F470720

General Info

Members Datasets Scaffolds Average Seq Length
629 337 1258 309

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1002675|Ga0081540_100267511
Length 346
Sequence MNQRTAPSTVVAGTTGHVLALCGGIGGAKLALGLYQVLPPDGLTVVVNTGDDFEHLGLHVSPDLDTVLYTLAGWSDPVRGWGRADETWHFMESLQALGGPDWFRLGDRDLAMHVIRTRWLQRGETLTAFARHVGQRMGIRAHILPMSDDPVHTLVDTTEGPLAFQNYFVGRHCDPVVTGIRFDGSERARPSPELLQAFARPDLAAIVICPSNPYLSVDPLLSIAGIRTALSTAAAPVIAVSPLIGGKAVKGPTDKIMAELGIAATTQAIAAHYGDLLDGLVIDEGDAADAPQLGIPTEVTSTLMRDVNDRRRLARHVLRFADSIAPNRAAGPGTKHDARRAVGAGK

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
234 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
301 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
324 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
325 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
326 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
327 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
328 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
329 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
330 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
331 2906610324
332 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
333 2922425934
334 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
335 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
336 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
337 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 0.48
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.56
Nodule 1.27
Rhizoplane 4.13
Rhizosphere 84.58
Stem 0
Stem Tuber 0
Unclassified 10.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1002675 3300005983 Bacteria 14504
2 JGI24751J29686_10000121 3300002459 Bacteria 39114
3 JGI24751J29686_10000239 3300002459 Bacteria 22167
4 rootH1_10243999 3300003323 Bacteria 1744
5 Ga0055530_10000160 3300003791 Bacteria 61095
6 Ga0055531_10002350 3300003794 Bacteria 12734
7 Ga0065165_1000876 3300005262 Bacteria 38977
8 Ga0065712_10078845 3300005290 Unclassified 3263
9 Ga0065715_10007581 3300005293 Bacteria 3297
10 Ga0065707_10137793 3300005295 Bacteria 1815
11 Ga0065707_10184717 3300005295 Bacteria 1396
12 Ga0070658_10036814 3300005327 Unclassified 3944
13 Ga0070658_10277351 3300005327 Bacteria 1426
14 Ga0070676_10029500 3300005328 Unclassified 3121
15 Ga0070676_10182392 3300005328 Bacteria 1366
16 Ga0070683_100039594 3300005329 Bacteria 4328
17 Ga0070683_100276382 3300005329 Bacteria 1598
18 Ga0070690_100056620 3300005330 Unclassified 2514
19 Ga0070670_100000028 3300005331 Bacteria 184816
20 Ga0070670_100002970 3300005331 Bacteria 14048
21 Ga0070666_10015019 3300005335 Bacteria 4934
22 Ga0070680_100005296 3300005336 Bacteria 9760
23 Ga0070680_100060653 3300005336 Bacteria 3095
24 Ga0070682_100000875 3300005337 Bacteria 17553
25 Ga0068868_100070560 3300005338 Unclassified 2786
26 Ga0070660_100012801 3300005339 Bacteria 5997
27 Ga0070660_100050505 3300005339 Bacteria 3200
28 Ga0070687_100065771 3300005343 Unclassified 1930
29 Ga0070661_100166242 3300005344 Bacteria 1673
30 Ga0070668_100004010 3300005347 Bacteria 10894
31 Ga0070668_100012363 3300005347 Bacteria 6357
32 Ga0070668_100064751 3300005347 Bacteria 2834
33 Ga0070668_100071294 3300005347 Bacteria 2706
34 Ga0070668_100096091 3300005347 Bacteria 2341
35 Ga0070668_100154375 3300005347 Bacteria 1859
36 Ga0070669_100000005 3300005353 Bacteria 309134
37 Ga0070669_100008410 3300005353 Bacteria 7365
38 Ga0070671_100003669 3300005355 Bacteria 12033
39 Ga0070671_100031151 3300005355 Bacteria 4405
40 Ga0070671_100032929 3300005355 Bacteria 4284
41 Ga0070674_100001074 3300005356 Bacteria 14307
42 Ga0070674_100025268 3300005356 Unclassified 3865
43 Ga0070674_100206154 3300005356 Bacteria 1521
44 Ga0070673_100023660 3300005364 Bacteria 4491
45 Ga0070673_100098477 3300005364 Bacteria 2404
46 Ga0070659_100105454 3300005366 Bacteria 2271
47 Ga0070667_100006070 3300005367 Bacteria 10031
48 Ga0070667_100032495 3300005367 Bacteria 4353
49 Ga0070667_100065066 3300005367 Bacteria 3095
50 Ga0070667_100101834 3300005367 Bacteria 2481
51 Ga0070714_100074099 3300005435 Unclassified 2951
52 Ga0070713_100112964 3300005436 Bacteria 2371
53 Ga0070713_100176544 3300005436 Bacteria 1917
54 Ga0070710_10020294 3300005437 Bacteria 3446
55 Ga0070705_100189964 3300005440 Bacteria 1399
56 Ga0070663_100046515 3300005455 Unclassified 3071
57 Ga0070678_100007457 3300005456 Bacteria 6494
58 Ga0070678_100212010 3300005456 Unclassified 1605
59 Ga0070662_100045878 3300005457 Bacteria 3138
60 Ga0070662_100069749 3300005457 Unclassified 2588
61 Ga0070681_10025471 3300005458 Bacteria 5950
62 Ga0070681_10155127 3300005458 Unclassified 2215
63 Ga0068867_100264854 3300005459 Bacteria 1403
64 Ga0070706_100190847 3300005467 Bacteria 1914
65 Ga0070706_100208245 3300005467 Bacteria 1826
66 Ga0070707_100084947 3300005468 Bacteria 3058
67 Ga0070707_100276240 3300005468 Bacteria 1633
68 Ga0070698_100027663 3300005471 Bacteria 5895
69 Ga0070699_100003205 3300005518 Bacteria 14472
70 Ga0070699_100227900 3300005518 Bacteria 1661
71 Ga0070679_100051285 3300005530 Bacteria 4109
72 Ga0070679_100075439 3300005530 Unclassified 3361
73 Ga0070679_100078969 3300005530 Bacteria 3280
74 Ga0070679_100107517 3300005530 Bacteria 2775
75 Ga0070684_100023583 3300005535 Bacteria 5150
76 Ga0070684_100254300 3300005535 Unclassified 1606
77 Ga0070684_100393061 3300005535 Bacteria 1278
78 Ga0070697_100114216 3300005536 Bacteria 2253
79 Ga0068853_100056080 3300005539 Bacteria 3397
80 Ga0068853_100406402 3300005539 Unclassified 1275
81 Ga0070686_100031151 3300005544 Bacteria 3259
82 Ga0070696_100063908 3300005546 Unclassified 2579
83 Ga0070693_100001366 3300005547 Bacteria 10987
84 Ga0070693_100139784 3300005547 Unclassified 1523
85 Ga0070665_100002758 3300005548 Bacteria 19041
86 Ga0070665_100068940 3300005548 Bacteria 3545
87 Ga0070665_100090025 3300005548 Bacteria 3074
88 Ga0070665_100091370 3300005548 Bacteria 3049
89 Ga0070665_100201531 3300005548 Bacteria 1991
90 Ga0070665_100240625 3300005548 Bacteria 1811
91 Ga0068855_100000377 3300005563 Bacteria 55242
92 Ga0068855_100013895 3300005563 Bacteria 9710
93 Ga0068855_100015775 3300005563 Bacteria 9089
94 Ga0068855_100040151 3300005563 Bacteria 5555
95 Ga0068855_100151518 3300005563 Bacteria 2637
96 Ga0068855_100213921 3300005563 Unclassified 2165
97 Ga0070664_100005626 3300005564 Bacteria 10087
98 Ga0068856_100101636 3300005614 Bacteria 2868
99 Ga0068856_100570607 3300005614 Bacteria 1153
100 Ga0068859_100002359 3300005617 Bacteria 19224
101 Ga0068859_100015463 3300005617 Bacteria 7666
102 Ga0068859_100021499 3300005617 Bacteria 6476
103 Ga0068859_100198677 3300005617 Bacteria 2090
104 Ga0068859_100655101 3300005617 Bacteria 1142
105 Ga0068864_100000049 3300005618 Bacteria 143621
106 Ga0068864_100130919 3300005618 Bacteria 2253
107 Ga0068861_100028708 3300005719 Bacteria 4061
108 Ga0068861_100165609 3300005719 Bacteria 1828
109 Ga0068861_100172951 3300005719 Unclassified 1791
110 Ga0068870_10046874 3300005840 Bacteria 2269
111 Ga0068863_100028293 3300005841 Bacteria 5351
112 Ga0068863_100038479 3300005841 Bacteria 4551
113 Ga0068863_100049400 3300005841 Bacteria 3989
114 Ga0068863_100074799 3300005841 Bacteria 3205
115 Ga0068858_100019679 3300005842 Bacteria 6311
116 Ga0068858_100038408 3300005842 Bacteria 4440
117 Ga0068858_100178424 3300005842 Bacteria 2005
118 Ga0068858_100551810 3300005842 Bacteria 1115
119 Ga0068860_100000015 3300005843 Bacteria 313639
120 Ga0068860_100026398 3300005843 Bacteria 5599
121 Ga0068860_100083856 3300005843 Bacteria 3032
122 Ga0068860_100231104 3300005843 Unclassified 1797
123 Ga0068860_100298714 3300005843 Bacteria 1577
124 Ga0068862_100000005 3300005844 Bacteria 350713
125 Ga0068862_100008281 3300005844 Bacteria 8601
126 Ga0068862_100328744 3300005844 Bacteria 1413
127 Ga0081455_10000911 3300005937 Bacteria 37905
128 Ga0081455_10001814 3300005937 Bacteria 25739
129 Ga0081455_10002979 3300005937 Bacteria 19784
130 Ga0081455_10083907 3300005937 Bacteria 2602
131 Ga0081455_10148715 3300005937 Bacteria 1808
132 Ga0081538_10003874 3300005981 Bacteria 13978
133 Ga0081540_1000768 3300005983 Bacteria 29471
134 Ga0081540_1005330 3300005983 Bacteria 9623
135 Ga0081540_1012027 3300005983 Bacteria 5731
136 Ga0081540_1015550 3300005983 Bacteria 4813
137 Ga0081539_10002318 3300005985 Bacteria 27421
138 Ga0081539_10007392 3300005985 Bacteria 10042
139 Ga0070717_10064871 3300006028 Bacteria 3034
140 Ga0075365_10053933 3300006038 Bacteria 2664
141 Ga0075365_10081496 3300006038 Bacteria 2192
142 Ga0075365_10094624 3300006038 Bacteria 2039
143 Ga0075365_10236284 3300006038 Bacteria 1284
144 Ga0075368_10038867 3300006042 Bacteria 1864
145 Ga0070715_10034864 3300006163 Bacteria 2066
146 Ga0070716_100147083 3300006173 Bacteria 1511
147 Ga0070716_100150424 3300006173 Bacteria 1496
148 Ga0070712_100016273 3300006175 Bacteria 4803
149 Ga0070712_100024409 3300006175 Bacteria 4006
150 Ga0070712_100067138 3300006175 Bacteria 2551
151 Ga0070712_100069514 3300006175 Bacteria 2512
152 Ga0070712_100179299 3300006175 Bacteria 1650
153 Ga0070712_100462873 3300006175 Unclassified 1058
154 Ga0075362_10021926 3300006177 Bacteria 2687
155 Ga0075362_10093795 3300006177 Bacteria 1396
156 Ga0075362_10102484 3300006177 Bacteria 1340
157 Ga0075367_10106280 3300006178 Bacteria 1720
158 Ga0075369_10001265 3300006186 Bacteria 8610
159 Ga0075430_100178381 3300006846 Bacteria 1767
160 Ga0075433_10274541 3300006852 Unclassified 1494
161 Ga0075434_100037101 3300006871 Bacteria 4824
162 Ga0075434_100040063 3300006871 Bacteria 4640
163 Ga0075434_100065890 3300006871 Bacteria 3608
164 Ga0075434_100080504 3300006871 Unclassified 3254
165 Ga0075434_100367584 3300006871 Bacteria 1459
166 Ga0068865_100059833 3300006881 Bacteria 2666
167 Ga0068865_100454444 3300006881 Unclassified 1060
168 Ga0075436_100051558 3300006914 Bacteria 2840
169 Ga0097620_100002358 3300006931 Bacteria 19224
170 Ga0097620_100015464 3300006931 Bacteria 7666
171 Ga0097620_100021501 3300006931 Bacteria 6476
172 Ga0097620_100198670 3300006931 Bacteria 2090
173 Ga0097620_100655057 3300006931 Bacteria 1142
174 Ga0079104_1000772 3300006946 Bacteria 27473
175 Ga0075435_100022064 3300007076 Bacteria 4908
176 Ga0075435_100048000 3300007076 Bacteria 3429
177 Ga0075435_100097348 3300007076 Bacteria 2435
178 Ga0075435_100102005 3300007076 Bacteria 2378
179 Ga0099794_10033323 3300007265 Bacteria 2422
180 Ga0099795_10002642 3300007788 Bacteria 4265
181 Ga0099795_10005682 3300007788 Unclassified 3342
182 Ga0105251_10103296 3300009011 Bacteria 1302
183 Ga0105240_10004270 3300009093 Bacteria 21845
184 Ga0105240_10004805 3300009093 Bacteria 20362
185 Ga0105240_10005113 3300009093 Bacteria 19635
186 Ga0105240_10301112 3300009093 Bacteria 1834
187 Ga0105240_10457767 3300009093 Bacteria 1426
188 Ga0111539_10002851 3300009094 Bacteria 22970
189 Ga0111539_10198153 3300009094 Bacteria 2342
190 Ga0111539_10278202 3300009094 Unclassified 1948
191 Ga0105245_10058063 3300009098 Bacteria 3482
192 Ga0105245_10346150 3300009098 Bacteria 1471
193 Ga0114129_10097200 3300009147 Bacteria 4076
194 Ga0114129_10170974 3300009147 Bacteria 2963
195 Ga0105242_10142576 3300009176 Bacteria 2081
196 Ga0105242_10161645 3300009176 Bacteria 1961
197 Ga0105242_10161972 3300009176 Bacteria 1959
198 Ga0105248_10000648 3300009177 Bacteria 39487
199 Ga0105248_10001188 3300009177 Bacteria 29131
200 Ga0105248_10028613 3300009177 Bacteria 6210
201 Ga0105248_10067306 3300009177 Bacteria 4021
202 Ga0105248_10074970 3300009177 Bacteria 3803
203 Ga0105237_10022316 3300009545 Bacteria 6496
204 Ga0105237_10175276 3300009545 Bacteria 2145
205 Ga0105237_10230830 3300009545 Unclassified 1851
206 Ga0105237_10279991 3300009545 Bacteria 1670
207 Ga0105237_10299352 3300009545 Bacteria 1612
208 Ga0105237_10422583 3300009545 Bacteria 1338
209 Ga0105238_10091522 3300009551 Bacteria 3029
210 Ga0105238_10122024 3300009551 Bacteria 2585
211 Ga0105238_10135258 3300009551 Bacteria 2443
212 Ga0105238_10219192 3300009551 Bacteria 1878
213 Ga0105238_10332827 3300009551 Bacteria 1505
214 Ga0099796_10001277 3300010159 Bacteria 4960
215 Ga0099796_10001432 3300010159 Bacteria 4796
216 Ga0105239_10028723 3300010375 Bacteria 6115
217 Ga0105239_10032846 3300010375 Bacteria 5702
218 Ga0105239_10124785 3300010375 Bacteria 2861
219 Ga0105239_10184936 3300010375 Bacteria 2332
220 Ga0105246_10022061 3300011119 Unclassified 4106
221 Ga0157343_1001253 3300012488 Bacteria 1208
222 Ga0157373_10020217 3300013100 Bacteria 4843
223 Ga0157370_10025630 3300013104 Bacteria 5835
224 Ga0157369_10010262 3300013105 Bacteria 10687
225 Ga0157369_10129848 3300013105 Bacteria 2671
226 Ga0157374_10032780 3300013296 Bacteria 4734
227 Ga0157374_10034035 3300013296 Bacteria 4652
228 Ga0157374_10215193 3300013296 Bacteria 1885
229 Ga0157378_10012472 3300013297 Bacteria 7442
230 Ga0163162_10040173 3300013306 Bacteria 4677
231 Ga0163162_10053053 3300013306 Unclassified 4074
232 Ga0163162_10065459 3300013306 Unclassified 3682
233 Ga0163162_10131244 3300013306 Bacteria 2614
234 Ga0157372_10015520 3300013307 Bacteria 8165
235 Ga0157372_10029583 3300013307 Bacteria 5983
236 Ga0157372_10710133 3300013307 Unclassified 1170
237 Ga0157375_10025368 3300013308 Bacteria 5507
238 Ga0163163_10004279 3300014325 Bacteria 12164
239 Ga0163163_10021678 3300014325 Bacteria 6066
240 Ga0163163_10185985 3300014325 Bacteria 2125
241 Ga0157380_10000023 3300014326 Bacteria 113686
242 Ga0157380_10147401 3300014326 Bacteria 2030
243 Ga0157379_10000560 3300014968 Bacteria 29968
244 Ga0157379_10032106 3300014968 Bacteria 4679
245 Ga0157379_10319171 3300014968 Bacteria 1418
246 Ga0157376_10006701 3300014969 Bacteria 8154
247 Ga0163161_10089138 3300017792 Bacteria 2281
248 Ga0206356_11726480 3300020070 Bacteria 5017
249 Ga0206354_10397507 3300020081 Bacteria 1280
250 Ga0213872_10044729 3300021361 Bacteria 2015
251 Ga0213875_10011302 3300021388 Bacteria 4446
252 Ga0213871_10002813 3300021441 Bacteria 3258
253 Ga0209050_1000130 3300025298 Bacteria 186070
254 Ga0209257_1000059 3300025304 Bacteria 378097
255 Ga0209257_1000676 3300025304 Bacteria 53204
256 Ga0207697_10009506 3300025315 Unclassified 4197
257 Ga0207688_10011741 3300025901 Unclassified 4765
258 Ga0207688_10015017 3300025901 Bacteria 4202
259 Ga0207680_10203403 3300025903 Unclassified 1351
260 Ga0207699_10094467 3300025906 Bacteria 1883
261 Ga0207645_10003794 3300025907 Bacteria 11344
262 Ga0207643_10020632 3300025908 Bacteria 3616
263 Ga0207707_10028717 3300025912 Bacteria 4860
264 Ga0207707_10079587 3300025912 Bacteria 2861
265 Ga0207707_10299656 3300025912 Bacteria 1390
266 Ga0207695_10002655 3300025913 Bacteria 26142
267 Ga0207695_10020027 3300025913 Bacteria 7678
268 Ga0207695_10049213 3300025913 Bacteria 4445
269 Ga0207695_10258799 3300025913 Bacteria 1638
270 Ga0207671_10058078 3300025914 Bacteria 2868
271 Ga0207671_10174315 3300025914 Bacteria 1671
272 Ga0207693_10001175 3300025915 Bacteria 23359
273 Ga0207693_10041393 3300025915 Bacteria 3627
274 Ga0207693_10106339 3300025915 Bacteria 2201
275 Ga0207663_10239395 3300025916 Bacteria 1330
276 Ga0207660_10014405 3300025917 Bacteria 5201
277 Ga0207660_10122971 3300025917 Bacteria 1967
278 Ga0207662_10020281 3300025918 Bacteria 3791
279 Ga0207657_10011431 3300025919 Bacteria 8814
280 Ga0207657_10137970 3300025919 Bacteria 1994
281 Ga0207649_10071294 3300025920 Unclassified 2219
282 Ga0207652_10023691 3300025921 Bacteria 5088
283 Ga0207652_10098811 3300025921 Bacteria 2575
284 Ga0207652_10102454 3300025921 Bacteria 2530
285 Ga0207652_10140142 3300025921 Unclassified 2162
286 Ga0207681_10000003 3300025923 Bacteria 713245
287 Ga0207681_10044641 3300025923 Bacteria 2971
288 Ga0207681_10071160 3300025923 Bacteria 2425
289 Ga0207694_10069042 3300025924 Bacteria 2761
290 Ga0207694_10190037 3300025924 Bacteria 1668
291 Ga0207694_10232707 3300025924 Bacteria 1505
292 Ga0207650_10000012 3300025925 Bacteria 437889
293 Ga0207650_10008129 3300025925 Bacteria 7150
294 Ga0207650_10204348 3300025925 Unclassified 1584
295 Ga0207659_10152278 3300025926 Bacteria 1807
296 Ga0207659_10162930 3300025926 Bacteria 1753
297 Ga0207659_10418357 3300025926 Bacteria 1124
298 Ga0207687_10227289 3300025927 Unclassified 1472
299 Ga0207664_10015531 3300025929 Bacteria 5530
300 Ga0207644_10049444 3300025931 Unclassified 3010
301 Ga0207644_10053433 3300025931 Bacteria 2906
302 Ga0207644_10096351 3300025931 Bacteria 2214
303 Ga0207706_10015463 3300025933 Bacteria 6894
304 Ga0207706_10057430 3300025933 Bacteria 3429
305 Ga0207686_10134871 3300025934 Bacteria 1698
306 Ga0207669_10003139 3300025937 Bacteria 7124
307 Ga0207669_10121374 3300025937 Bacteria 1775
308 Ga0207704_10083020 3300025938 Unclassified 2078
309 Ga0207704_10416859 3300025938 Unclassified 1064
310 Ga0207665_10036241 3300025939 Bacteria 3279
311 Ga0207691_10166986 3300025940 Bacteria 1928
312 Ga0207711_10001582 3300025941 Bacteria 21003
313 Ga0207711_10003491 3300025941 Bacteria 13605
314 Ga0207711_10367855 3300025941 Bacteria 1333
315 Ga0207689_10085665 3300025942 Bacteria 2590
316 Ga0207679_10015119 3300025945 Bacteria 5091
317 Ga0207679_10033445 3300025945 Unclassified 3617
318 Ga0207667_10000537 3300025949 Bacteria 50070
319 Ga0207667_10015425 3300025949 Bacteria 8679
320 Ga0207667_10096071 3300025949 Unclassified 3058
321 Ga0207667_10164272 3300025949 Bacteria 2283
322 Ga0207667_10331208 3300025949 Bacteria 1554
323 Ga0207712_10095008 3300025961 Unclassified 2203
324 Ga0207668_10002414 3300025972 Bacteria 10926
325 Ga0207668_10014928 3300025972 Bacteria 4817
326 Ga0207668_10040088 3300025972 Bacteria 3157
327 Ga0207668_10107578 3300025972 Bacteria 2085
328 Ga0207640_10085895 3300025981 Unclassified 2165
329 Ga0207658_10008558 3300025986 Bacteria 6961
330 Ga0207658_10099421 3300025986 Bacteria 2275
331 Ga0207658_10160293 3300025986 Unclassified 1843
332 Ga0207703_10017588 3300026035 Bacteria 5582
333 Ga0207639_10016877 3300026041 Bacteria 5173
334 Ga0207639_10096244 3300026041 Unclassified 2381
335 Ga0207639_10260151 3300026041 Bacteria 1517
336 Ga0207678_10008165 3300026067 Bacteria 9231
337 Ga0207678_10008770 3300026067 Bacteria 8895
338 Ga0207702_10043554 3300026078 Bacteria 3769
339 Ga0207702_10146379 3300026078 Bacteria 2144
340 Ga0207702_10422322 3300026078 Bacteria 1289
341 Ga0207702_10491809 3300026078 Bacteria 1195
342 Ga0207641_10005395 3300026088 Bacteria 10923
343 Ga0207648_10076115 3300026089 Unclassified 2925
344 Ga0207676_10000009 3300026095 Bacteria 545256
345 Ga0207676_10004446 3300026095 Bacteria 9916
346 Ga0207676_10110534 3300026095 Bacteria 2299
347 Ga0207674_10163206 3300026116 Bacteria 2182
348 Ga0207674_10295941 3300026116 Bacteria 1567
349 Ga0207675_100154296 3300026118 Unclassified 2188
350 Ga0207675_100159120 3300026118 Bacteria 2153
351 Ga0207683_10016277 3300026121 Bacteria 6328
352 Ga0207683_10101024 3300026121 Bacteria 2575
353 Ga0207683_10251912 3300026121 Bacteria 1611
354 Ga0207698_10170123 3300026142 Bacteria 1917
355 Ga0209281_1000839 3300027111 Bacteria 27458
356 Ga0209974_10031705 3300027876 Bacteria 1750
357 Ga0207428_10080071 3300027907 Bacteria 2553
358 Ga0268266_10022698 3300028379 Bacteria 5342
359 Ga0268266_10030849 3300028379 Bacteria 4552
360 Ga0268266_10077686 3300028379 Bacteria 2887
361 Ga0268266_10295722 3300028379 Bacteria 1509
362 Ga0268265_10000001 3300028380 Bacteria 1230727
363 Ga0268265_10064026 3300028380 Bacteria 2831
364 Ga0268265_10111252 3300028380 Bacteria 2236
365 Ga0268265_10228111 3300028380 Bacteria 1635
366 Ga0268265_10255236 3300028380 Unclassified 1556
367 Ga0268265_10537412 3300028380 Bacteria 1107
368 Ga0268264_10000002 3300028381 Bacteria 1153045
369 Ga0268264_10000014 3300028381 Bacteria 509962
370 Ga0268264_10029293 3300028381 Bacteria 4507
371 Ga0307515_10179830 3300028794 Bacteria 2070
372 Ga0307511_10089556 3300030521 Bacteria 2096
373 Ga0307513_10000063 3300031456 Bacteria 142538
374 Ga0307508_10000235 3300031616 Bacteria 67350
375 Ga0307514_10087303 3300031649 Bacteria 2286
376 Ga0307516_10118288 3300031730 Bacteria 2444
377 Ga0307405_10227515 3300031731 Bacteria 1373
378 Ga0307405_10239350 3300031731 Bacteria 1343
379 Ga0316577_10001464 3300031733 Bacteria 11170
380 Ga0307415_100120767 3300032126 Bacteria 1964
381 Ga0307507_10159020 3300033179 Bacteria 1675
382 Ga0373945_0036276 3300035116 Unclassified 1766
383 Ga0373960_0047240 3300035121 Unclassified 1266
384 Ga0373943_0004903 3300035170 Bacteria 6045
385 Ga0373946_0029240 3300035171 Unclassified 2192
386 Ga0373946_0159010 3300035171 Bacteria 1059
387 Ga0373955_0001957 3300035172 Bacteria 8867
388 Ga0373955_0051431 3300035172 Bacteria 2244
389 Ga0373955_0119705 3300035172 Bacteria 1530
390 Ga0373955_0180238 3300035172 Bacteria 1253
391 Ga0373955_0218276 3300035172 Bacteria 1138
392 Ga0373942_0003301 3300035207 Bacteria 3797
393 Ga0373962_0011051 3300035242 Bacteria 2257
394 Ga0373924_0011836 3300035410 Unclassified 3248
395 Ga0373931_0000538 3300035691 Bacteria 15536
396 Ga0373935_0055321 3300035692 Bacteria 2528
397 Ga0373935_0133847 3300035692 Bacteria 1668
398 Ga0373935_0316716 3300035692 Bacteria 1106
399 Ga0373927_0019179 3300035695 Bacteria 4485
400 Ga0373927_0067100 3300035695 Bacteria 2321
401 Ga0373927_0149946 3300035695 Bacteria 1527
402 Ga0373933_0026191 3300035724 Bacteria 3348
403 Ga0373937_0000963 3300036401 Bacteria 24397
404 Ga0373937_0002673 3300036401 Bacteria 14860
405 Ga0373937_0015459 3300036401 Bacteria 6749
406 Ga0373937_0023031 3300036401 Bacteria 5603
407 Ga0373937_0138386 3300036401 Bacteria 2277
408 Ga0373937_0443054 3300036401 Bacteria 1233
409 Ga0373937_0466052 3300036401 Bacteria 1200
410 Ga0372808_008761 3300036459 Bacteria 1406
411 Ga0316582_0008193 3300036647 Bacteria 5605
412 Ga0373925_0047870 3300037068 Unclassified 3184
413 Ga0373925_0099956 3300037068 Bacteria 2228
414 Ga0373925_0413839 3300037068 Bacteria 1101
415 Ga0395898_0030064 3300037466 Bacteria 5439
416 Ga0395905_0222647 3300037471 Bacteria 1766
417 Ga0316581_0000539 3300037588 Bacteria 7383
418 Ga0436364_0489334 3300037853 Bacteria 3448
419 Ga0395901_0513290 3300038443 Bacteria 1219
420 Ga0436365_0709029 3300039437 Bacteria 3559
421 Ga0436365_1934348 3300039437 Bacteria 2621
422 Ga0436360_0140826 3300039438 Bacteria 5906
423 Ga0436361_0187044 3300039447 Bacteria 4670
424 Ga0436361_0374903 3300039447 Bacteria 15048
425 Ga0436361_0603954 3300039447 Bacteria 1239
426 Ga0439444_0004852 3300042437 Bacteria 1971
427 Ga0451577_0085989 3300042876 Bacteria 2805
428 Ga0466966_0135404 3300044684 Bacteria 1507
429 Ga0466963_0130091 3300044694 Bacteria 1738
430 Ga0466963_0270892 3300044694 Bacteria 1193
431 Ga0451576_0126977 3300045051 Bacteria 2657
432 Ga0466967_0047935 3300045976 Bacteria 3728
433 Ga0466967_0055484 3300045976 Bacteria 3490
434 Ga0466967_0106676 3300045976 Bacteria 2568
435 Ga0466967_0219368 3300045976 Bacteria 1806
436 Ga0466967_0236089 3300045976 Bacteria 1742
437 Ga0495627_035172 3300046453 Bacteria 1562
438 Ga0495592_0011234 3300046454 Bacteria 6769
439 Ga0495592_0035241 3300046454 Bacteria 3771
440 Ga0495603_0010292 3300046455 Bacteria 5661
441 Ga0495603_0049171 3300046455 Bacteria 2510
442 Ga0495603_0083438 3300046455 Bacteria 1871
443 Ga0495603_0220405 3300046455 Bacteria 1095
444 Ga0495591_044879 3300046458 Bacteria 1235
445 Ga0495629_0000708 3300046459 Bacteria 27003
446 Ga0495629_0026876 3300046459 Bacteria 4087
447 Ga0495641_0025898 3300046461 Bacteria 2872
448 Ga0495651_0214706 3300046462 Bacteria 1336
449 Ga0495580_0007173 3300046472 Bacteria 8971
450 Ga0495580_0067615 3300046472 Bacteria 2499
451 Ga0495580_0146115 3300046472 Unclassified 1639
452 Ga0495582_0003136 3300046473 Bacteria 9274
453 Ga0495605_0011490 3300046474 Bacteria 4931
454 Ga0495639_0002986 3300046475 Bacteria 7366
455 Ga0495662_0037222 3300046476 Bacteria 2349
456 Ga0495584_0023198 3300046491 Bacteria 3146
457 Ga0495585_0063826 3300046492 Bacteria 2020
458 Ga0495585_0081390 3300046492 Bacteria 1754
459 Ga0495594_0011820 3300046499 Bacteria 4540
460 Ga0495594_0080614 3300046499 Bacteria 1817
461 Ga0495607_0037443 3300046501 Bacteria 2914
462 Ga0495606_0003152 3300046507 Bacteria 17859
463 Ga0495610_0083327 3300046512 Unclassified 1464
464 Ga0495618_0033151 3300046514 Bacteria 3238
465 Ga0495628_0022426 3300046516 Bacteria 5185
466 Ga0495628_0031053 3300046516 Bacteria 4321
467 Ga0495628_0266145 3300046516 Bacteria 1276
468 Ga0495630_0023574 3300046517 Bacteria 4549
469 Ga0495630_0120073 3300046517 Bacteria 1994
470 Ga0495631_0022343 3300046518 Bacteria 2941
471 Ga0495632_0178435 3300046519 Bacteria 973
472 Ga0495644_0012121 3300046523 Bacteria 3314
473 Ga0495644_0032199 3300046523 Bacteria 1981
474 Ga0495663_0007602 3300046525 Bacteria 2999
475 Ga0495642_0041365 3300046528 Bacteria 1874
476 Ga0495665_0002120 3300046531 Bacteria 10739
477 Ga0495640_0018279 3300046533 Bacteria 5204
478 Ga0495640_0180388 3300046533 Unclassified 1346
479 Ga0495587_0047636 3300046536 Bacteria 2541
480 Ga0495587_0099131 3300046536 Bacteria 1679
481 Ga0495598_0001255 3300046537 Bacteria 4942
482 Ga0495609_0025153 3300046538 Bacteria 2730
483 Ga0495621_0003514 3300046539 Bacteria 4325
484 Ga0495645_0037534 3300046543 Bacteria 3533
485 Ga0495622_0001772 3300046557 Bacteria 10652
486 Ga0495622_0107659 3300046557 Bacteria 1277
487 Ga0495633_0010280 3300046558 Bacteria 5116
488 Ga0495667_0025811 3300046559 Bacteria 3958
489 Ga0495634_0006007 3300046642 Bacteria 9266
490 Ga0495611_0067446 3300046648 Bacteria 1632
491 Ga0495635_0004326 3300046663 Bacteria 9836
492 Ga0495635_0042637 3300046663 Bacteria 3133
493 Ga0495635_0083844 3300046663 Bacteria 2181
494 Ga0495659_0001567 3300046664 Bacteria 7690
495 Ga0495661_0054038 3300046665 Bacteria 2413
496 Ga0495588_0001004 3300046674 Bacteria 12297
497 Ga0495588_0049392 3300046674 Bacteria 2163
498 Ga0495599_0015549 3300046678 Bacteria 4724
499 Ga0495599_0063188 3300046678 Bacteria 2313
500 Ga0495646_0014099 3300046680 Bacteria 5083
501 Ga0495646_0022490 3300046680 Bacteria 3977
502 Ga0495647_0007563 3300046681 Bacteria 3646
503 Ga0495658_0001960 3300046683 Bacteria 10528
504 Ga0495658_0158250 3300046683 Bacteria 1395
505 Ga0495669_0009434 3300046684 Bacteria 4114
506 Ga0495669_0040839 3300046684 Unclassified 2058
507 Ga0495613_0022995 3300046689 Bacteria 4645
508 Ga0495613_0187023 3300046689 Bacteria 1465
509 Ga0495624_0003274 3300046690 Bacteria 12069
510 Ga0495624_0083716 3300046690 Bacteria 1972
511 Ga0495671_0015183 3300046692 Bacteria 4134
512 Ga0495649_0021737 3300046694 Bacteria 3594
513 Ga0495660_0165676 3300046810 Bacteria 1080
514 Ga0495581_0001031 3300047315 Bacteria 15076
515 Ga0495581_0031887 3300047315 Bacteria 3053
516 Ga0495604_0028410 3300047317 Bacteria 4450
517 Ga0495604_0079495 3300047317 Bacteria 2459
518 Ga0495636_0013525 3300047318 Bacteria 3239
519 Ga0495674_0168083 3300047319 Bacteria 1831
520 Ga0495672_0001235 3300047320 Bacteria 25666
521 Ga0495672_0009814 3300047320 Bacteria 6889
522 Ga0495676_0012956 3300047321 Bacteria 7502
523 Ga0495683_0019905 3300047323 Bacteria 3462
524 Ga0495675_0002021 3300047444 Bacteria 12122
525 Ga0495677_0005216 3300047445 Bacteria 4942
526 Ga0495679_014512 3300047446 Bacteria 2916
527 Ga0495685_008090 3300047447 Bacteria 3483
528 Ga0495684_0086112 3300047471 Bacteria 2382
529 Ga0495593_0001063 3300047673 Bacteria 16031
530 Ga0495602_0022198 3300048088 Bacteria 6221
531 Ga0495602_0170769 3300048088 Bacteria 1688
532 Ga0495614_0045333 3300048089 Bacteria 1886
533 Ga0496100_0133798 3300048903 Bacteria 1749
534 Ga0496100_0282737 3300048903 Unclassified 1237
535 Ga0496104_0026760 3300048907 Bacteria 5330
536 Ga0496104_0071171 3300048907 Bacteria 3306
537 Ga0496105_0013758 3300048908 Bacteria 6424
538 Ga0496106_0148806 3300048909 Unclassified 1846
539 Ga0496108_0138240 3300048911 Bacteria 2098
540 Ga0496108_0227673 3300048911 Unclassified 1621
541 Ga0496109_0284871 3300048912 Bacteria 1557
542 Ga0496111_0146130 3300048914 Bacteria 1753
543 Ga0496111_0162474 3300048914 Bacteria 1658
544 Ga0496112_0001395 3300048915 Bacteria 18455
545 Ga0496112_0004066 3300048915 Bacteria 12278
546 Ga0496112_0006762 3300048915 Bacteria 10103
547 Ga0496112_0037930 3300048915 Bacteria 4706
548 Ga0496112_0081619 3300048915 Bacteria 3198
549 Ga0496112_0187398 3300048915 Bacteria 2032
550 Ga0496112_0222100 3300048915 Bacteria 1845
551 Ga0496113_0026364 3300048916 Bacteria 4154
552 Ga0496113_0245203 3300048916 Unclassified 1430
553 Ga0496113_0295371 3300048916 Bacteria 1297
554 Ga0496114_0179683 3300048917 Bacteria 1847
555 Ga0496115_0003088 3300048918 Bacteria 11959
556 Ga0496115_0008572 3300048918 Bacteria 7569
557 Ga0496115_0027208 3300048918 Bacteria 4471
558 Ga0496115_0070637 3300048918 Bacteria 2831
559 Ga0496118_0020190 3300048921 Bacteria 5918
560 Ga0496121_0000473 3300048924 Bacteria 78228
561 Ga0496121_0044274 3300048924 Bacteria 3842
562 Ga0496124_0134265 3300048927 Bacteria 1962
563 Ga0496126_0074768 3300048929 Bacteria 3008
564 Ga0496126_0193487 3300048929 Bacteria 1721
565 Ga0496126_0256883 3300048929 Bacteria 1454
566 Ga0496126_0259778 3300048929 Bacteria 1445
567 Ga0501034_0039056 3300049571 Bacteria 4808
568 Ga0501034_0245180 3300049571 Bacteria 1737
569 Ga0501042_0223024 3300049578 Bacteria 1360
570 Ga0501047_0109726 3300049581 Bacteria 2642
571 Ga0501047_0219286 3300049581 Bacteria 1759
572 Ga0501079_0198985 3300049741 Bacteria 1565
573 Ga0501080_0019798 3300049742 Bacteria 6231
574 Ga0501035_0076835 3300049822 Bacteria 2952
575 Ga0501044_0004179 3300049823 Bacteria 16230
576 Ga0501044_0103349 3300049823 Bacteria 2864
577 Ga0501045_0077668 3300049824 Bacteria 2447
578 nmdc:mga03683_1158_c1 3300050489 Bacteria 7750
579 nmdc:mga03n38_82000_c1 3300050490 Bacteria 1517
580 nmdc:mga0yw44_12183_c1 3300050492 Bacteria 4472
581 nmdc:mga0yw44_13339_c2 3300050492 Bacteria 1560
582 nmdc:mga0yw44_316827_c1 3300050492 Bacteria 1047
583 nmdc:mga06z11_113025_c1 3300050494 Bacteria 1506
584 nmdc:mga06z11_51244_c1 3300050494 Bacteria 1708
585 nmdc:mga05p37_53800_c1 3300050507 Bacteria 4305
586 nmdc:mga0qj67_167941_c1 3300050509 Bacteria 1781
587 nmdc:mga08y16_4949_c1 3300050511 Bacteria 13919
588 nmdc:mga0n895_123311_c1 3300050512 Bacteria 2613
589 nmdc:mga0n895_475878_c1 3300050512 Unclassified 1260
590 nmdc:mga0n895_79674_c1 3300050512 Bacteria 3262
591 nmdc:mga0n895_92921_c1 3300050512 Bacteria 3020
592 nmdc:mga0rr50_215380_c1 3300050513 Bacteria 1584
593 nmdc:mga0rr50_26730_c1 3300050513 Bacteria 4032
594 nmdc:mga0rr50_292334_c1 3300050513 Unclassified 1362
595 nmdc:mga0rr50_382118_c1 3300050513 Unclassified 1187
596 nmdc:mga08x19_139814_c1 3300050514 Bacteria 1635
597 nmdc:mga0a205_130834_c1 3300050515 Unclassified 2410
598 nmdc:mga0a205_454802_c1 3300050515 Bacteria 1140
599 nmdc:mga0a205_53880_c1 3300050515 Unclassified 3882
600 nmdc:mga0sz30_34251_c1 3300050516 Bacteria 2113
601 nmdc:mga0sz30_792_c1 3300050516 Bacteria 11461
602 Ga0495601_0021569 3300053077 Bacteria 3945
603 Ga0495601_0158831 3300053077 Bacteria 1477
604 Ga0495612_0009848 3300053078 Bacteria 3869
605 Ga0495619_0107901 3300053085 Bacteria 1900
606 Ga0500651_0043528 3300053093 Bacteria 2827
607 Ga0500651_0112070 3300053093 Bacteria 1664
608 Ga0500641_0054821 3300053096 Bacteria 1649
609 Ga0500595_061535 3300053119 Bacteria 1133
610 Ga0500607_013356 3300053121 Bacteria 4794
611 Ga0500559_0031150 3300053136 Bacteria 2288
612 Ga0500616_0009378 3300053153 Bacteria 5960
613 Ga0500636_0000049 3300053177 Bacteria 57130
614 Ga0500637_0017995 3300053178 Bacteria 3791
615 Ga0500625_031492 3300053729 Unclassified 2516
616 2510246159 2510065045 Bacteria 7761063
617 2643728520 2643221541 Bacteria 5498788
618 2644392242 2643221671 Bacteria 5496681
619 2719637536 2718217991 Bacteria 7829542
620 2793073779 2791355197 Bacteria 8420563
621 2837654358 2837651117 Bacteria 3772164
622 2900643382 2900634093 Bacteria 10263517
623 2906611720
624 2919451166 2919450847 Bacteria 5631160
625 2922427642
626 3005477316 3005474847 Bacteria 9259049
627 8001848630 8001845381 Bacteria 5804942
628 8002290631 8002285264 Bacteria 6717907
629 8019559815 8019555841 Bacteria 9642137
630 Ga0081540_1002675
631 JGI24751J29686_10000121
632 JGI24751J29686_10000239
633 rootH1_10243999
634 Ga0055530_10000160
635 Ga0055531_10002350
636 Ga0065165_1000876
637 Ga0065712_10078845
638 Ga0065715_10007581
639 Ga0065707_10137793
640 Ga0065707_10184717
641 Ga0070658_10036814
642 Ga0070658_10277351
643 Ga0070676_10029500
644 Ga0070676_10182392
645 Ga0070683_100039594
646 Ga0070683_100276382
647 Ga0070690_100056620
648 Ga0070670_100000028
649 Ga0070670_100002970
650 Ga0070666_10015019
651 Ga0070680_100005296
652 Ga0070680_100060653
653 Ga0070682_100000875
654 Ga0068868_100070560
655 Ga0070660_100012801
656 Ga0070660_100050505
657 Ga0070687_100065771
658 Ga0070661_100166242
659 Ga0070668_100004010
660 Ga0070668_100012363
661 Ga0070668_100064751
662 Ga0070668_100071294
663 Ga0070668_100096091
664 Ga0070668_100154375
665 Ga0070669_100000005
666 Ga0070669_100008410
667 Ga0070671_100003669
668 Ga0070671_100031151
669 Ga0070671_100032929
670 Ga0070674_100001074
671 Ga0070674_100025268
672 Ga0070674_100206154
673 Ga0070673_100023660
674 Ga0070673_100098477
675 Ga0070659_100105454
676 Ga0070667_100006070
677 Ga0070667_100032495
678 Ga0070667_100065066
679 Ga0070667_100101834
680 Ga0070714_100074099
681 Ga0070713_100112964
682 Ga0070713_100176544
683 Ga0070710_10020294
684 Ga0070705_100189964
685 Ga0070663_100046515
686 Ga0070678_100007457
687 Ga0070678_100212010
688 Ga0070662_100045878
689 Ga0070662_100069749
690 Ga0070681_10025471
691 Ga0070681_10155127
692 Ga0068867_100264854
693 Ga0070706_100190847
694 Ga0070706_100208245
695 Ga0070707_100084947
696 Ga0070707_100276240
697 Ga0070698_100027663
698 Ga0070699_100003205
699 Ga0070699_100227900
700 Ga0070679_100051285
701 Ga0070679_100075439
702 Ga0070679_100078969
703 Ga0070679_100107517
704 Ga0070684_100023583
705 Ga0070684_100254300
706 Ga0070684_100393061
707 Ga0070697_100114216
708 Ga0068853_100056080
709 Ga0068853_100406402
710 Ga0070686_100031151
711 Ga0070696_100063908
712 Ga0070693_100001366
713 Ga0070693_100139784
714 Ga0070665_100002758
715 Ga0070665_100068940
716 Ga0070665_100090025
717 Ga0070665_100091370
718 Ga0070665_100201531
719 Ga0070665_100240625
720 Ga0068855_100000377
721 Ga0068855_100013895
722 Ga0068855_100015775
723 Ga0068855_100040151
724 Ga0068855_100151518
725 Ga0068855_100213921
726 Ga0070664_100005626
727 Ga0068856_100101636
728 Ga0068856_100570607
729 Ga0068859_100002359
730 Ga0068859_100015463
731 Ga0068859_100021499
732 Ga0068859_100198677
733 Ga0068859_100655101
734 Ga0068864_100000049
735 Ga0068864_100130919
736 Ga0068861_100028708
737 Ga0068861_100165609
738 Ga0068861_100172951
739 Ga0068870_10046874
740 Ga0068863_100028293
741 Ga0068863_100038479
742 Ga0068863_100049400
743 Ga0068863_100074799
744 Ga0068858_100019679
745 Ga0068858_100038408
746 Ga0068858_100178424
747 Ga0068858_100551810
748 Ga0068860_100000015
749 Ga0068860_100026398
750 Ga0068860_100083856
751 Ga0068860_100231104
752 Ga0068860_100298714
753 Ga0068862_100000005
754 Ga0068862_100008281
755 Ga0068862_100328744
756 Ga0081455_10000911
757 Ga0081455_10001814
758 Ga0081455_10002979
759 Ga0081455_10083907
760 Ga0081455_10148715
761 Ga0081538_10003874
762 Ga0081540_1000768
763 Ga0081540_1005330
764 Ga0081540_1012027
765 Ga0081540_1015550
766 Ga0081539_10002318
767 Ga0081539_10007392
768 Ga0070717_10064871
769 Ga0075365_10053933
770 Ga0075365_10081496
771 Ga0075365_10094624
772 Ga0075365_10236284
773 Ga0075368_10038867
774 Ga0070715_10034864
775 Ga0070716_100147083
776 Ga0070716_100150424
777 Ga0070712_100016273
778 Ga0070712_100024409
779 Ga0070712_100067138
780 Ga0070712_100069514
781 Ga0070712_100179299
782 Ga0070712_100462873
783 Ga0075362_10021926
784 Ga0075362_10093795
785 Ga0075362_10102484
786 Ga0075367_10106280
787 Ga0075369_10001265
788 Ga0075430_100178381
789 Ga0075433_10274541
790 Ga0075434_100037101
791 Ga0075434_100040063
792 Ga0075434_100065890
793 Ga0075434_100080504
794 Ga0075434_100367584
795 Ga0068865_100059833
796 Ga0068865_100454444
797 Ga0075436_100051558
798 Ga0097620_100002358
799 Ga0097620_100015464
800 Ga0097620_100021501
801 Ga0097620_100198670
802 Ga0097620_100655057
803 Ga0079104_1000772
804 Ga0075435_100022064
805 Ga0075435_100048000
806 Ga0075435_100097348
807 Ga0075435_100102005
808 Ga0099794_10033323
809 Ga0099795_10002642
810 Ga0099795_10005682
811 Ga0105251_10103296
812 Ga0105240_10004270
813 Ga0105240_10004805
814 Ga0105240_10005113
815 Ga0105240_10301112
816 Ga0105240_10457767
817 Ga0111539_10002851
818 Ga0111539_10198153
819 Ga0111539_10278202
820 Ga0105245_10058063
821 Ga0105245_10346150
822 Ga0114129_10097200
823 Ga0114129_10170974
824 Ga0105242_10142576
825 Ga0105242_10161645
826 Ga0105242_10161972
827 Ga0105248_10000648
828 Ga0105248_10001188
829 Ga0105248_10028613
830 Ga0105248_10067306
831 Ga0105248_10074970
832 Ga0105237_10022316
833 Ga0105237_10175276
834 Ga0105237_10230830
835 Ga0105237_10279991
836 Ga0105237_10299352
837 Ga0105237_10422583
838 Ga0105238_10091522
839 Ga0105238_10122024
840 Ga0105238_10135258
841 Ga0105238_10219192
842 Ga0105238_10332827
843 Ga0099796_10001277
844 Ga0099796_10001432
845 Ga0105239_10028723
846 Ga0105239_10032846
847 Ga0105239_10124785
848 Ga0105239_10184936
849 Ga0105246_10022061
850 Ga0157343_1001253
851 Ga0157373_10020217
852 Ga0157370_10025630
853 Ga0157369_10010262
854 Ga0157369_10129848
855 Ga0157374_10032780
856 Ga0157374_10034035
857 Ga0157374_10215193
858 Ga0157378_10012472
859 Ga0163162_10040173
860 Ga0163162_10053053
861 Ga0163162_10065459
862 Ga0163162_10131244
863 Ga0157372_10015520
864 Ga0157372_10029583
865 Ga0157372_10710133
866 Ga0157375_10025368
867 Ga0163163_10004279
868 Ga0163163_10021678
869 Ga0163163_10185985
870 Ga0157380_10000023
871 Ga0157380_10147401
872 Ga0157379_10000560
873 Ga0157379_10032106
874 Ga0157379_10319171
875 Ga0157376_10006701
876 Ga0163161_10089138
877 Ga0206356_11726480
878 Ga0206354_10397507
879 Ga0213872_10044729
880 Ga0213875_10011302
881 Ga0213871_10002813
882 Ga0209050_1000130
883 Ga0209257_1000059
884 Ga0209257_1000676
885 Ga0207697_10009506
886 Ga0207688_10011741
887 Ga0207688_10015017
888 Ga0207680_10203403
889 Ga0207699_10094467
890 Ga0207645_10003794
891 Ga0207643_10020632
892 Ga0207707_10028717
893 Ga0207707_10079587
894 Ga0207707_10299656
895 Ga0207695_10002655
896 Ga0207695_10020027
897 Ga0207695_10049213
898 Ga0207695_10258799
899 Ga0207671_10058078
900 Ga0207671_10174315
901 Ga0207693_10001175
902 Ga0207693_10041393
903 Ga0207693_10106339
904 Ga0207663_10239395
905 Ga0207660_10014405
906 Ga0207660_10122971
907 Ga0207662_10020281
908 Ga0207657_10011431
909 Ga0207657_10137970
910 Ga0207649_10071294
911 Ga0207652_10023691
912 Ga0207652_10098811
913 Ga0207652_10102454
914 Ga0207652_10140142
915 Ga0207681_10000003
916 Ga0207681_10044641
917 Ga0207681_10071160
918 Ga0207694_10069042
919 Ga0207694_10190037
920 Ga0207694_10232707
921 Ga0207650_10000012
922 Ga0207650_10008129
923 Ga0207650_10204348
924 Ga0207659_10152278
925 Ga0207659_10162930
926 Ga0207659_10418357
927 Ga0207687_10227289
928 Ga0207664_10015531
929 Ga0207644_10049444
930 Ga0207644_10053433
931 Ga0207644_10096351
932 Ga0207706_10015463
933 Ga0207706_10057430
934 Ga0207686_10134871
935 Ga0207669_10003139
936 Ga0207669_10121374
937 Ga0207704_10083020
938 Ga0207704_10416859
939 Ga0207665_10036241
940 Ga0207691_10166986
941 Ga0207711_10001582
942 Ga0207711_10003491
943 Ga0207711_10367855
944 Ga0207689_10085665
945 Ga0207679_10015119
946 Ga0207679_10033445
947 Ga0207667_10000537
948 Ga0207667_10015425
949 Ga0207667_10096071
950 Ga0207667_10164272
951 Ga0207667_10331208
952 Ga0207712_10095008
953 Ga0207668_10002414
954 Ga0207668_10014928
955 Ga0207668_10040088
956 Ga0207668_10107578
957 Ga0207640_10085895
958 Ga0207658_10008558
959 Ga0207658_10099421
960 Ga0207658_10160293
961 Ga0207703_10017588
962 Ga0207639_10016877
963 Ga0207639_10096244
964 Ga0207639_10260151
965 Ga0207678_10008165
966 Ga0207678_10008770
967 Ga0207702_10043554
968 Ga0207702_10146379
969 Ga0207702_10422322
970 Ga0207702_10491809
971 Ga0207641_10005395
972 Ga0207648_10076115
973 Ga0207676_10000009
974 Ga0207676_10004446
975 Ga0207676_10110534
976 Ga0207674_10163206
977 Ga0207674_10295941
978 Ga0207675_100154296
979 Ga0207675_100159120
980 Ga0207683_10016277
981 Ga0207683_10101024
982 Ga0207683_10251912
983 Ga0207698_10170123
984 Ga0209281_1000839
985 Ga0209974_10031705
986 Ga0207428_10080071
987 Ga0268266_10022698
988 Ga0268266_10030849
989 Ga0268266_10077686
990 Ga0268266_10295722
991 Ga0268265_10000001
992 Ga0268265_10064026
993 Ga0268265_10111252
994 Ga0268265_10228111
995 Ga0268265_10255236
996 Ga0268265_10537412
997 Ga0268264_10000002
998 Ga0268264_10000014
999 Ga0268264_10029293
1000 Ga0307515_10179830
1001 Ga0307511_10089556
1002 Ga0307513_10000063
1003 Ga0307508_10000235
1004 Ga0307514_10087303
1005 Ga0307516_10118288
1006 Ga0307405_10227515
1007 Ga0307405_10239350
1008 Ga0316577_10001464
1009 Ga0307415_100120767
1010 Ga0307507_10159020
1011 Ga0373945_0036276
1012 Ga0373960_0047240
1013 Ga0373943_0004903
1014 Ga0373946_0029240
1015 Ga0373946_0159010
1016 Ga0373955_0001957
1017 Ga0373955_0051431
1018 Ga0373955_0119705
1019 Ga0373955_0180238
1020 Ga0373955_0218276
1021 Ga0373942_0003301
1022 Ga0373962_0011051
1023 Ga0373924_0011836
1024 Ga0373931_0000538
1025 Ga0373935_0055321
1026 Ga0373935_0133847
1027 Ga0373935_0316716
1028 Ga0373927_0019179
1029 Ga0373927_0067100
1030 Ga0373927_0149946
1031 Ga0373933_0026191
1032 Ga0373937_0000963
1033 Ga0373937_0002673
1034 Ga0373937_0015459
1035 Ga0373937_0023031
1036 Ga0373937_0138386
1037 Ga0373937_0443054
1038 Ga0373937_0466052
1039 Ga0372808_008761
1040 Ga0316582_0008193
1041 Ga0373925_0047870
1042 Ga0373925_0099956
1043 Ga0373925_0413839
1044 Ga0395898_0030064
1045 Ga0395905_0222647
1046 Ga0316581_0000539
1047 Ga0436364_0489334
1048 Ga0395901_0513290
1049 Ga0436365_0709029
1050 Ga0436365_1934348
1051 Ga0436360_0140826
1052 Ga0436361_0187044
1053 Ga0436361_0374903
1054 Ga0436361_0603954
1055 Ga0439444_0004852
1056 Ga0451577_0085989
1057 Ga0466966_0135404
1058 Ga0466963_0130091
1059 Ga0466963_0270892
1060 Ga0451576_0126977
1061 Ga0466967_0047935
1062 Ga0466967_0055484
1063 Ga0466967_0106676
1064 Ga0466967_0219368
1065 Ga0466967_0236089
1066 Ga0495627_035172
1067 Ga0495592_0011234
1068 Ga0495592_0035241
1069 Ga0495603_0010292
1070 Ga0495603_0049171
1071 Ga0495603_0083438
1072 Ga0495603_0220405
1073 Ga0495591_044879
1074 Ga0495629_0000708
1075 Ga0495629_0026876
1076 Ga0495641_0025898
1077 Ga0495651_0214706
1078 Ga0495580_0007173
1079 Ga0495580_0067615
1080 Ga0495580_0146115
1081 Ga0495582_0003136
1082 Ga0495605_0011490
1083 Ga0495639_0002986
1084 Ga0495662_0037222
1085 Ga0495584_0023198
1086 Ga0495585_0063826
1087 Ga0495585_0081390
1088 Ga0495594_0011820
1089 Ga0495594_0080614
1090 Ga0495607_0037443
1091 Ga0495606_0003152
1092 Ga0495610_0083327
1093 Ga0495618_0033151
1094 Ga0495628_0022426
1095 Ga0495628_0031053
1096 Ga0495628_0266145
1097 Ga0495630_0023574
1098 Ga0495630_0120073
1099 Ga0495631_0022343
1100 Ga0495632_0178435
1101 Ga0495644_0012121
1102 Ga0495644_0032199
1103 Ga0495663_0007602
1104 Ga0495642_0041365
1105 Ga0495665_0002120
1106 Ga0495640_0018279
1107 Ga0495640_0180388
1108 Ga0495587_0047636
1109 Ga0495587_0099131
1110 Ga0495598_0001255
1111 Ga0495609_0025153
1112 Ga0495621_0003514
1113 Ga0495645_0037534
1114 Ga0495622_0001772
1115 Ga0495622_0107659
1116 Ga0495633_0010280
1117 Ga0495667_0025811
1118 Ga0495634_0006007
1119 Ga0495611_0067446
1120 Ga0495635_0004326
1121 Ga0495635_0042637
1122 Ga0495635_0083844
1123 Ga0495659_0001567
1124 Ga0495661_0054038
1125 Ga0495588_0001004
1126 Ga0495588_0049392
1127 Ga0495599_0015549
1128 Ga0495599_0063188
1129 Ga0495646_0014099
1130 Ga0495646_0022490
1131 Ga0495647_0007563
1132 Ga0495658_0001960
1133 Ga0495658_0158250
1134 Ga0495669_0009434
1135 Ga0495669_0040839
1136 Ga0495613_0022995
1137 Ga0495613_0187023
1138 Ga0495624_0003274
1139 Ga0495624_0083716
1140 Ga0495671_0015183
1141 Ga0495649_0021737
1142 Ga0495660_0165676
1143 Ga0495581_0001031
1144 Ga0495581_0031887
1145 Ga0495604_0028410
1146 Ga0495604_0079495
1147 Ga0495636_0013525
1148 Ga0495674_0168083
1149 Ga0495672_0001235
1150 Ga0495672_0009814
1151 Ga0495676_0012956
1152 Ga0495683_0019905
1153 Ga0495675_0002021
1154 Ga0495677_0005216
1155 Ga0495679_014512
1156 Ga0495685_008090
1157 Ga0495684_0086112
1158 Ga0495593_0001063
1159 Ga0495602_0022198
1160 Ga0495602_0170769
1161 Ga0495614_0045333
1162 Ga0496100_0133798
1163 Ga0496100_0282737
1164 Ga0496104_0026760
1165 Ga0496104_0071171
1166 Ga0496105_0013758
1167 Ga0496106_0148806
1168 Ga0496108_0138240
1169 Ga0496108_0227673
1170 Ga0496109_0284871
1171 Ga0496111_0146130
1172 Ga0496111_0162474
1173 Ga0496112_0001395
1174 Ga0496112_0004066
1175 Ga0496112_0006762
1176 Ga0496112_0037930
1177 Ga0496112_0081619
1178 Ga0496112_0187398
1179 Ga0496112_0222100
1180 Ga0496113_0026364
1181 Ga0496113_0245203
1182 Ga0496113_0295371
1183 Ga0496114_0179683
1184 Ga0496115_0003088
1185 Ga0496115_0008572
1186 Ga0496115_0027208
1187 Ga0496115_0070637
1188 Ga0496118_0020190
1189 Ga0496121_0000473
1190 Ga0496121_0044274
1191 Ga0496124_0134265
1192 Ga0496126_0074768
1193 Ga0496126_0193487
1194 Ga0496126_0256883
1195 Ga0496126_0259778
1196 Ga0501034_0039056
1197 Ga0501034_0245180
1198 Ga0501042_0223024
1199 Ga0501047_0109726
1200 Ga0501047_0219286
1201 Ga0501079_0198985
1202 Ga0501080_0019798
1203 Ga0501035_0076835
1204 Ga0501044_0004179
1205 Ga0501044_0103349
1206 Ga0501045_0077668
1207 nmdc:mga03683_1158_c1
1208 nmdc:mga03n38_82000_c1
1209 nmdc:mga0yw44_12183_c1
1210 nmdc:mga0yw44_13339_c2
1211 nmdc:mga0yw44_316827_c1
1212 nmdc:mga06z11_113025_c1
1213 nmdc:mga06z11_51244_c1
1214 nmdc:mga05p37_53800_c1
1215 nmdc:mga0qj67_167941_c1
1216 nmdc:mga08y16_4949_c1
1217 nmdc:mga0n895_123311_c1
1218 nmdc:mga0n895_475878_c1
1219 nmdc:mga0n895_79674_c1
1220 nmdc:mga0n895_92921_c1
1221 nmdc:mga0rr50_215380_c1
1222 nmdc:mga0rr50_26730_c1
1223 nmdc:mga0rr50_292334_c1
1224 nmdc:mga0rr50_382118_c1
1225 nmdc:mga08x19_139814_c1
1226 nmdc:mga0a205_130834_c1
1227 nmdc:mga0a205_454802_c1
1228 nmdc:mga0a205_53880_c1
1229 nmdc:mga0sz30_34251_c1
1230 nmdc:mga0sz30_792_c1
1231 Ga0495601_0021569
1232 Ga0495601_0158831
1233 Ga0495612_0009848
1234 Ga0495619_0107901
1235 Ga0500651_0043528
1236 Ga0500651_0112070
1237 Ga0500641_0054821
1238 Ga0500595_061535
1239 Ga0500607_013356
1240 Ga0500559_0031150
1241 Ga0500616_0009378
1242 Ga0500636_0000049
1243 Ga0500637_0017995
1244 Ga0500625_031492
1245 2510246159
1246 2643728520
1247 2644392242
1248 2719637536
1249 2793073779
1250 2837654358
1251 2900643382
1252 2906611720
1253 2919451166
1254 2922427642
1255 3005477316
1256 8001848630
1257 8002290631
1258 8019559815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01933

CofD

2-phospho-L-lactate transferase CofD

18

319

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c3e-assembly2.cif.gz_D crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46 0.934 6 310
3c3e-assembly2.cif.gz_D crystal structure of 2-phospho-(s)-lactate transferase from methanosarcina mazei in complex with fo and gdp. northeast structural genomics consortium target mar46 0.9192 6 310
6uw3-assembly1.cif.gz_B the crystal structure of fbia from mycobacterium smegmatis, gdp bound form 0.9087 4 311
6uvx-assembly1.cif.gz_B the crystal structure of fbia from mycobacterium smegmatis, apo state 0.9006 4 311
6uw7-assembly1.cif.gz_B the crystal structure of fbia from mycobacterium smegmatis, dehydro-f420-0 bound form 0.89 4 311
ID Description Score Start End Superfamily
3c3eA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.9395 7 309 3.40.50.10680
2ffeA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;CofD-like domain 0.9387 39 126 1.10.8.240
2ffeA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;CofD-like domain 0.9286 39 126 1.10.8.240
3c3eA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;CofD-like domains 0.914 7 309 3.40.50.10680
af_Q9UTE4_20_232_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.745 190 227 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A382FZN4-F1-model_v4 2-phospho-L-lactate transferase 0.9944 32 229 GO:0000287
GO:0043743
AF-A0A3D5HH45-F1-model_v4 2-phospho-L-lactate transferase 0.9941 2 219 GO:0000287
GO:0043743
AF-A0A381VEC5-F1-model_v4 2-phospho-L-lactate transferase 0.9912 3 313 GO:0000287
GO:0043743
AF-A0A382IX91-F1-model_v4 2-phospho-L-lactate transferase 0.9907 27 273 GO:0000287
GO:0043743
AF-A0A382KGI5-F1-model_v4 2-phospho-L-lactate transferase 0.99 1 252 GO:0000287
GO:0043743

Map