F470732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 280 | 623 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10304412|Ga0105237_103044123 |
| Length | 250 |
| Sequence | MLDVHPGPLALFGGFMEPRSQTVFNHGTAPAVGVAESQNRVLRNTYWLLSLSMLPTVAGAWAGMQLNFLSLFAASPVMAPLLMFGVMIGALFGVTALRNSAWGVPALFGFTFIAGLMLAPILSVALGFRNGGQLIGLAGGMTAVIFFAMAGIATVTKRDFSFMGKFLFIGLVLLIVASLANIFLQIPALSVTVSAIAVLLFSAYLLHDVSRIVRGGETNYITATLSLFLDVYNIFISLLNILLMFSGQRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 2 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 3 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 4 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 5 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 6 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 273 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.5 |
| Metatranscriptomes | 2.54 |
| Isolates | 0.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 2.38 |
| Rhizosphere | 96.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1012936 | 3300002074 | Bacteria | 986 |
| 2 | Ga0070658_10622671 | 3300005327 | Bacteria | 936 |
| 3 | Ga0070676_10000975 | 3300005328 | Bacteria | 14221 |
| 4 | Ga0070676_10290665 | 3300005328 | Bacteria | 1104 |
| 5 | Ga0070676_10341499 | 3300005328 | Bacteria | 1027 |
| 6 | Ga0070676_10362219 | 3300005328 | Bacteria | 999 |
| 7 | Ga0070683_100081264 | 3300005329 | Bacteria | 3034 |
| 8 | Ga0070683_100093131 | 3300005329 | Bacteria | 2830 |
| 9 | Ga0070683_100171932 | 3300005329 | Bacteria | 2057 |
| 10 | Ga0070690_100024054 | 3300005330 | Bacteria | 3743 |
| 11 | Ga0070670_100030196 | 3300005331 | Bacteria | 4667 |
| 12 | Ga0070670_100031567 | 3300005331 | Bacteria | 4563 |
| 13 | Ga0070670_100034350 | 3300005331 | Bacteria | 4363 |
| 14 | Ga0070670_100118242 | 3300005331 | Bacteria | 2286 |
| 15 | Ga0070670_100155446 | 3300005331 | Bacteria | 1980 |
| 16 | Ga0070670_100284706 | 3300005331 | Bacteria | 1443 |
| 17 | Ga0070677_10000807 | 3300005333 | Bacteria | 10366 |
| 18 | Ga0070677_10114922 | 3300005333 | Bacteria | 1207 |
| 19 | Ga0068869_100072952 | 3300005334 | Bacteria | 2544 |
| 20 | Ga0068869_100087312 | 3300005334 | Bacteria | 2339 |
| 21 | Ga0068869_100100776 | 3300005334 | Bacteria | 2184 |
| 22 | Ga0070666_10001239 | 3300005335 | Bacteria | 15435 |
| 23 | Ga0070666_10009140 | 3300005335 | Bacteria | 6179 |
| 24 | Ga0070680_100046206 | 3300005336 | Bacteria | 3541 |
| 25 | Ga0070680_100212762 | 3300005336 | Bacteria | 1631 |
| 26 | Ga0070682_100069975 | 3300005337 | Bacteria | 2242 |
| 27 | Ga0068868_100001857 | 3300005338 | Bacteria | 14499 |
| 28 | Ga0068868_100005645 | 3300005338 | Bacteria | 8806 |
| 29 | Ga0068868_100173623 | 3300005338 | Bacteria | 1785 |
| 30 | Ga0070660_100014044 | 3300005339 | Bacteria | 5764 |
| 31 | Ga0070660_100100830 | 3300005339 | Bacteria | 2287 |
| 32 | Ga0070660_100164259 | 3300005339 | Bacteria | 1790 |
| 33 | Ga0070660_100332316 | 3300005339 | Bacteria | 1250 |
| 34 | Ga0070689_100003142 | 3300005340 | Bacteria | 10924 |
| 35 | Ga0070689_100669986 | 3300005340 | Bacteria | 904 |
| 36 | Ga0070661_100085770 | 3300005344 | Bacteria | 2327 |
| 37 | Ga0070661_100161304 | 3300005344 | Bacteria | 1698 |
| 38 | Ga0070661_100219051 | 3300005344 | Bacteria | 1459 |
| 39 | Ga0070692_10036823 | 3300005345 | Bacteria | 2485 |
| 40 | Ga0070692_10390545 | 3300005345 | Bacteria | 876 |
| 41 | Ga0070668_100009765 | 3300005347 | Bacteria | 7114 |
| 42 | Ga0070668_100011053 | 3300005347 | Bacteria | 6720 |
| 43 | Ga0070668_100024428 | 3300005347 | Bacteria | 4579 |
| 44 | Ga0070668_100092604 | 3300005347 | Bacteria | 2384 |
| 45 | Ga0070669_100130606 | 3300005353 | Bacteria | 1926 |
| 46 | Ga0070675_100013624 | 3300005354 | Bacteria | 6394 |
| 47 | Ga0070675_100028134 | 3300005354 | Bacteria | 4523 |
| 48 | Ga0070675_100030634 | 3300005354 | Bacteria | 4344 |
| 49 | Ga0070675_100261794 | 3300005354 | Bacteria | 1516 |
| 50 | Ga0070671_100002986 | 3300005355 | Bacteria | 13164 |
| 51 | Ga0070671_100013348 | 3300005355 | Bacteria | 6621 |
| 52 | Ga0070671_100052646 | 3300005355 | Bacteria | 3384 |
| 53 | Ga0070671_100297517 | 3300005355 | Bacteria | 1374 |
| 54 | Ga0070671_100346011 | 3300005355 | Bacteria | 1269 |
| 55 | Ga0070674_100014547 | 3300005356 | Bacteria | 4894 |
| 56 | Ga0070674_100065882 | 3300005356 | Bacteria | 2544 |
| 57 | Ga0070674_100086827 | 3300005356 | Bacteria | 2248 |
| 58 | Ga0070674_100401046 | 3300005356 | Bacteria | 1121 |
| 59 | Ga0070673_100005623 | 3300005364 | Bacteria | 8043 |
| 60 | Ga0070673_100005830 | 3300005364 | Bacteria | 7938 |
| 61 | Ga0070673_100043334 | 3300005364 | Bacteria | 3476 |
| 62 | Ga0070673_100051987 | 3300005364 | Bacteria | 3212 |
| 63 | Ga0070673_100124315 | 3300005364 | Bacteria | 2156 |
| 64 | Ga0070688_100000458 | 3300005365 | Bacteria | 20699 |
| 65 | Ga0070688_100204330 | 3300005365 | Bacteria | 1384 |
| 66 | Ga0070659_100124663 | 3300005366 | Bacteria | 2089 |
| 67 | Ga0070659_100147820 | 3300005366 | Bacteria | 1915 |
| 68 | Ga0070659_100165857 | 3300005366 | Bacteria | 1807 |
| 69 | Ga0070659_100288401 | 3300005366 | Bacteria | 1366 |
| 70 | Ga0070667_100003537 | 3300005367 | Bacteria | 13310 |
| 71 | Ga0070667_100013731 | 3300005367 | Bacteria | 6695 |
| 72 | Ga0070667_100237462 | 3300005367 | Bacteria | 1626 |
| 73 | Ga0070667_100267578 | 3300005367 | Bacteria | 1532 |
| 74 | Ga0070709_10001951 | 3300005434 | Bacteria | 11233 |
| 75 | Ga0070714_100009134 | 3300005435 | Bacteria | 7777 |
| 76 | Ga0070714_100040356 | 3300005435 | Bacteria | 3934 |
| 77 | Ga0070714_100209573 | 3300005435 | Bacteria | 1786 |
| 78 | Ga0070714_100738068 | 3300005435 | Bacteria | 951 |
| 79 | Ga0070714_100854003 | 3300005435 | Bacteria | 883 |
| 80 | Ga0070713_100002402 | 3300005436 | Bacteria | 12211 |
| 81 | Ga0070713_100020507 | 3300005436 | Bacteria | 5068 |
| 82 | Ga0070713_100142839 | 3300005436 | Bacteria | 2122 |
| 83 | Ga0070713_100214158 | 3300005436 | Bacteria | 1745 |
| 84 | Ga0070710_10036498 | 3300005437 | Bacteria | 2688 |
| 85 | Ga0070701_10012622 | 3300005438 | Bacteria | 3816 |
| 86 | Ga0070711_100003780 | 3300005439 | Bacteria | 8880 |
| 87 | Ga0070711_100239915 | 3300005439 | Bacteria | 1417 |
| 88 | Ga0070694_100037166 | 3300005444 | Bacteria | 3229 |
| 89 | Ga0070708_100054327 | 3300005445 | Bacteria | 3557 |
| 90 | Ga0070663_100008281 | 3300005455 | Bacteria | 6387 |
| 91 | Ga0070663_100123186 | 3300005455 | Bacteria | 1961 |
| 92 | Ga0070663_100146392 | 3300005455 | Bacteria | 1808 |
| 93 | Ga0070663_100238322 | 3300005455 | Bacteria | 1435 |
| 94 | Ga0070678_100001518 | 3300005456 | Bacteria | 12390 |
| 95 | Ga0070678_100007823 | 3300005456 | Bacteria | 6360 |
| 96 | Ga0070678_100093439 | 3300005456 | Bacteria | 2313 |
| 97 | Ga0070662_100084522 | 3300005457 | Bacteria | 2371 |
| 98 | Ga0070662_100316928 | 3300005457 | Bacteria | 1271 |
| 99 | Ga0070662_100788667 | 3300005457 | Bacteria | 807 |
| 100 | Ga0070681_10005398 | 3300005458 | Bacteria | 12344 |
| 101 | Ga0070681_10008601 | 3300005458 | Bacteria | 10006 |
| 102 | Ga0070681_10217907 | 3300005458 | Bacteria | 1824 |
| 103 | Ga0070681_10348590 | 3300005458 | Bacteria | 1391 |
| 104 | Ga0068867_100008965 | 3300005459 | Bacteria | 7058 |
| 105 | Ga0068867_100026811 | 3300005459 | Bacteria | 4139 |
| 106 | Ga0068867_100487133 | 3300005459 | Bacteria | 1058 |
| 107 | Ga0070685_10008324 | 3300005466 | Bacteria | 5324 |
| 108 | Ga0070685_10225443 | 3300005466 | Bacteria | 1230 |
| 109 | Ga0070707_100071004 | 3300005468 | Bacteria | 3354 |
| 110 | Ga0070698_100589264 | 3300005471 | Bacteria | 1052 |
| 111 | Ga0070699_100023002 | 3300005518 | Bacteria | 5370 |
| 112 | Ga0070699_100046715 | 3300005518 | Bacteria | 3746 |
| 113 | Ga0070679_100011162 | 3300005530 | Bacteria | 8557 |
| 114 | Ga0070679_100046471 | 3300005530 | Bacteria | 4327 |
| 115 | Ga0070679_100151429 | 3300005530 | Bacteria | 2296 |
| 116 | Ga0070679_100215667 | 3300005530 | Bacteria | 1882 |
| 117 | Ga0070679_100310377 | 3300005530 | Bacteria | 1527 |
| 118 | Ga0070684_100042537 | 3300005535 | Bacteria | 3922 |
| 119 | Ga0070684_100081329 | 3300005535 | Bacteria | 2866 |
| 120 | Ga0070697_100013500 | 3300005536 | Bacteria | 6408 |
| 121 | Ga0068853_100046600 | 3300005539 | Bacteria | 3718 |
| 122 | Ga0068853_100178978 | 3300005539 | Bacteria | 1922 |
| 123 | Ga0068853_100222230 | 3300005539 | Bacteria | 1725 |
| 124 | Ga0068853_100400438 | 3300005539 | Bacteria | 1285 |
| 125 | Ga0070672_100000308 | 3300005543 | Bacteria | 27646 |
| 126 | Ga0070672_100002977 | 3300005543 | Bacteria | 10912 |
| 127 | Ga0070672_100023780 | 3300005543 | Bacteria | 4520 |
| 128 | Ga0070672_100028844 | 3300005543 | Bacteria | 4155 |
| 129 | Ga0070672_100039503 | 3300005543 | Bacteria | 3615 |
| 130 | Ga0070672_100079170 | 3300005543 | Bacteria | 2630 |
| 131 | Ga0070686_100040050 | 3300005544 | Bacteria | 2922 |
| 132 | Ga0070696_100035587 | 3300005546 | Bacteria | 3429 |
| 133 | Ga0070696_100064816 | 3300005546 | Bacteria | 2560 |
| 134 | Ga0070693_100024807 | 3300005547 | Bacteria | 3220 |
| 135 | Ga0070665_100001417 | 3300005548 | Bacteria | 28129 |
| 136 | Ga0070665_100001524 | 3300005548 | Bacteria | 26828 |
| 137 | Ga0070665_100007532 | 3300005548 | Bacteria | 11066 |
| 138 | Ga0070665_100021232 | 3300005548 | Bacteria | 6529 |
| 139 | Ga0070665_100089954 | 3300005548 | Bacteria | 3075 |
| 140 | Ga0068855_100001119 | 3300005563 | Bacteria | 33345 |
| 141 | Ga0070664_100000934 | 3300005564 | Bacteria | 22823 |
| 142 | Ga0070664_100067175 | 3300005564 | Bacteria | 3064 |
| 143 | Ga0070664_100271007 | 3300005564 | Bacteria | 1529 |
| 144 | Ga0070664_100595648 | 3300005564 | Bacteria | 1025 |
| 145 | Ga0068857_100002116 | 3300005577 | Bacteria | 16149 |
| 146 | Ga0068857_100028759 | 3300005577 | Bacteria | 4904 |
| 147 | Ga0068857_100160467 | 3300005577 | Bacteria | 2040 |
| 148 | Ga0068854_100003623 | 3300005578 | Bacteria | 9664 |
| 149 | Ga0068854_100021061 | 3300005578 | Bacteria | 4420 |
| 150 | Ga0068854_100029133 | 3300005578 | Bacteria | 3820 |
| 151 | Ga0068854_100193172 | 3300005578 | Bacteria | 1596 |
| 152 | Ga0068856_100006845 | 3300005614 | Bacteria | 11150 |
| 153 | Ga0068856_100013862 | 3300005614 | Bacteria | 7795 |
| 154 | Ga0068856_100185290 | 3300005614 | Bacteria | 2095 |
| 155 | Ga0068852_100000768 | 3300005616 | Bacteria | 21136 |
| 156 | Ga0068852_100012670 | 3300005616 | Bacteria | 6413 |
| 157 | Ga0068852_100112895 | 3300005616 | Bacteria | 2473 |
| 158 | Ga0068852_100147553 | 3300005616 | Bacteria | 2183 |
| 159 | Ga0068852_100150540 | 3300005616 | Bacteria | 2163 |
| 160 | Ga0068859_100002028 | 3300005617 | Bacteria | 20687 |
| 161 | Ga0068859_100156595 | 3300005617 | Bacteria | 2356 |
| 162 | Ga0068859_100302767 | 3300005617 | Bacteria | 1692 |
| 163 | Ga0068864_100000455 | 3300005618 | Bacteria | 35377 |
| 164 | Ga0068864_100000740 | 3300005618 | Bacteria | 27362 |
| 165 | Ga0068864_100063009 | 3300005618 | Bacteria | 3213 |
| 166 | Ga0068864_100177810 | 3300005618 | Bacteria | 1944 |
| 167 | Ga0068864_100502645 | 3300005618 | Bacteria | 1166 |
| 168 | Ga0068864_100649693 | 3300005618 | Bacteria | 1027 |
| 169 | Ga0068866_10000548 | 3300005718 | Bacteria | 17150 |
| 170 | Ga0068866_10208924 | 3300005718 | Bacteria | 1171 |
| 171 | Ga0068861_100207468 | 3300005719 | Bacteria | 1648 |
| 172 | Ga0068861_100307053 | 3300005719 | Bacteria | 1376 |
| 173 | Ga0068861_100489192 | 3300005719 | Bacteria | 1110 |
| 174 | Ga0068851_10006873 | 3300005834 | Bacteria | 5212 |
| 175 | Ga0068851_10078478 | 3300005834 | Bacteria | 1720 |
| 176 | Ga0068870_10004919 | 3300005840 | Bacteria | 5785 |
| 177 | Ga0068863_100009317 | 3300005841 | Bacteria | 9581 |
| 178 | Ga0068863_100036668 | 3300005841 | Bacteria | 4670 |
| 179 | Ga0068863_100050940 | 3300005841 | Bacteria | 3924 |
| 180 | Ga0068863_100401422 | 3300005841 | Bacteria | 1341 |
| 181 | Ga0068863_100670217 | 3300005841 | Bacteria | 1029 |
| 182 | Ga0068858_100000850 | 3300005842 | Bacteria | 31613 |
| 183 | Ga0068858_100032194 | 3300005842 | Bacteria | 4870 |
| 184 | Ga0068858_100141381 | 3300005842 | Bacteria | 2259 |
| 185 | Ga0068858_100389535 | 3300005842 | Bacteria | 1338 |
| 186 | Ga0068858_100452841 | 3300005842 | Bacteria | 1237 |
| 187 | Ga0068860_100008471 | 3300005843 | Bacteria | 10247 |
| 188 | Ga0068860_100022393 | 3300005843 | Bacteria | 6112 |
| 189 | Ga0068860_100353651 | 3300005843 | Bacteria | 1446 |
| 190 | Ga0068860_100399763 | 3300005843 | Bacteria | 1359 |
| 191 | Ga0068862_100029944 | 3300005844 | Bacteria | 4587 |
| 192 | Ga0068862_100111823 | 3300005844 | Bacteria | 2398 |
| 193 | Ga0081455_10172117 | 3300005937 | Bacteria | 1648 |
| 194 | Ga0070716_100011269 | 3300006173 | Bacteria | 4501 |
| 195 | Ga0070712_100004102 | 3300006175 | Bacteria | 8949 |
| 196 | Ga0070712_100255614 | 3300006175 | Bacteria | 1402 |
| 197 | Ga0075366_10133174 | 3300006195 | Bacteria | 1500 |
| 198 | Ga0097621_100005686 | 3300006237 | Bacteria | 8801 |
| 199 | Ga0097621_100027814 | 3300006237 | Bacteria | 4451 |
| 200 | Ga0097621_100072662 | 3300006237 | Bacteria | 2845 |
| 201 | Ga0097621_100419683 | 3300006237 | Bacteria | 1201 |
| 202 | Ga0097621_100456682 | 3300006237 | Bacteria | 1152 |
| 203 | Ga0068871_100050572 | 3300006358 | Bacteria | 3362 |
| 204 | Ga0068871_100285365 | 3300006358 | Bacteria | 1445 |
| 205 | Ga0075428_100170197 | 3300006844 | Bacteria | 2362 |
| 206 | Ga0075428_100235058 | 3300006844 | Bacteria | 1978 |
| 207 | Ga0075434_100110026 | 3300006871 | Bacteria | 2766 |
| 208 | Ga0068865_100085048 | 3300006881 | Bacteria | 2281 |
| 209 | Ga0068865_100138120 | 3300006881 | Bacteria | 1834 |
| 210 | Ga0068865_100195897 | 3300006881 | Bacteria | 1566 |
| 211 | Ga0097620_100002027 | 3300006931 | Bacteria | 20687 |
| 212 | Ga0097620_100156598 | 3300006931 | Bacteria | 2356 |
| 213 | Ga0097620_100302747 | 3300006931 | Bacteria | 1692 |
| 214 | Ga0075435_100043986 | 3300007076 | Bacteria | 3577 |
| 215 | Ga0105240_10000332 | 3300009093 | Bacteria | 88613 |
| 216 | Ga0105240_10090010 | 3300009093 | Bacteria | 3752 |
| 217 | Ga0105240_10090143 | 3300009093 | Bacteria | 3749 |
| 218 | Ga0105240_10810231 | 3300009093 | Bacteria | 1014 |
| 219 | Ga0105245_10013288 | 3300009098 | Bacteria | 7172 |
| 220 | Ga0105245_10189531 | 3300009098 | Bacteria | 1969 |
| 221 | Ga0105247_10029095 | 3300009101 | Bacteria | 3346 |
| 222 | Ga0105243_10057543 | 3300009148 | Bacteria | 3096 |
| 223 | Ga0105241_10004491 | 3300009174 | Bacteria | 10319 |
| 224 | Ga0105241_10024851 | 3300009174 | Bacteria | 4451 |
| 225 | Ga0105241_10044096 | 3300009174 | Bacteria | 3379 |
| 226 | Ga0105248_10032092 | 3300009177 | Bacteria | 5869 |
| 227 | Ga0105248_10121389 | 3300009177 | Bacteria | 2948 |
| 228 | Ga0105248_10310224 | 3300009177 | Bacteria | 1777 |
| 229 | Ga0105248_10354239 | 3300009177 | Bacteria | 1652 |
| 230 | Ga0105248_10860738 | 3300009177 | Bacteria | 1023 |
| 231 | Ga0105237_10028957 | 3300009545 | Bacteria | 5634 |
| 232 | Ga0105237_10304412 | 3300009545 | Bacteria | 1597 |
| 233 | Ga0105238_10000244 | 3300009551 | Bacteria | 60605 |
| 234 | Ga0105238_10198644 | 3300009551 | Bacteria | 1981 |
| 235 | Ga0105239_10073547 | 3300010375 | Bacteria | 3757 |
| 236 | Ga0105239_10092064 | 3300010375 | Bacteria | 3346 |
| 237 | Ga0105246_10051342 | 3300011119 | Bacteria | 2832 |
| 238 | Ga0105246_10395288 | 3300011119 | Bacteria | 1146 |
| 239 | Ga0157373_10019865 | 3300013100 | Bacteria | 4887 |
| 240 | Ga0157373_10024332 | 3300013100 | Bacteria | 4388 |
| 241 | Ga0157373_10051274 | 3300013100 | Bacteria | 2940 |
| 242 | Ga0157373_10370840 | 3300013100 | Bacteria | 1023 |
| 243 | Ga0157373_10485500 | 3300013100 | Bacteria | 891 |
| 244 | Ga0157371_10023665 | 3300013102 | Bacteria | 4491 |
| 245 | Ga0157371_10253857 | 3300013102 | Bacteria | 1267 |
| 246 | Ga0157370_10005883 | 3300013104 | Bacteria | 13674 |
| 247 | Ga0157370_10009707 | 3300013104 | Bacteria | 10233 |
| 248 | Ga0157370_10026468 | 3300013104 | Bacteria | 5727 |
| 249 | Ga0157370_10279217 | 3300013104 | Bacteria | 1543 |
| 250 | Ga0157370_10553279 | 3300013104 | Bacteria | 1055 |
| 251 | Ga0157369_10005394 | 3300013105 | Bacteria | 14884 |
| 252 | Ga0157369_10194997 | 3300013105 | Bacteria | 2127 |
| 253 | Ga0157369_10201144 | 3300013105 | Bacteria | 2091 |
| 254 | Ga0157369_10787895 | 3300013105 | Bacteria | 977 |
| 255 | Ga0157374_10003271 | 3300013296 | Bacteria | 13608 |
| 256 | Ga0157374_10215666 | 3300013296 | Bacteria | 1882 |
| 257 | Ga0157374_10807317 | 3300013296 | Bacteria | 954 |
| 258 | Ga0157378_10005893 | 3300013297 | Bacteria | 10735 |
| 259 | Ga0157378_10064824 | 3300013297 | Bacteria | 3269 |
| 260 | Ga0157378_10137993 | 3300013297 | Bacteria | 2262 |
| 261 | Ga0157378_10165684 | 3300013297 | Bacteria | 2070 |
| 262 | Ga0163162_10020054 | 3300013306 | Bacteria | 6566 |
| 263 | Ga0163162_10061410 | 3300013306 | Bacteria | 3796 |
| 264 | Ga0163162_10169699 | 3300013306 | Bacteria | 2306 |
| 265 | Ga0163162_10290493 | 3300013306 | Bacteria | 1767 |
| 266 | Ga0163162_10343862 | 3300013306 | Bacteria | 1624 |
| 267 | Ga0163162_10510112 | 3300013306 | Bacteria | 1333 |
| 268 | Ga0157372_10002879 | 3300013307 | Bacteria | 18604 |
| 269 | Ga0157372_10057898 | 3300013307 | Bacteria | 4332 |
| 270 | Ga0157372_10132165 | 3300013307 | Bacteria | 2872 |
| 271 | Ga0157372_10271123 | 3300013307 | Bacteria | 1972 |
| 272 | Ga0157375_10006021 | 3300013308 | Bacteria | 10577 |
| 273 | Ga0157375_10011902 | 3300013308 | Bacteria | 7697 |
| 274 | Ga0157375_10035555 | 3300013308 | Bacteria | 4756 |
| 275 | Ga0157375_10068797 | 3300013308 | Bacteria | 3544 |
| 276 | Ga0157375_10243716 | 3300013308 | Bacteria | 1957 |
| 277 | Ga0157375_10439583 | 3300013308 | Bacteria | 1470 |
| 278 | Ga0163163_10000310 | 3300014325 | Bacteria | 47904 |
| 279 | Ga0163163_10043746 | 3300014325 | Bacteria | 4392 |
| 280 | Ga0163163_10349037 | 3300014325 | Bacteria | 1535 |
| 281 | Ga0157380_10043712 | 3300014326 | Bacteria | 3508 |
| 282 | Ga0182008_10067352 | 3300014497 | Bacteria | 1762 |
| 283 | Ga0182008_10082404 | 3300014497 | Bacteria | 1583 |
| 284 | Ga0157377_10126571 | 3300014745 | Bacteria | 1555 |
| 285 | Ga0157377_10451438 | 3300014745 | Bacteria | 887 |
| 286 | Ga0157379_10000626 | 3300014968 | Bacteria | 28509 |
| 287 | Ga0157379_10136790 | 3300014968 | Bacteria | 2207 |
| 288 | Ga0157376_10005464 | 3300014969 | Bacteria | 8883 |
| 289 | Ga0157376_10111908 | 3300014969 | Bacteria | 2405 |
| 290 | Ga0157376_10234134 | 3300014969 | Bacteria | 1707 |
| 291 | Ga0157376_10358740 | 3300014969 | Bacteria | 1397 |
| 292 | Ga0163161_10038381 | 3300017792 | Bacteria | 3435 |
| 293 | Ga0163161_10293990 | 3300017792 | Bacteria | 1277 |
| 294 | Ga0197907_10357466 | 3300020069 | Bacteria | 869 |
| 295 | Ga0206356_10470992 | 3300020070 | Bacteria | 1566 |
| 296 | Ga0206350_10016023 | 3300020080 | Bacteria | 825 |
| 297 | Ga0206354_10100971 | 3300020081 | Bacteria | 773 |
| 298 | Ga0154015_1377351 | 3300020610 | Bacteria | 1473 |
| 299 | Ga0154015_1531000 | 3300020610 | Bacteria | 1266 |
| 300 | Ga0224712_10100485 | 3300022467 | Bacteria | 1226 |
| 301 | Ga0207697_10022631 | 3300025315 | Bacteria | 2574 |
| 302 | Ga0207656_10025393 | 3300025321 | Bacteria | 2405 |
| 303 | Ga0207682_10000061 | 3300025893 | Bacteria | 46850 |
| 304 | Ga0207682_10115312 | 3300025893 | Bacteria | 1186 |
| 305 | Ga0207692_10283412 | 3300025898 | Bacteria | 1003 |
| 306 | Ga0207642_10029855 | 3300025899 | Bacteria | 2263 |
| 307 | Ga0207710_10272210 | 3300025900 | Bacteria | 851 |
| 308 | Ga0207688_10013116 | 3300025901 | Bacteria | 4505 |
| 309 | Ga0207688_10180618 | 3300025901 | Bacteria | 1258 |
| 310 | Ga0207680_10004784 | 3300025903 | Bacteria | 6447 |
| 311 | Ga0207680_10014384 | 3300025903 | Bacteria | 4093 |
| 312 | Ga0207680_10286128 | 3300025903 | Bacteria | 1146 |
| 313 | Ga0207680_10368882 | 3300025903 | Bacteria | 1010 |
| 314 | Ga0207699_10134270 | 3300025906 | Bacteria | 1618 |
| 315 | Ga0207645_10002609 | 3300025907 | Bacteria | 14052 |
| 316 | Ga0207643_10005370 | 3300025908 | Bacteria | 6859 |
| 317 | Ga0207643_10031149 | 3300025908 | Bacteria | 2972 |
| 318 | Ga0207643_10190550 | 3300025908 | Bacteria | 1245 |
| 319 | Ga0207643_10238416 | 3300025908 | Bacteria | 1117 |
| 320 | Ga0207705_10083383 | 3300025909 | Bacteria | 2332 |
| 321 | Ga0207705_10085213 | 3300025909 | Bacteria | 2308 |
| 322 | Ga0207705_10274479 | 3300025909 | Bacteria | 1289 |
| 323 | Ga0207705_10480875 | 3300025909 | Bacteria | 964 |
| 324 | Ga0207705_10551014 | 3300025909 | Bacteria | 896 |
| 325 | Ga0207654_10129434 | 3300025911 | Bacteria | 1596 |
| 326 | Ga0207654_10238568 | 3300025911 | Bacteria | 1214 |
| 327 | Ga0207707_10013250 | 3300025912 | Bacteria | 7183 |
| 328 | Ga0207707_10033435 | 3300025912 | Bacteria | 4500 |
| 329 | Ga0207707_10109658 | 3300025912 | Bacteria | 2413 |
| 330 | Ga0207707_10403609 | 3300025912 | Bacteria | 1173 |
| 331 | Ga0207695_10039493 | 3300025913 | Bacteria | 5073 |
| 332 | Ga0207695_10066294 | 3300025913 | Bacteria | 3709 |
| 333 | Ga0207695_10111471 | 3300025913 | Bacteria | 2715 |
| 334 | Ga0207695_10220565 | 3300025913 | Bacteria | 1804 |
| 335 | Ga0207671_10283072 | 3300025914 | Bacteria | 1308 |
| 336 | Ga0207693_10000485 | 3300025915 | Bacteria | 36061 |
| 337 | Ga0207693_10055636 | 3300025915 | Bacteria | 3104 |
| 338 | Ga0207693_10171803 | 3300025915 | Bacteria | 1707 |
| 339 | Ga0207693_10363514 | 3300025915 | Bacteria | 1132 |
| 340 | Ga0207663_10041522 | 3300025916 | Bacteria | 2803 |
| 341 | Ga0207660_10114229 | 3300025917 | Bacteria | 2036 |
| 342 | Ga0207660_10337101 | 3300025917 | Bacteria | 1207 |
| 343 | Ga0207660_10455997 | 3300025917 | Bacteria | 1034 |
| 344 | Ga0207662_10054613 | 3300025918 | Bacteria | 2382 |
| 345 | Ga0207662_10146324 | 3300025918 | Bacteria | 1500 |
| 346 | Ga0207657_10000240 | 3300025919 | Bacteria | 58053 |
| 347 | Ga0207657_10002577 | 3300025919 | Bacteria | 19605 |
| 348 | Ga0207657_10701394 | 3300025919 | Bacteria | 786 |
| 349 | Ga0207649_10042056 | 3300025920 | Bacteria | 2785 |
| 350 | Ga0207649_10069389 | 3300025920 | Bacteria | 2244 |
| 351 | Ga0207649_10089399 | 3300025920 | Bacteria | 2013 |
| 352 | Ga0207652_10008752 | 3300025921 | Bacteria | 8147 |
| 353 | Ga0207652_10050689 | 3300025921 | Bacteria | 3557 |
| 354 | Ga0207652_10174010 | 3300025921 | Bacteria | 1932 |
| 355 | Ga0207652_10343166 | 3300025921 | Bacteria | 1348 |
| 356 | Ga0207652_10493927 | 3300025921 | Bacteria | 1102 |
| 357 | Ga0207652_10640028 | 3300025921 | Bacteria | 951 |
| 358 | Ga0207681_10024021 | 3300025923 | Bacteria | 3907 |
| 359 | Ga0207681_10083649 | 3300025923 | Bacteria | 2259 |
| 360 | Ga0207694_10171593 | 3300025924 | Bacteria | 1756 |
| 361 | Ga0207694_10373780 | 3300025924 | Bacteria | 1182 |
| 362 | Ga0207650_10020951 | 3300025925 | Bacteria | 4618 |
| 363 | Ga0207650_10021783 | 3300025925 | Bacteria | 4532 |
| 364 | Ga0207650_10066683 | 3300025925 | Bacteria | 2699 |
| 365 | Ga0207650_10183340 | 3300025925 | Bacteria | 1669 |
| 366 | Ga0207659_10019552 | 3300025926 | Bacteria | 4461 |
| 367 | Ga0207659_10029096 | 3300025926 | Bacteria | 3761 |
| 368 | Ga0207659_10073026 | 3300025926 | Bacteria | 2510 |
| 369 | Ga0207659_10089151 | 3300025926 | Bacteria | 2300 |
| 370 | Ga0207659_10195386 | 3300025926 | Bacteria | 1612 |
| 371 | Ga0207687_10001442 | 3300025927 | Bacteria | 16268 |
| 372 | Ga0207687_10042059 | 3300025927 | Bacteria | 3141 |
| 373 | Ga0207700_10010411 | 3300025928 | Bacteria | 5867 |
| 374 | Ga0207700_10015613 | 3300025928 | Bacteria | 5016 |
| 375 | Ga0207700_10036619 | 3300025928 | Bacteria | 3547 |
| 376 | Ga0207700_10159423 | 3300025928 | Bacteria | 1873 |
| 377 | Ga0207700_10394235 | 3300025928 | Bacteria | 1212 |
| 378 | Ga0207664_10009373 | 3300025929 | Bacteria | 6867 |
| 379 | Ga0207664_10015854 | 3300025929 | Bacteria | 5486 |
| 380 | Ga0207664_10134989 | 3300025929 | Bacteria | 2081 |
| 381 | Ga0207664_10160377 | 3300025929 | Bacteria | 1918 |
| 382 | Ga0207664_10508323 | 3300025929 | Bacteria | 1079 |
| 383 | Ga0207644_10010849 | 3300025931 | Bacteria | 6015 |
| 384 | Ga0207644_10014416 | 3300025931 | Bacteria | 5288 |
| 385 | Ga0207644_10015490 | 3300025931 | Bacteria | 5119 |
| 386 | Ga0207644_10103945 | 3300025931 | Bacteria | 2138 |
| 387 | Ga0207690_10042995 | 3300025932 | Bacteria | 2971 |
| 388 | Ga0207690_10166598 | 3300025932 | Bacteria | 1647 |
| 389 | Ga0207690_10352325 | 3300025932 | Bacteria | 1164 |
| 390 | Ga0207706_10053246 | 3300025933 | Bacteria | 3573 |
| 391 | Ga0207686_10058449 | 3300025934 | Bacteria | 2431 |
| 392 | Ga0207686_10454499 | 3300025934 | Bacteria | 986 |
| 393 | Ga0207709_10516106 | 3300025935 | Bacteria | 935 |
| 394 | Ga0207670_10173526 | 3300025936 | Bacteria | 1618 |
| 395 | Ga0207669_10125310 | 3300025937 | Bacteria | 1753 |
| 396 | Ga0207669_10158948 | 3300025937 | Bacteria | 1593 |
| 397 | Ga0207669_10282044 | 3300025937 | Bacteria | 1253 |
| 398 | Ga0207665_10052801 | 3300025939 | Bacteria | 2739 |
| 399 | Ga0207691_10000016 | 3300025940 | Bacteria | 141024 |
| 400 | Ga0207691_10000403 | 3300025940 | Bacteria | 43257 |
| 401 | Ga0207691_10004470 | 3300025940 | Bacteria | 13543 |
| 402 | Ga0207691_10005992 | 3300025940 | Bacteria | 11740 |
| 403 | Ga0207691_10049904 | 3300025940 | Bacteria | 3833 |
| 404 | Ga0207691_10094699 | 3300025940 | Bacteria | 2672 |
| 405 | Ga0207711_10000115 | 3300025941 | Bacteria | 83472 |
| 406 | Ga0207711_10415327 | 3300025941 | Bacteria | 1251 |
| 407 | Ga0207711_10557049 | 3300025941 | Bacteria | 1069 |
| 408 | Ga0207689_10007197 | 3300025942 | Bacteria | 9773 |
| 409 | Ga0207689_10013293 | 3300025942 | Bacteria | 7022 |
| 410 | Ga0207689_10237980 | 3300025942 | Bacteria | 1505 |
| 411 | Ga0207661_10145483 | 3300025944 | Bacteria | 2044 |
| 412 | Ga0207679_10151487 | 3300025945 | Bacteria | 1888 |
| 413 | Ga0207679_10184331 | 3300025945 | Bacteria | 1729 |
| 414 | Ga0207679_10297700 | 3300025945 | Bacteria | 1389 |
| 415 | Ga0207679_10392443 | 3300025945 | Bacteria | 1219 |
| 416 | Ga0207667_10071924 | 3300025949 | Bacteria | 3595 |
| 417 | Ga0207667_10106771 | 3300025949 | Bacteria | 2888 |
| 418 | Ga0207651_10000427 | 3300025960 | Bacteria | 17939 |
| 419 | Ga0207651_10020040 | 3300025960 | Bacteria | 4025 |
| 420 | Ga0207651_10026974 | 3300025960 | Bacteria | 3600 |
| 421 | Ga0207651_10029467 | 3300025960 | Bacteria | 3478 |
| 422 | Ga0207651_10035670 | 3300025960 | Bacteria | 3238 |
| 423 | Ga0207668_10045746 | 3300025972 | Bacteria | 2986 |
| 424 | Ga0207668_10097017 | 3300025972 | Bacteria | 2180 |
| 425 | Ga0207668_10111456 | 3300025972 | Bacteria | 2054 |
| 426 | Ga0207668_10182993 | 3300025972 | Bacteria | 1654 |
| 427 | Ga0207640_10009888 | 3300025981 | Bacteria | 5355 |
| 428 | Ga0207640_10023654 | 3300025981 | Bacteria | 3695 |
| 429 | Ga0207640_10035643 | 3300025981 | Bacteria | 3115 |
| 430 | Ga0207640_10056033 | 3300025981 | Bacteria | 2585 |
| 431 | Ga0207640_10464380 | 3300025981 | Bacteria | 1046 |
| 432 | Ga0207658_10017552 | 3300025986 | Bacteria | 4934 |
| 433 | Ga0207658_10027345 | 3300025986 | Bacteria | 4006 |
| 434 | Ga0207658_10105780 | 3300025986 | Bacteria | 2214 |
| 435 | Ga0207658_10251010 | 3300025986 | Bacteria | 1503 |
| 436 | Ga0207677_10000210 | 3300026023 | Bacteria | 47077 |
| 437 | Ga0207677_10010883 | 3300026023 | Bacteria | 5163 |
| 438 | Ga0207677_10106146 | 3300026023 | Bacteria | 2080 |
| 439 | Ga0207677_10413495 | 3300026023 | Bacteria | 1147 |
| 440 | Ga0207703_10000438 | 3300026035 | Bacteria | 43827 |
| 441 | Ga0207639_10047455 | 3300026041 | Bacteria | 3246 |
| 442 | Ga0207639_10120046 | 3300026041 | Bacteria | 2158 |
| 443 | Ga0207639_10214358 | 3300026041 | Bacteria | 1659 |
| 444 | Ga0207639_10419124 | 3300026041 | Bacteria | 1210 |
| 445 | Ga0207678_10045920 | 3300026067 | Bacteria | 3777 |
| 446 | Ga0207678_10150957 | 3300026067 | Bacteria | 1984 |
| 447 | Ga0207678_10153548 | 3300026067 | Bacteria | 1966 |
| 448 | Ga0207678_10272028 | 3300026067 | Bacteria | 1453 |
| 449 | Ga0207708_10033508 | 3300026075 | Bacteria | 3903 |
| 450 | Ga0207702_10016093 | 3300026078 | Bacteria | 6192 |
| 451 | Ga0207702_10028889 | 3300026078 | Bacteria | 4611 |
| 452 | Ga0207702_10056716 | 3300026078 | Bacteria | 3326 |
| 453 | Ga0207702_10449489 | 3300026078 | Bacteria | 1250 |
| 454 | Ga0207702_10461156 | 3300026078 | Bacteria | 1234 |
| 455 | Ga0207702_10909325 | 3300026078 | Bacteria | 872 |
| 456 | Ga0207641_10001573 | 3300026088 | Bacteria | 22307 |
| 457 | Ga0207641_10047920 | 3300026088 | Bacteria | 3605 |
| 458 | Ga0207641_10513885 | 3300026088 | Bacteria | 1164 |
| 459 | Ga0207648_10022497 | 3300026089 | Bacteria | 5658 |
| 460 | Ga0207648_10105331 | 3300026089 | Bacteria | 2474 |
| 461 | Ga0207648_10377093 | 3300026089 | Bacteria | 1282 |
| 462 | Ga0207648_10428040 | 3300026089 | Bacteria | 1203 |
| 463 | Ga0207676_10000415 | 3300026095 | Bacteria | 36094 |
| 464 | Ga0207676_10013255 | 3300026095 | Bacteria | 5921 |
| 465 | Ga0207676_10047895 | 3300026095 | Bacteria | 3315 |
| 466 | Ga0207676_10078201 | 3300026095 | Bacteria | 2678 |
| 467 | Ga0207676_10410373 | 3300026095 | Bacteria | 1268 |
| 468 | Ga0207676_10665449 | 3300026095 | Bacteria | 1006 |
| 469 | Ga0207674_10000237 | 3300026116 | Bacteria | 68721 |
| 470 | Ga0207674_10006274 | 3300026116 | Bacteria | 14012 |
| 471 | Ga0207674_10050952 | 3300026116 | Bacteria | 4226 |
| 472 | Ga0207674_10156279 | 3300026116 | Bacteria | 2236 |
| 473 | Ga0207674_10705792 | 3300026116 | Bacteria | 974 |
| 474 | Ga0207675_100028498 | 3300026118 | Bacteria | 5199 |
| 475 | Ga0207675_100032081 | 3300026118 | Bacteria | 4893 |
| 476 | Ga0207675_100046380 | 3300026118 | Bacteria | 4060 |
| 477 | Ga0207675_100143050 | 3300026118 | Bacteria | 2273 |
| 478 | Ga0207675_100272663 | 3300026118 | Bacteria | 1642 |
| 479 | Ga0207683_10000322 | 3300026121 | Bacteria | 43758 |
| 480 | Ga0207683_10005374 | 3300026121 | Bacteria | 10981 |
| 481 | Ga0207683_10038415 | 3300026121 | Bacteria | 4172 |
| 482 | Ga0207683_10322733 | 3300026121 | Bacteria | 1415 |
| 483 | Ga0207698_10012505 | 3300026142 | Bacteria | 5558 |
| 484 | Ga0207698_10086819 | 3300026142 | Bacteria | 2546 |
| 485 | Ga0207698_10093281 | 3300026142 | Bacteria | 2471 |
| 486 | Ga0207698_10115819 | 3300026142 | Bacteria | 2258 |
| 487 | Ga0207698_10147089 | 3300026142 | Bacteria | 2039 |
| 488 | Ga0207698_10260853 | 3300026142 | Bacteria | 1592 |
| 489 | Ga0268266_10008005 | 3300028379 | Bacteria | 9450 |
| 490 | Ga0268266_10027867 | 3300028379 | Bacteria | 4803 |
| 491 | Ga0268266_10049569 | 3300028379 | Bacteria | 3601 |
| 492 | Ga0268266_10142775 | 3300028379 | Bacteria | 2150 |
| 493 | Ga0268266_10277195 | 3300028379 | Bacteria | 1558 |
| 494 | Ga0268265_10038952 | 3300028380 | Bacteria | 3500 |
| 495 | Ga0268265_10469516 | 3300028380 | Bacteria | 1179 |
| 496 | Ga0268264_10001696 | 3300028381 | Bacteria | 20279 |
| 497 | Ga0268264_10092407 | 3300028381 | Bacteria | 2612 |
| 498 | Ga0268264_10351872 | 3300028381 | Bacteria | 1402 |
| 499 | Ga0268264_10395140 | 3300028381 | Bacteria | 1327 |
| 500 | Ga0268264_10558636 | 3300028381 | Bacteria | 1123 |
| 501 | Ga0268264_10668912 | 3300028381 | Bacteria | 1029 |
| 502 | Ga0268264_10735130 | 3300028381 | Bacteria | 982 |
| 503 | Ga0265332_10002744 | 3300031238 | Bacteria | 8776 |
| 504 | Ga0265325_10034431 | 3300031241 | Bacteria | 2694 |
| 505 | Ga0265329_10022400 | 3300031242 | Bacteria | 2114 |
| 506 | Ga0265331_10016184 | 3300031250 | Bacteria | 3920 |
| 507 | Ga0265327_10015235 | 3300031251 | Bacteria | 4978 |
| 508 | Ga0265316_10297821 | 3300031344 | Bacteria | 1175 |
| 509 | Ga0307516_10031515 | 3300031730 | Bacteria | 5343 |
| 510 | Ga0307413_10174906 | 3300031824 | Bacteria | 1524 |
| 511 | Ga0307410_10191898 | 3300031852 | Bacteria | 1554 |
| 512 | Ga0307412_10222448 | 3300031911 | Bacteria | 1448 |
| 513 | Ga0307412_10376139 | 3300031911 | Bacteria | 1148 |
| 514 | Ga0307409_100029964 | 3300031995 | Bacteria | 3903 |
| 515 | Ga0307416_100301141 | 3300032002 | Bacteria | 1594 |
| 516 | Ga0307414_10130847 | 3300032004 | Bacteria | 1948 |
| 517 | Ga0307411_10006056 | 3300032005 | Bacteria | 6013 |
| 518 | Ga0307411_10125323 | 3300032005 | Bacteria | 1867 |
| 519 | Ga0373928_0022491 | 3300035084 | Bacteria | 1338 |
| 520 | Ga0373934_0021469 | 3300035086 | Bacteria | 2485 |
| 521 | Ga0373936_0145769 | 3300035113 | Bacteria | 1024 |
| 522 | Ga0373953_0097056 | 3300035117 | Bacteria | 1237 |
| 523 | Ga0373954_0003066 | 3300035118 | Bacteria | 7055 |
| 524 | Ga0373956_0134589 | 3300035119 | Bacteria | 1158 |
| 525 | Ga0373957_0003850 | 3300035120 | Bacteria | 4500 |
| 526 | Ga0373943_0033714 | 3300035170 | Bacteria | 2441 |
| 527 | Ga0373946_0114061 | 3300035171 | Bacteria | 1226 |
| 528 | Ga0373955_0003010 | 3300035172 | Bacteria | 7384 |
| 529 | Ga0373924_0006705 | 3300035410 | Bacteria | 4134 |
| 530 | Ga0373931_0044303 | 3300035691 | Bacteria | 2346 |
| 531 | Ga0373927_0080462 | 3300035695 | Bacteria | 2111 |
| 532 | Ga0373933_0015824 | 3300035724 | Bacteria | 4209 |
| 533 | Ga0373933_0026781 | 3300035724 | Bacteria | 3314 |
| 534 | Ga0373947_0032374 | 3300035725 | Bacteria | 3081 |
| 535 | Ga0373937_0009175 | 3300036401 | Bacteria | 8586 |
| 536 | Ga0373937_0024904 | 3300036401 | Bacteria | 5401 |
| 537 | Ga0373937_0524797 | 3300036401 | Bacteria | 1125 |
| 538 | Ga0373925_0059311 | 3300037068 | Bacteria | 2870 |
| 539 | Ga0373925_0112638 | 3300037068 | Bacteria | 2103 |
| 540 | Ga0395899_0104107 | 3300037312 | Bacteria | 2046 |
| 541 | Ga0395900_0341325 | 3300037418 | Bacteria | 1473 |
| 542 | Ga0395898_0199776 | 3300037466 | Bacteria | 1909 |
| 543 | Ga0395901_0069237 | 3300038443 | Bacteria | 3675 |
| 544 | Ga0395901_0324675 | 3300038443 | Bacteria | 1592 |
| 545 | Ga0451577_0002330 | 3300042876 | Bacteria | 22882 |
| 546 | Ga0451577_0423642 | 3300042876 | Bacteria | 1209 |
| 547 | Ga0453683_0086917 | 3300044673 | Bacteria | 1959 |
| 548 | Ga0466963_0021552 | 3300044694 | Bacteria | 4068 |
| 549 | Ga0453684_0008886 | 3300044712 | Bacteria | 17799 |
| 550 | Ga0453684_0110465 | 3300044712 | Bacteria | 3341 |
| 551 | Ga0451576_0002999 | 3300045051 | Bacteria | 23862 |
| 552 | Ga0451576_0315382 | 3300045051 | Bacteria | 1636 |
| 553 | Ga0451576_0320270 | 3300045051 | Bacteria | 1622 |
| 554 | Ga0495629_0106737 | 3300046459 | Bacteria | 1953 |
| 555 | Ga0495651_0360249 | 3300046462 | Bacteria | 959 |
| 556 | Ga0495580_0119055 | 3300046472 | Bacteria | 1833 |
| 557 | Ga0495639_0053629 | 3300046475 | Bacteria | 1837 |
| 558 | Ga0495662_0056805 | 3300046476 | Bacteria | 1890 |
| 559 | Ga0495594_0097429 | 3300046499 | Bacteria | 1653 |
| 560 | Ga0495606_0037758 | 3300046507 | Bacteria | 3276 |
| 561 | Ga0495606_0053060 | 3300046507 | Bacteria | 2632 |
| 562 | Ga0495630_0083896 | 3300046517 | Bacteria | 2406 |
| 563 | Ga0495654_0021588 | 3300046530 | Bacteria | 3348 |
| 564 | Ga0495665_0010339 | 3300046531 | Bacteria | 5050 |
| 565 | Ga0495640_0211486 | 3300046533 | Bacteria | 1226 |
| 566 | Ga0495609_0101809 | 3300046538 | Bacteria | 1244 |
| 567 | Ga0495645_0088355 | 3300046543 | Bacteria | 2217 |
| 568 | Ga0495645_0228964 | 3300046543 | Bacteria | 1246 |
| 569 | Ga0495635_0043202 | 3300046663 | Bacteria | 3110 |
| 570 | Ga0495659_0000122 | 3300046664 | Bacteria | 34041 |
| 571 | Ga0495623_0059055 | 3300046679 | Bacteria | 2410 |
| 572 | Ga0495613_0024468 | 3300046689 | Bacteria | 4499 |
| 573 | Ga0495671_0000430 | 3300046692 | Bacteria | 33279 |
| 574 | Ga0495660_0002980 | 3300046810 | Bacteria | 10569 |
| 575 | Ga0495674_0491516 | 3300047319 | Bacteria | 982 |
| 576 | Ga0495672_0000176 | 3300047320 | Bacteria | 92728 |
| 577 | Ga0495676_0508718 | 3300047321 | Bacteria | 790 |
| 578 | Ga0495680_0037414 | 3300047322 | Bacteria | 3887 |
| 579 | Ga0495675_0079181 | 3300047444 | Bacteria | 2070 |
| 580 | Ga0495684_0039104 | 3300047471 | Bacteria | 3636 |
| 581 | Ga0495684_0334449 | 3300047471 | Bacteria | 1079 |
| 582 | Ga0495686_0009713 | 3300047472 | Bacteria | 6907 |
| 583 | Ga0495602_0219067 | 3300048088 | Bacteria | 1438 |
| 584 | Ga0495614_0012737 | 3300048089 | Bacteria | 3690 |
| 585 | Ga0496100_0064502 | 3300048903 | Bacteria | 2424 |
| 586 | Ga0496101_0010694 | 3300048904 | Bacteria | 6065 |
| 587 | Ga0496101_0462870 | 3300048904 | Bacteria | 1001 |
| 588 | Ga0496104_0023522 | 3300048907 | Bacteria | 5665 |
| 589 | Ga0496105_0019861 | 3300048908 | Bacteria | 5421 |
| 590 | Ga0496106_0101829 | 3300048909 | Bacteria | 2228 |
| 591 | Ga0496106_0653294 | 3300048909 | Bacteria | 840 |
| 592 | Ga0496109_0020289 | 3300048912 | Bacteria | 5869 |
| 593 | Ga0496109_0408504 | 3300048912 | Bacteria | 1283 |
| 594 | Ga0496110_0137917 | 3300048913 | Bacteria | 2205 |
| 595 | Ga0496112_0002173 | 3300048915 | Bacteria | 15586 |
| 596 | Ga0496112_0026219 | 3300048915 | Bacteria | 5605 |
| 597 | Ga0496112_0154404 | 3300048915 | Bacteria | 2263 |
| 598 | Ga0496114_0028308 | 3300048917 | Bacteria | 4597 |
| 599 | Ga0496114_0362275 | 3300048917 | Bacteria | 1283 |
| 600 | Ga0496125_0182914 | 3300048928 | Bacteria | 1394 |
| 601 | Ga0501310_002663 | 3300049130 | Bacteria | 1706 |
| 602 | Ga0501033_0171338 | 3300049570 | Bacteria | 1559 |
| 603 | Ga0501038_0445391 | 3300049574 | Bacteria | 996 |
| 604 | Ga0501040_0247710 | 3300049576 | Bacteria | 1271 |
| 605 | Ga0501067_0037399 | 3300049583 | Bacteria | 2696 |
| 606 | Ga0501219_012304 | 3300049703 | Bacteria | 662 |
| 607 | Ga0501035_0006955 | 3300049822 | Bacteria | 10565 |
| 608 | Ga0501044_0001056 | 3300049823 | Bacteria | 33138 |
| 609 | Ga0501045_0437962 | 3300049824 | Bacteria | 972 |
| 610 | nmdc:mga0rr50_88706_c1 | 3300050513 | Bacteria | 2403 |
| 611 | nmdc:mga08x19_30093_c1 | 3300050514 | Bacteria | 3409 |
| 612 | nmdc:mga08x19_49289_c1 | 3300050514 | Bacteria | 2700 |
| 613 | Ga0495612_0017904 | 3300053078 | Bacteria | 2836 |
| 614 | Ga0495619_0005152 | 3300053085 | Bacteria | 8295 |
| 615 | Ga0500634_0016000 | 3300053161 | Bacteria | 3997 |
| 616 | Ga0587093_025330 | 3300059478 | Bacteria | 822 |
| 617 | Ga0587090_040772 | 3300059510 | Bacteria | 816 |
| 618 | Ga0587113_010239 | 3300059625 | Bacteria | 862 |
| 619 | Ga0587115_014942 | 3300059626 | Bacteria | 1022 |
| 620 | Ga0587128_026143 | 3300059630 | Bacteria | 934 |
| 621 | Ga0587068_031069 | 3300059641 | Bacteria | 926 |
| 622 | Ga0587075_017360 | 3300059644 | Bacteria | 1034 |
| 623 | Ga0587078_016403 | 3300059646 | Bacteria | 902 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053161 | Ga0500634_0016000 | Ga0500634_0016000_3400_3984 | 180 |
| 2 | 3300046543 | Ga0495645_0228964 | Ga0495645_0228964_12_608 | 184 |
| 3 | 3300047471 | Ga0495684_0334449 | Ga0495684_0334449_10_606 | 184 |
| 4 | 3300048928 | Ga0496125_0182914 | Ga0496125_0182914_542_1222 | 187 |
| 5 | 3300025945 | Ga0207679_10297700 | Ga0207679_102977002 | 193 |
| 6 | 3300049703 | Ga0501219_012304 | Ga0501219_012304_28_651 | 193 |
| 7 | 3300048917 | Ga0496114_0362275 | Ga0496114_0362275_510_1208 | 195 |
| 8 | 3300013104 | Ga0157370_10005883 | Ga0157370_100058835 | 200 |
| 9 | 3300013105 | Ga0157369_10194997 | Ga0157369_101949972 | 200 |
| 10 | 3300013307 | Ga0157372_10132165 | Ga0157372_101321653 | 200 |
| 11 | 3300005328 | Ga0070676_10341499 | Ga0070676_103414991 | 203 |
| 12 | 3300005355 | Ga0070671_100346011 | Ga0070671_1003460112 | 203 |
| 13 | 3300005356 | Ga0070674_100065882 | Ga0070674_1000658824 | 203 |
| 14 | 3300005456 | Ga0070678_100093439 | Ga0070678_1000934392 | 203 |
| 15 | 3300005548 | Ga0070665_100021232 | Ga0070665_1000212323 | 203 |
| 16 | 3300005618 | Ga0068864_100502645 | Ga0068864_1005026452 | 203 |
| 17 | 3300009177 | Ga0105248_10121389 | Ga0105248_101213893 | 203 |
| 18 | 3300013308 | Ga0157375_10243716 | Ga0157375_102437162 | 203 |
| 19 | 3300014969 | Ga0157376_10358740 | Ga0157376_103587401 | 203 |
| 20 | 3300017792 | Ga0163161_10293990 | Ga0163161_102939902 | 203 |
| 21 | 3300025926 | Ga0207659_10195386 | Ga0207659_101953863 | 203 |
| 22 | 3300025937 | Ga0207669_10282044 | Ga0207669_102820443 | 203 |
| 23 | 3300026088 | Ga0207641_10513885 | Ga0207641_105138852 | 203 |
| 24 | 3300026121 | Ga0207683_10038415 | Ga0207683_100384153 | 203 |
| 25 | 3300028381 | Ga0268264_10668912 | Ga0268264_106689121 | 203 |
| 26 | 3300005333 | Ga0070677_10114922 | Ga0070677_101149221 | 204 |
| 27 | 3300005334 | Ga0068869_100072952 | Ga0068869_1000729521 | 204 |
| 28 | 3300005364 | Ga0070673_100124315 | Ga0070673_1001243151 | 204 |
| 29 | 3300005543 | Ga0070672_100028844 | Ga0070672_1000288444 | 204 |
| 30 | 3300005718 | Ga0068866_10208924 | Ga0068866_102089242 | 204 |
| 31 | 3300005842 | Ga0068858_100452841 | Ga0068858_1004528413 | 204 |
| 32 | 3300005843 | Ga0068860_100022393 | Ga0068860_1000223933 | 204 |
| 33 | 3300006237 | Ga0097621_100027814 | Ga0097621_1000278145 | 204 |
| 34 | 3300006881 | Ga0068865_100195897 | Ga0068865_1001958972 | 204 |
| 35 | 3300009148 | Ga0105243_10057543 | Ga0105243_100575431 | 204 |
| 36 | 3300013306 | Ga0163162_10290493 | Ga0163162_102904931 | 204 |
| 37 | 3300013308 | Ga0157375_10439583 | Ga0157375_104395832 | 204 |
| 38 | 3300014326 | Ga0157380_10043712 | Ga0157380_100437124 | 204 |
| 39 | 3300025893 | Ga0207682_10115312 | Ga0207682_101153121 | 204 |
| 40 | 3300025908 | Ga0207643_10031149 | Ga0207643_100311492 | 204 |
| 41 | 3300025918 | Ga0207662_10146324 | Ga0207662_101463242 | 204 |
| 42 | 3300025923 | Ga0207681_10083649 | Ga0207681_100836493 | 204 |
| 43 | 3300025935 | Ga0207709_10516106 | Ga0207709_105161061 | 204 |
| 44 | 3300025936 | Ga0207670_10173526 | Ga0207670_101735262 | 204 |
| 45 | 3300025940 | Ga0207691_10049904 | Ga0207691_100499042 | 204 |
| 46 | 3300025942 | Ga0207689_10007197 | Ga0207689_100071977 | 204 |
| 47 | 3300025960 | Ga0207651_10035670 | Ga0207651_100356704 | 204 |
| 48 | 3300026075 | Ga0207708_10033508 | Ga0207708_100335081 | 204 |
| 49 | 3300026089 | Ga0207648_10377093 | Ga0207648_103770932 | 204 |
| 50 | 3300026118 | Ga0207675_100028498 | Ga0207675_1000284986 | 204 |
| 51 | 3300026121 | Ga0207683_10322733 | Ga0207683_103227331 | 204 |
| 52 | 3300028380 | Ga0268265_10469516 | Ga0268265_104695161 | 204 |
| 53 | 3300028381 | Ga0268264_10092407 | Ga0268264_100924072 | 204 |
| 54 | 3300028381 | Ga0268264_10735130 | Ga0268264_107351301 | 204 |
| 55 | 3300005937 | Ga0081455_10172117 | Ga0081455_101721172 | 205 |
| 56 | 3300006358 | Ga0068871_100285365 | Ga0068871_1002853652 | 205 |
| 57 | 3300013297 | Ga0157378_10165684 | Ga0157378_101656843 | 205 |
| 58 | 3300014969 | Ga0157376_10234134 | Ga0157376_102341341 | 205 |
| 59 | 3300005459 | Ga0068867_100487133 | Ga0068867_1004871332 | 206 |
| 60 | 3300009177 | Ga0105248_10310224 | Ga0105248_103102241 | 206 |
| 61 | 3300005327 | Ga0070658_10622671 | Ga0070658_106226711 | 207 |
| 62 | 3300005329 | Ga0070683_100171932 | Ga0070683_1001719324 | 207 |
| 63 | 3300005334 | Ga0068869_100100776 | Ga0068869_1001007762 | 207 |
| 64 | 3300005435 | Ga0070714_100854003 | Ga0070714_1008540031 | 207 |
| 65 | 3300005458 | Ga0070681_10005398 | Ga0070681_100053981 | 207 |
| 66 | 3300005530 | Ga0070679_100215667 | Ga0070679_1002156672 | 207 |
| 67 | 3300005564 | Ga0070664_100595648 | Ga0070664_1005956481 | 207 |
| 68 | 3300005844 | Ga0068862_100111823 | Ga0068862_1001118232 | 207 |
| 69 | 3300009093 | Ga0105240_10810231 | Ga0105240_108102311 | 207 |
| 70 | 3300013105 | Ga0157369_10005394 | Ga0157369_1000539414 | 207 |
| 71 | 3300013307 | Ga0157372_10057898 | Ga0157372_100578983 | 207 |
| 72 | 3300025909 | Ga0207705_10480875 | Ga0207705_104808751 | 207 |
| 73 | 3300025919 | Ga0207657_10701394 | Ga0207657_107013941 | 207 |
| 74 | 3300025921 | Ga0207652_10174010 | Ga0207652_101740102 | 207 |
| 75 | 3300025926 | Ga0207659_10073026 | Ga0207659_100730262 | 207 |
| 76 | 3300025928 | Ga0207700_10394235 | Ga0207700_103942351 | 207 |
| 77 | 3300025929 | Ga0207664_10160377 | Ga0207664_101603773 | 207 |
| 78 | 3300026078 | Ga0207702_10449489 | Ga0207702_104494892 | 207 |
| 79 | 3300026078 | Ga0207702_10909325 | Ga0207702_109093251 | 207 |
| 80 | 3300026116 | Ga0207674_10156279 | Ga0207674_101562791 | 207 |
| 81 | 3300036401 | Ga0373937_0524797 | Ga0373937_0524797_331_1062 | 207 |
| 82 | 3300037312 | Ga0395899_0104107 | Ga0395899_0104107_664_1371 | 207 |
| 83 | 3300037418 | Ga0395900_0341325 | Ga0395900_0341325_593_1300 | 207 |
| 84 | 3300037466 | Ga0395898_0199776 | Ga0395898_0199776_900_1607 | 207 |
| 85 | 3300038443 | Ga0395901_0069237 | Ga0395901_0069237_1838_2545 | 207 |
| 86 | 3300005328 | Ga0070676_10362219 | Ga0070676_103622191 | 208 |
| 87 | 3300005331 | Ga0070670_100030196 | Ga0070670_1000301964 | 208 |
| 88 | 3300005331 | Ga0070670_100034350 | Ga0070670_1000343503 | 208 |
| 89 | 3300005618 | Ga0068864_100177810 | Ga0068864_1001778102 | 208 |
| 90 | 3300005841 | Ga0068863_100401422 | Ga0068863_1004014221 | 208 |
| 91 | 3300006844 | Ga0075428_100170197 | Ga0075428_1001701973 | 208 |
| 92 | 3300014497 | Ga0182008_10067352 | Ga0182008_100673521 | 208 |
| 93 | 3300025925 | Ga0207650_10066683 | Ga0207650_100666832 | 208 |
| 94 | 3300026095 | Ga0207676_10013255 | Ga0207676_100132555 | 208 |
| 95 | 3300031730 | Ga0307516_10031515 | Ga0307516_100315153 | 208 |
| 96 | 3300050514 | nmdc:mga08x19_30093_c1 | nmdc:mga08x19_30093_c1_1535_2209 | 208 |
| 97 | iso_pu_bacteria | 2643221664 | 2644357137 | 208 |
| 98 | iso_pu_bacteria | 2738541280 | 2738741600 | 208 |
| 99 | iso_pu_bacteria | 2738541300 | 2738843784 | 208 |
| 100 | iso_pu_bacteria | 2738543018 | 2739275135 | 208 |
| 101 | iso_pu_bacteria | 2738543030 | 2739344179 | 208 |
| 102 | 3300005436 | Ga0070713_100142839 | Ga0070713_1001428392 | 209 |
| 103 | 3300013104 | Ga0157370_10009707 | Ga0157370_100097077 | 209 |
| 104 | 3300025912 | Ga0207707_10403609 | Ga0207707_104036092 | 209 |
| 105 | 3300044694 | Ga0466963_0021552 | Ga0466963_0021552_313_1020 | 209 |
| 106 | 3300047321 | Ga0495676_0508718 | Ga0495676_0508718_86_775 | 209 |
| 107 | 3300005336 | Ga0070680_100212762 | Ga0070680_1002127622 | 210 |
| 108 | 3300005339 | Ga0070660_100332316 | Ga0070660_1003323162 | 210 |
| 109 | 3300005366 | Ga0070659_100288401 | Ga0070659_1002884012 | 210 |
| 110 | 3300005530 | Ga0070679_100310377 | Ga0070679_1003103771 | 210 |
| 111 | 3300005616 | Ga0068852_100112895 | Ga0068852_1001128952 | 210 |
| 112 | 3300025917 | Ga0207660_10337101 | Ga0207660_103371012 | 210 |
| 113 | 3300025921 | Ga0207652_10493927 | Ga0207652_104939271 | 210 |
| 114 | 3300025921 | Ga0207652_10640028 | Ga0207652_106400281 | 210 |
| 115 | 3300026142 | Ga0207698_10260853 | Ga0207698_102608531 | 210 |
| 116 | 3300042876 | Ga0451577_0423642 | Ga0451577_0423642_260_973 | 210 |
| 117 | 3300048909 | Ga0496106_0653294 | Ga0496106_0653294_114_827 | 210 |
| 118 | 3300049583 | Ga0501067_0037399 | Ga0501067_0037399_1889_2602 | 210 |
| 119 | 3300005564 | Ga0070664_100271007 | Ga0070664_1002710072 | 211 |
| 120 | 3300005577 | Ga0068857_100160467 | Ga0068857_1001604672 | 211 |
| 121 | 3300006237 | Ga0097621_100419683 | Ga0097621_1004196832 | 211 |
| 122 | 3300006844 | Ga0075428_100235058 | Ga0075428_1002350583 | 211 |
| 123 | 3300013100 | Ga0157373_10485500 | Ga0157373_104855001 | 211 |
| 124 | 3300025915 | Ga0207693_10171803 | Ga0207693_101718031 | 211 |
| 125 | 3300025920 | Ga0207649_10089399 | Ga0207649_100893992 | 211 |
| 126 | 3300025945 | Ga0207679_10392443 | Ga0207679_103924432 | 211 |
| 127 | 3300026095 | Ga0207676_10665449 | Ga0207676_106654491 | 211 |
| 128 | 3300049576 | Ga0501040_0247710 | Ga0501040_0247710_157_861 | 211 |
| 129 | 3300005435 | Ga0070714_100209573 | Ga0070714_1002095731 | 212 |
| 130 | 3300046507 | Ga0495606_0037758 | Ga0495606_0037758_1842_2525 | 212 |
| 131 | 3300046530 | Ga0495654_0021588 | Ga0495654_0021588_1714_2397 | 212 |
| 132 | 3300046664 | Ga0495659_0000122 | Ga0495659_0000122_4678_5361 | 212 |
| 133 | 3300046692 | Ga0495671_0000430 | Ga0495671_0000430_26948_27631 | 212 |
| 134 | 3300047320 | Ga0495672_0000176 | Ga0495672_0000176_64044_64727 | 212 |
| 135 | 3300049130 | Ga0501310_002663 | Ga0501310_002663_1004_1687 | 212 |
| 136 | 3300005328 | Ga0070676_10000975 | Ga0070676_100009759 | 213 |
| 137 | 3300005331 | Ga0070670_100118242 | Ga0070670_1001182421 | 213 |
| 138 | 3300005333 | Ga0070677_10000807 | Ga0070677_1000080712 | 213 |
| 139 | 3300005338 | Ga0068868_100005645 | Ga0068868_1000056451 | 213 |
| 140 | 3300005347 | Ga0070668_100011053 | Ga0070668_1000110535 | 213 |
| 141 | 3300005354 | Ga0070675_100028134 | Ga0070675_1000281344 | 213 |
| 142 | 3300005355 | Ga0070671_100002986 | Ga0070671_10000298613 | 213 |
| 143 | 3300005356 | Ga0070674_100014547 | Ga0070674_1000145475 | 213 |
| 144 | 3300005364 | Ga0070673_100005830 | Ga0070673_1000058308 | 213 |
| 145 | 3300005365 | Ga0070688_100204330 | Ga0070688_1002043301 | 213 |
| 146 | 3300005367 | Ga0070667_100003537 | Ga0070667_10000353714 | 213 |
| 147 | 3300005367 | Ga0070667_100013731 | Ga0070667_10001373111 | 213 |
| 148 | 3300005434 | Ga0070709_10001951 | Ga0070709_1000195111 | 213 |
| 149 | 3300005435 | Ga0070714_100040356 | Ga0070714_1000403565 | 213 |
| 150 | 3300005436 | Ga0070713_100020507 | Ga0070713_1000205071 | 213 |
| 151 | 3300005437 | Ga0070710_10036498 | Ga0070710_100364983 | 213 |
| 152 | 3300005455 | Ga0070663_100146392 | Ga0070663_1001463922 | 213 |
| 153 | 3300005456 | Ga0070678_100001518 | Ga0070678_1000015186 | 213 |
| 154 | 3300005458 | Ga0070681_10348590 | Ga0070681_103485901 | 213 |
| 155 | 3300005459 | Ga0068867_100008965 | Ga0068867_1000089652 | 213 |
| 156 | 3300005518 | Ga0070699_100023002 | Ga0070699_1000230026 | 213 |
| 157 | 3300005530 | Ga0070679_100151429 | Ga0070679_1001514292 | 213 |
| 158 | 3300005543 | Ga0070672_100002977 | Ga0070672_10000297713 | 213 |
| 159 | 3300005543 | Ga0070672_100079170 | Ga0070672_1000791704 | 213 |
| 160 | 3300005546 | Ga0070696_100035587 | Ga0070696_1000355873 | 213 |
| 161 | 3300005548 | Ga0070665_100001417 | Ga0070665_10000141714 | 213 |
| 162 | 3300005616 | Ga0068852_100012670 | Ga0068852_1000126708 | 213 |
| 163 | 3300005617 | Ga0068859_100156595 | Ga0068859_1001565952 | 213 |
| 164 | 3300005719 | Ga0068861_100307053 | Ga0068861_1003070531 | 213 |
| 165 | 3300005840 | Ga0068870_10004919 | Ga0068870_100049195 | 213 |
| 166 | 3300005841 | Ga0068863_100036668 | Ga0068863_1000366686 | 213 |
| 167 | 3300005842 | Ga0068858_100141381 | Ga0068858_1001413812 | 213 |
| 168 | 3300005843 | Ga0068860_100008471 | Ga0068860_1000084719 | 213 |
| 169 | 3300006237 | Ga0097621_100005686 | Ga0097621_1000056865 | 213 |
| 170 | 3300006358 | Ga0068871_100050572 | Ga0068871_1000505721 | 213 |
| 171 | 3300006931 | Ga0097620_100156598 | Ga0097620_1001565983 | 213 |
| 172 | 3300013104 | Ga0157370_10026468 | Ga0157370_100264681 | 213 |
| 173 | 3300013307 | Ga0157372_10271123 | Ga0157372_102711233 | 213 |
| 174 | 3300013308 | Ga0157375_10006021 | Ga0157375_100060218 | 213 |
| 175 | 3300014745 | Ga0157377_10451438 | Ga0157377_104514381 | 213 |
| 176 | 3300014969 | Ga0157376_10111908 | Ga0157376_101119082 | 213 |
| 177 | 3300025315 | Ga0207697_10022631 | Ga0207697_100226314 | 213 |
| 178 | 3300025893 | Ga0207682_10000061 | Ga0207682_1000006138 | 213 |
| 179 | 3300025898 | Ga0207692_10283412 | Ga0207692_102834121 | 213 |
| 180 | 3300025903 | Ga0207680_10286128 | Ga0207680_102861281 | 213 |
| 181 | 3300025906 | Ga0207699_10134270 | Ga0207699_101342701 | 213 |
| 182 | 3300025907 | Ga0207645_10002609 | Ga0207645_100026098 | 213 |
| 183 | 3300025908 | Ga0207643_10005370 | Ga0207643_100053709 | 213 |
| 184 | 3300025909 | Ga0207705_10274479 | Ga0207705_102744792 | 213 |
| 185 | 3300025912 | Ga0207707_10109658 | Ga0207707_101096583 | 213 |
| 186 | 3300025913 | Ga0207695_10039493 | Ga0207695_100394935 | 213 |
| 187 | 3300025917 | Ga0207660_10455997 | Ga0207660_104559971 | 213 |
| 188 | 3300025921 | Ga0207652_10343166 | Ga0207652_103431662 | 213 |
| 189 | 3300025925 | Ga0207650_10183340 | Ga0207650_101833402 | 213 |
| 190 | 3300025926 | Ga0207659_10029096 | Ga0207659_100290964 | 213 |
| 191 | 3300025928 | Ga0207700_10015613 | Ga0207700_100156136 | 213 |
| 192 | 3300025929 | Ga0207664_10009373 | Ga0207664_100093737 | 213 |
| 193 | 3300025931 | Ga0207644_10015490 | Ga0207644_100154906 | 213 |
| 194 | 3300025934 | Ga0207686_10454499 | Ga0207686_104544991 | 213 |
| 195 | 3300025940 | Ga0207691_10000016 | Ga0207691_10000016142 | 213 |
| 196 | 3300025940 | Ga0207691_10094699 | Ga0207691_100946994 | 213 |
| 197 | 3300025960 | Ga0207651_10020040 | Ga0207651_100200405 | 213 |
| 198 | 3300025972 | Ga0207668_10045746 | Ga0207668_100457465 | 213 |
| 199 | 3300025981 | Ga0207640_10464380 | Ga0207640_104643801 | 213 |
| 200 | 3300025986 | Ga0207658_10251010 | Ga0207658_102510102 | 213 |
| 201 | 3300026023 | Ga0207677_10010883 | Ga0207677_100108836 | 213 |
| 202 | 3300026067 | Ga0207678_10045920 | Ga0207678_100459202 | 213 |
| 203 | 3300026088 | Ga0207641_10047920 | Ga0207641_100479204 | 213 |
| 204 | 3300026089 | Ga0207648_10022497 | Ga0207648_100224972 | 213 |
| 205 | 3300026118 | Ga0207675_100046380 | Ga0207675_1000463806 | 213 |
| 206 | 3300026121 | Ga0207683_10000322 | Ga0207683_1000032212 | 213 |
| 207 | 3300026142 | Ga0207698_10093281 | Ga0207698_100932815 | 213 |
| 208 | 3300028379 | Ga0268266_10027867 | Ga0268266_100278674 | 213 |
| 209 | 3300028381 | Ga0268264_10558636 | Ga0268264_105586361 | 213 |
| 210 | 3300042876 | Ga0451577_0002330 | Ga0451577_0002330_6630_7313 | 213 |
| 211 | 3300044712 | Ga0453684_0008886 | Ga0453684_0008886_14164_14847 | 213 |
| 212 | 3300044712 | Ga0453684_0110465 | Ga0453684_0110465_1024_1707 | 213 |
| 213 | 3300045051 | Ga0451576_0002999 | Ga0451576_0002999_55_738 | 213 |
| 214 | 3300045051 | Ga0451576_0320270 | Ga0451576_0320270_635_1318 | 213 |
| 215 | 3300026116 | Ga0207674_10705792 | Ga0207674_107057921 | 214 |
| 216 | 3300031911 | Ga0307412_10376139 | Ga0307412_103761392 | 214 |
| 217 | 3300032005 | Ga0307411_10125323 | Ga0307411_101253232 | 214 |
| 218 | 3300046507 | Ga0495606_0053060 | Ga0495606_0053060_664_1353 | 214 |
| 219 | 3300046538 | Ga0495609_0101809 | Ga0495609_0101809_454_1143 | 214 |
| 220 | 3300046810 | Ga0495660_0002980 | Ga0495660_0002980_5603_6292 | 214 |
| 221 | 3300047472 | Ga0495686_0009713 | Ga0495686_0009713_3508_4197 | 214 |
| 222 | iso_pu_bacteria | 2887375801 | 2887377906 | 214 |
| 223 | 3300005842 | Ga0068858_100389535 | Ga0068858_1003895351 | 215 |
| 224 | 3300006195 | Ga0075366_10133174 | Ga0075366_101331742 | 215 |
| 225 | 3300025901 | Ga0207688_10013116 | Ga0207688_100131163 | 215 |
| 226 | 3300044673 | Ga0453683_0086917 | Ga0453683_0086917_287_976 | 215 |
| 227 | 3300045051 | Ga0451576_0315382 | Ga0451576_0315382_840_1529 | 215 |
| 228 | 3300049824 | Ga0501045_0437962 | Ga0501045_0437962_193_909 | 215 |
| 229 | 3300005331 | Ga0070670_100284706 | Ga0070670_1002847062 | 216 |
| 230 | 3300005340 | Ga0070689_100669986 | Ga0070689_1006699861 | 216 |
| 231 | 3300005347 | Ga0070668_100024428 | Ga0070668_1000244283 | 216 |
| 232 | 3300005364 | Ga0070673_100051987 | Ga0070673_1000519872 | 216 |
| 233 | 3300005367 | Ga0070667_100237462 | Ga0070667_1002374622 | 216 |
| 234 | 3300005455 | Ga0070663_100123186 | Ga0070663_1001231861 | 216 |
| 235 | 3300005457 | Ga0070662_100084522 | Ga0070662_1000845222 | 216 |
| 236 | 3300005539 | Ga0068853_100400438 | Ga0068853_1004004382 | 216 |
| 237 | 3300005548 | Ga0070665_100089954 | Ga0070665_1000899543 | 216 |
| 238 | 3300005578 | Ga0068854_100193172 | Ga0068854_1001931721 | 216 |
| 239 | 3300005616 | Ga0068852_100147553 | Ga0068852_1001475531 | 216 |
| 240 | 3300005834 | Ga0068851_10006873 | Ga0068851_100068737 | 216 |
| 241 | 3300005841 | Ga0068863_100670217 | Ga0068863_1006702172 | 216 |
| 242 | 3300006881 | Ga0068865_100085048 | Ga0068865_1000850482 | 216 |
| 243 | 3300013306 | Ga0163162_10510112 | Ga0163162_105101121 | 216 |
| 244 | 3300025960 | Ga0207651_10026974 | Ga0207651_100269744 | 216 |
| 245 | 3300025986 | Ga0207658_10105780 | Ga0207658_101057803 | 216 |
| 246 | 3300026041 | Ga0207639_10419124 | Ga0207639_104191242 | 216 |
| 247 | 3300026067 | Ga0207678_10150957 | Ga0207678_101509572 | 216 |
| 248 | 3300026118 | Ga0207675_100143050 | Ga0207675_1001430504 | 216 |
| 249 | 3300026142 | Ga0207698_10115819 | Ga0207698_101158192 | 216 |
| 250 | 3300028379 | Ga0268266_10142775 | Ga0268266_101427752 | 216 |
| 251 | 3300032002 | Ga0307416_100301141 | Ga0307416_1003011412 | 216 |
| 252 | 3300005436 | Ga0070713_100214158 | Ga0070713_1002141584 | 217 |
| 253 | 3300006175 | Ga0070712_100255614 | Ga0070712_1002556141 | 217 |
| 254 | 3300025915 | Ga0207693_10363514 | Ga0207693_103635142 | 217 |
| 255 | 3300025928 | Ga0207700_10159423 | Ga0207700_101594233 | 217 |
| 256 | 3300009177 | Ga0105248_10860738 | Ga0105248_108607381 | 219 |
| 257 | 3300005329 | Ga0070683_100093131 | Ga0070683_1000931314 | 220 |
| 258 | 3300005339 | Ga0070660_100100830 | Ga0070660_1001008303 | 220 |
| 259 | 3300005344 | Ga0070661_100161304 | Ga0070661_1001613044 | 220 |
| 260 | 3300005345 | Ga0070692_10036823 | Ga0070692_100368231 | 220 |
| 261 | 3300005356 | Ga0070674_100401046 | Ga0070674_1004010461 | 220 |
| 262 | 3300005366 | Ga0070659_100165857 | Ga0070659_1001658572 | 220 |
| 263 | 3300005435 | Ga0070714_100738068 | Ga0070714_1007380681 | 220 |
| 264 | 3300005455 | Ga0070663_100008281 | Ga0070663_1000082812 | 220 |
| 265 | 3300005455 | Ga0070663_100238322 | Ga0070663_1002383221 | 220 |
| 266 | 3300005471 | Ga0070698_100589264 | Ga0070698_1005892641 | 220 |
| 267 | 3300005535 | Ga0070684_100081329 | Ga0070684_1000813294 | 220 |
| 268 | 3300005539 | Ga0068853_100178978 | Ga0068853_1001789782 | 220 |
| 269 | 3300005546 | Ga0070696_100064816 | Ga0070696_1000648163 | 220 |
| 270 | 3300005564 | Ga0070664_100067175 | Ga0070664_1000671753 | 220 |
| 271 | 3300005577 | Ga0068857_100028759 | Ga0068857_1000287594 | 220 |
| 272 | 3300005578 | Ga0068854_100021061 | Ga0068854_1000210615 | 220 |
| 273 | 3300005614 | Ga0068856_100185290 | Ga0068856_1001852902 | 220 |
| 274 | 3300005616 | Ga0068852_100150540 | Ga0068852_1001505402 | 220 |
| 275 | 3300005718 | Ga0068866_10000548 | Ga0068866_1000054817 | 220 |
| 276 | 3300005834 | Ga0068851_10078478 | Ga0068851_100784782 | 220 |
| 277 | 3300006881 | Ga0068865_100138120 | Ga0068865_1001381202 | 220 |
| 278 | 3300009093 | Ga0105240_10090143 | Ga0105240_100901434 | 220 |
| 279 | 3300009174 | Ga0105241_10004491 | Ga0105241_1000449110 | 220 |
| 280 | 3300009174 | Ga0105241_10024851 | Ga0105241_100248515 | 220 |
| 281 | 3300009545 | Ga0105237_10304412 | Ga0105237_103044123 | 220 |
| 282 | 3300009551 | Ga0105238_10198644 | Ga0105238_101986442 | 220 |
| 283 | 3300010375 | Ga0105239_10073547 | Ga0105239_100735474 | 220 |
| 284 | 3300013100 | Ga0157373_10024332 | Ga0157373_100243324 | 220 |
| 285 | 3300013100 | Ga0157373_10370840 | Ga0157373_103708401 | 220 |
| 286 | 3300013102 | Ga0157371_10253857 | Ga0157371_102538572 | 220 |
| 287 | 3300013104 | Ga0157370_10279217 | Ga0157370_102792171 | 220 |
| 288 | 3300013105 | Ga0157369_10201144 | Ga0157369_102011442 | 220 |
| 289 | 3300013306 | Ga0163162_10169699 | Ga0163162_101696992 | 220 |
| 290 | 3300014497 | Ga0182008_10082404 | Ga0182008_100824042 | 220 |
| 291 | 3300020069 | Ga0197907_10357466 | Ga0197907_103574661 | 220 |
| 292 | 3300020070 | Ga0206356_10470992 | Ga0206356_104709922 | 220 |
| 293 | 3300020080 | Ga0206350_10016023 | Ga0206350_100160231 | 220 |
| 294 | 3300020081 | Ga0206354_10100971 | Ga0206354_101009711 | 220 |
| 295 | 3300020610 | Ga0154015_1377351 | Ga0154015_13773513 | 220 |
| 296 | 3300020610 | Ga0154015_1531000 | Ga0154015_15310001 | 220 |
| 297 | 3300025321 | Ga0207656_10025393 | Ga0207656_100253933 | 220 |
| 298 | 3300025899 | Ga0207642_10029855 | Ga0207642_100298551 | 220 |
| 299 | 3300025909 | Ga0207705_10085213 | Ga0207705_100852134 | 220 |
| 300 | 3300025912 | Ga0207707_10033435 | Ga0207707_100334355 | 220 |
| 301 | 3300025913 | Ga0207695_10066294 | Ga0207695_100662944 | 220 |
| 302 | 3300025914 | Ga0207671_10283072 | Ga0207671_102830723 | 220 |
| 303 | 3300025919 | Ga0207657_10000240 | Ga0207657_1000024052 | 220 |
| 304 | 3300025920 | Ga0207649_10069389 | Ga0207649_100693891 | 220 |
| 305 | 3300025921 | Ga0207652_10008752 | Ga0207652_100087527 | 220 |
| 306 | 3300025924 | Ga0207694_10373780 | Ga0207694_103737802 | 220 |
| 307 | 3300025929 | Ga0207664_10508323 | Ga0207664_105083232 | 220 |
| 308 | 3300025932 | Ga0207690_10042995 | Ga0207690_100429952 | 220 |
| 309 | 3300025934 | Ga0207686_10058449 | Ga0207686_100584493 | 220 |
| 310 | 3300025937 | Ga0207669_10125310 | Ga0207669_101253102 | 220 |
| 311 | 3300025942 | Ga0207689_10237980 | Ga0207689_102379802 | 220 |
| 312 | 3300025945 | Ga0207679_10184331 | Ga0207679_101843312 | 220 |
| 313 | 3300025981 | Ga0207640_10023654 | Ga0207640_100236544 | 220 |
| 314 | 3300025981 | Ga0207640_10035643 | Ga0207640_100356434 | 220 |
| 315 | 3300026023 | Ga0207677_10413495 | Ga0207677_104134951 | 220 |
| 316 | 3300026041 | Ga0207639_10047455 | Ga0207639_100474554 | 220 |
| 317 | 3300026067 | Ga0207678_10153548 | Ga0207678_101535482 | 220 |
| 318 | 3300026067 | Ga0207678_10272028 | Ga0207678_102720281 | 220 |
| 319 | 3300026078 | Ga0207702_10028889 | Ga0207702_100288895 | 220 |
| 320 | 3300026089 | Ga0207648_10428040 | Ga0207648_104280402 | 220 |
| 321 | 3300026116 | Ga0207674_10000237 | Ga0207674_1000023732 | 220 |
| 322 | 3300026142 | Ga0207698_10012505 | Ga0207698_100125056 | 220 |
| 323 | 3300026142 | Ga0207698_10086819 | Ga0207698_100868192 | 220 |
| 324 | 3300028381 | Ga0268264_10395140 | Ga0268264_103951402 | 220 |
| 325 | 3300038443 | Ga0395901_0324675 | Ga0395901_0324675_485_1237 | 220 |
| 326 | 3300049570 | Ga0501033_0171338 | Ga0501033_0171338_172_882 | 220 |
| 327 | 3300049574 | Ga0501038_0445391 | Ga0501038_0445391_111_821 | 220 |
| 328 | 3300049822 | Ga0501035_0006955 | Ga0501035_0006955_858_1568 | 220 |
| 329 | 3300049823 | Ga0501044_0001056 | Ga0501044_0001056_31545_32255 | 220 |
| 330 | 3300059478 | Ga0587093_025330 | Ga0587093_025330_19_726 | 220 |
| 331 | 3300059510 | Ga0587090_040772 | Ga0587090_040772_11_763 | 220 |
| 332 | 3300059625 | Ga0587113_010239 | Ga0587113_010239_57_809 | 220 |
| 333 | 3300059626 | Ga0587115_014942 | Ga0587115_014942_250_1002 | 220 |
| 334 | 3300059630 | Ga0587128_026143 | Ga0587128_026143_129_881 | 220 |
| 335 | 3300059641 | Ga0587068_031069 | Ga0587068_031069_121_873 | 220 |
| 336 | 3300059644 | Ga0587075_017360 | Ga0587075_017360_214_966 | 220 |
| 337 | 3300059646 | Ga0587078_016403 | Ga0587078_016403_97_804 | 220 |
| 338 | 3300025909 | Ga0207705_10551014 | Ga0207705_105510141 | 221 |
| 339 | 3300005328 | Ga0070676_10290665 | Ga0070676_102906652 | 222 |
| 340 | 3300005459 | Ga0068867_100026811 | Ga0068867_1000268114 | 222 |
| 341 | 3300031824 | Ga0307413_10174906 | Ga0307413_101749061 | 222 |
| 342 | 3300031852 | Ga0307410_10191898 | Ga0307410_101918982 | 222 |
| 343 | 3300031911 | Ga0307412_10222448 | Ga0307412_102224482 | 222 |
| 344 | 3300031995 | Ga0307409_100029964 | Ga0307409_1000299642 | 222 |
| 345 | 3300032004 | Ga0307414_10130847 | Ga0307414_101308471 | 222 |
| 346 | 3300032005 | Ga0307411_10006056 | Ga0307411_100060562 | 222 |
| 347 | 3300005339 | Ga0070660_100014044 | Ga0070660_1000140447 | 223 |
| 348 | 3300005344 | Ga0070661_100219051 | Ga0070661_1002190513 | 223 |
| 349 | 3300005366 | Ga0070659_100124663 | Ga0070659_1001246633 | 223 |
| 350 | 3300005435 | Ga0070714_100009134 | Ga0070714_1000091343 | 223 |
| 351 | 3300005458 | Ga0070681_10008601 | Ga0070681_1000860110 | 223 |
| 352 | 3300005530 | Ga0070679_100011162 | Ga0070679_10001116211 | 223 |
| 353 | 3300005535 | Ga0070684_100042537 | Ga0070684_1000425372 | 223 |
| 354 | 3300005539 | Ga0068853_100046600 | Ga0068853_1000466003 | 223 |
| 355 | 3300005563 | Ga0068855_100001119 | Ga0068855_10000111925 | 223 |
| 356 | 3300005564 | Ga0070664_100000934 | Ga0070664_10000093415 | 223 |
| 357 | 3300005577 | Ga0068857_100002116 | Ga0068857_10000211620 | 223 |
| 358 | 3300005578 | Ga0068854_100003623 | Ga0068854_1000036239 | 223 |
| 359 | 3300005614 | Ga0068856_100006845 | Ga0068856_10000684512 | 223 |
| 360 | 3300005616 | Ga0068852_100000768 | Ga0068852_1000007688 | 223 |
| 361 | 3300009093 | Ga0105240_10000332 | Ga0105240_1000033278 | 223 |
| 362 | 3300009174 | Ga0105241_10044096 | Ga0105241_100440963 | 223 |
| 363 | 3300009551 | Ga0105238_10000244 | Ga0105238_1000024424 | 223 |
| 364 | 3300013100 | Ga0157373_10051274 | Ga0157373_100512743 | 223 |
| 365 | 3300013102 | Ga0157371_10023665 | Ga0157371_100236653 | 223 |
| 366 | 3300013105 | Ga0157369_10787895 | Ga0157369_107878951 | 223 |
| 367 | 3300013296 | Ga0157374_10215666 | Ga0157374_102156662 | 223 |
| 368 | 3300013307 | Ga0157372_10002879 | Ga0157372_1000287910 | 223 |
| 369 | 3300022467 | Ga0224712_10100485 | Ga0224712_101004852 | 223 |
| 370 | 3300025909 | Ga0207705_10083383 | Ga0207705_100833832 | 223 |
| 371 | 3300025911 | Ga0207654_10238568 | Ga0207654_102385681 | 223 |
| 372 | 3300025913 | Ga0207695_10111471 | Ga0207695_101114712 | 223 |
| 373 | 3300025920 | Ga0207649_10042056 | Ga0207649_100420563 | 223 |
| 374 | 3300025921 | Ga0207652_10050689 | Ga0207652_100506892 | 223 |
| 375 | 3300025924 | Ga0207694_10171593 | Ga0207694_101715932 | 223 |
| 376 | 3300025929 | Ga0207664_10134989 | Ga0207664_101349892 | 223 |
| 377 | 3300025932 | Ga0207690_10352325 | Ga0207690_103523252 | 223 |
| 378 | 3300025944 | Ga0207661_10145483 | Ga0207661_101454833 | 223 |
| 379 | 3300025945 | Ga0207679_10151487 | Ga0207679_101514872 | 223 |
| 380 | 3300025949 | Ga0207667_10071924 | Ga0207667_100719242 | 223 |
| 381 | 3300025981 | Ga0207640_10056033 | Ga0207640_100560333 | 223 |
| 382 | 3300026041 | Ga0207639_10214358 | Ga0207639_102143582 | 223 |
| 383 | 3300026078 | Ga0207702_10016093 | Ga0207702_100160939 | 223 |
| 384 | 3300026116 | Ga0207674_10006274 | Ga0207674_1000627417 | 223 |
| 385 | 3300026142 | Ga0207698_10147089 | Ga0207698_101470893 | 223 |
| 386 | 3300046533 | Ga0495640_0211486 | Ga0495640_0211486_110_850 | 223 |
| 387 | 3300005331 | Ga0070670_100155446 | Ga0070670_1001554464 | 224 |
| 388 | 3300005335 | Ga0070666_10009140 | Ga0070666_100091402 | 224 |
| 389 | 3300005338 | Ga0068868_100173623 | Ga0068868_1001736232 | 224 |
| 390 | 3300005347 | Ga0070668_100009765 | Ga0070668_1000097652 | 224 |
| 391 | 3300005347 | Ga0070668_100092604 | Ga0070668_1000926042 | 224 |
| 392 | 3300005354 | Ga0070675_100013624 | Ga0070675_1000136246 | 224 |
| 393 | 3300005355 | Ga0070671_100052646 | Ga0070671_1000526464 | 224 |
| 394 | 3300005355 | Ga0070671_100297517 | Ga0070671_1002975172 | 224 |
| 395 | 3300005356 | Ga0070674_100086827 | Ga0070674_1000868272 | 224 |
| 396 | 3300005364 | Ga0070673_100043334 | Ga0070673_1000433343 | 224 |
| 397 | 3300005367 | Ga0070667_100267578 | Ga0070667_1002675782 | 224 |
| 398 | 3300005456 | Ga0070678_100007823 | Ga0070678_1000078234 | 224 |
| 399 | 3300005457 | Ga0070662_100316928 | Ga0070662_1003169282 | 224 |
| 400 | 3300005466 | Ga0070685_10225443 | Ga0070685_102254431 | 224 |
| 401 | 3300005543 | Ga0070672_100000308 | Ga0070672_1000003087 | 224 |
| 402 | 3300005543 | Ga0070672_100039503 | Ga0070672_1000395031 | 224 |
| 403 | 3300005548 | Ga0070665_100007532 | Ga0070665_1000075326 | 224 |
| 404 | 3300005618 | Ga0068864_100063009 | Ga0068864_1000630095 | 224 |
| 405 | 3300005719 | Ga0068861_100207468 | Ga0068861_1002074682 | 224 |
| 406 | 3300005843 | Ga0068860_100399763 | Ga0068860_1003997632 | 224 |
| 407 | 3300005844 | Ga0068862_100029944 | Ga0068862_1000299444 | 224 |
| 408 | 3300006237 | Ga0097621_100072662 | Ga0097621_1000726622 | 224 |
| 409 | 3300009177 | Ga0105248_10354239 | Ga0105248_103542392 | 224 |
| 410 | 3300013296 | Ga0157374_10807317 | Ga0157374_108073171 | 224 |
| 411 | 3300013297 | Ga0157378_10005893 | Ga0157378_1000589313 | 224 |
| 412 | 3300013297 | Ga0157378_10137993 | Ga0157378_101379932 | 224 |
| 413 | 3300013306 | Ga0163162_10343862 | Ga0163162_103438622 | 224 |
| 414 | 3300013308 | Ga0157375_10035555 | Ga0157375_100355553 | 224 |
| 415 | 3300013308 | Ga0157375_10068797 | Ga0157375_100687973 | 224 |
| 416 | 3300014325 | Ga0163163_10349037 | Ga0163163_103490373 | 224 |
| 417 | 3300014969 | Ga0157376_10005464 | Ga0157376_100054642 | 224 |
| 418 | 3300017792 | Ga0163161_10038381 | Ga0163161_100383813 | 224 |
| 419 | 3300025901 | Ga0207688_10180618 | Ga0207688_101806181 | 224 |
| 420 | 3300025903 | Ga0207680_10014384 | Ga0207680_100143842 | 224 |
| 421 | 3300025923 | Ga0207681_10024021 | Ga0207681_100240216 | 224 |
| 422 | 3300025926 | Ga0207659_10019552 | Ga0207659_100195524 | 224 |
| 423 | 3300025931 | Ga0207644_10014416 | Ga0207644_100144165 | 224 |
| 424 | 3300025931 | Ga0207644_10103945 | Ga0207644_101039452 | 224 |
| 425 | 3300025933 | Ga0207706_10053246 | Ga0207706_100532461 | 224 |
| 426 | 3300025937 | Ga0207669_10158948 | Ga0207669_101589482 | 224 |
| 427 | 3300025940 | Ga0207691_10000403 | Ga0207691_1000040324 | 224 |
| 428 | 3300025940 | Ga0207691_10004470 | Ga0207691_1000447015 | 224 |
| 429 | 3300025941 | Ga0207711_10557049 | Ga0207711_105570491 | 224 |
| 430 | 3300025960 | Ga0207651_10029467 | Ga0207651_100294673 | 224 |
| 431 | 3300025972 | Ga0207668_10111456 | Ga0207668_101114562 | 224 |
| 432 | 3300025972 | Ga0207668_10182993 | Ga0207668_101829931 | 224 |
| 433 | 3300026023 | Ga0207677_10106146 | Ga0207677_101061462 | 224 |
| 434 | 3300026095 | Ga0207676_10047895 | Ga0207676_100478955 | 224 |
| 435 | 3300026118 | Ga0207675_100032081 | Ga0207675_1000320814 | 224 |
| 436 | 3300026121 | Ga0207683_10005374 | Ga0207683_100053747 | 224 |
| 437 | 3300028379 | Ga0268266_10049569 | Ga0268266_100495695 | 224 |
| 438 | 3300028380 | Ga0268265_10038952 | Ga0268265_100389522 | 224 |
| 439 | 3300005543 | Ga0070672_100023780 | Ga0070672_1000237801 | 225 |
| 440 | 3300005618 | Ga0068864_100649693 | Ga0068864_1006496931 | 225 |
| 441 | 3300005842 | Ga0068858_100032194 | Ga0068858_1000321943 | 225 |
| 442 | 3300005843 | Ga0068860_100353651 | Ga0068860_1003536512 | 225 |
| 443 | 3300013306 | Ga0163162_10061410 | Ga0163162_100614101 | 225 |
| 444 | 3300014968 | Ga0157379_10136790 | Ga0157379_101367902 | 225 |
| 445 | 3300025900 | Ga0207710_10272210 | Ga0207710_102722101 | 225 |
| 446 | 3300025941 | Ga0207711_10415327 | Ga0207711_104153272 | 225 |
| 447 | 3300025986 | Ga0207658_10017552 | Ga0207658_100175526 | 225 |
| 448 | 3300026089 | Ga0207648_10105331 | Ga0207648_101053311 | 225 |
| 449 | 3300026095 | Ga0207676_10410373 | Ga0207676_104103732 | 225 |
| 450 | 3300028381 | Ga0268264_10351872 | Ga0268264_103518722 | 225 |
| 451 | 3300031238 | Ga0265332_10002744 | Ga0265332_100027448 | 225 |
| 452 | 3300031241 | Ga0265325_10034431 | Ga0265325_100344313 | 225 |
| 453 | 3300031242 | Ga0265329_10022400 | Ga0265329_100224002 | 225 |
| 454 | 3300031250 | Ga0265331_10016184 | Ga0265331_100161844 | 225 |
| 455 | 3300031251 | Ga0265327_10015235 | Ga0265327_100152351 | 225 |
| 456 | 3300031344 | Ga0265316_10297821 | Ga0265316_102978211 | 225 |
| 457 | 3300035084 | Ga0373928_0022491 | Ga0373928_0022491_99_824 | 225 |
| 458 | 3300035691 | Ga0373931_0044303 | Ga0373931_0044303_1338_2063 | 225 |
| 459 | 3300048904 | Ga0496101_0462870 | Ga0496101_0462870_54_779 | 225 |
| 460 | 3300048912 | Ga0496109_0408504 | Ga0496109_0408504_441_1166 | 225 |
| 461 | 3300048915 | Ga0496112_0026219 | Ga0496112_0026219_2667_3392 | 225 |
| 462 | 3300005353 | Ga0070669_100130606 | Ga0070669_1001306062 | 227 |
| 463 | 3300005354 | Ga0070675_100030634 | Ga0070675_1000306345 | 227 |
| 464 | 3300005439 | Ga0070711_100239915 | Ga0070711_1002399153 | 227 |
| 465 | 3300005457 | Ga0070662_100788667 | Ga0070662_1007886671 | 227 |
| 466 | 3300005617 | Ga0068859_100302767 | Ga0068859_1003027671 | 227 |
| 467 | 3300005618 | Ga0068864_100000740 | Ga0068864_1000007405 | 227 |
| 468 | 3300005841 | Ga0068863_100050940 | Ga0068863_1000509405 | 227 |
| 469 | 3300006237 | Ga0097621_100456682 | Ga0097621_1004566822 | 227 |
| 470 | 3300006931 | Ga0097620_100302747 | Ga0097620_1003027472 | 227 |
| 471 | 3300014325 | Ga0163163_10043746 | Ga0163163_100437466 | 227 |
| 472 | 3300025903 | Ga0207680_10368882 | Ga0207680_103688822 | 227 |
| 473 | 3300025908 | Ga0207643_10190550 | Ga0207643_101905502 | 227 |
| 474 | 3300025925 | Ga0207650_10021783 | Ga0207650_100217834 | 227 |
| 475 | 3300025926 | Ga0207659_10089151 | Ga0207659_100891513 | 227 |
| 476 | 3300025940 | Ga0207691_10005992 | Ga0207691_100059924 | 227 |
| 477 | 3300025972 | Ga0207668_10097017 | Ga0207668_100970172 | 227 |
| 478 | 3300026095 | Ga0207676_10078201 | Ga0207676_100782012 | 227 |
| 479 | 3300028379 | Ga0268266_10277195 | Ga0268266_102771952 | 227 |
| 480 | 3300035170 | Ga0373943_0033714 | Ga0373943_0033714_868_1611 | 231 |
| 481 | 3300035171 | Ga0373946_0114061 | Ga0373946_0114061_336_1109 | 231 |
| 482 | 3300035695 | Ga0373927_0080462 | Ga0373927_0080462_894_1640 | 231 |
| 483 | 3300037068 | Ga0373925_0059311 | Ga0373925_0059311_406_1152 | 231 |
| 484 | 3300037068 | Ga0373925_0112638 | Ga0373925_0112638_1267_2010 | 231 |
| 485 | 3300046459 | Ga0495629_0106737 | Ga0495629_0106737_476_1222 | 231 |
| 486 | 3300046472 | Ga0495580_0119055 | Ga0495580_0119055_994_1740 | 231 |
| 487 | 3300046475 | Ga0495639_0053629 | Ga0495639_0053629_861_1607 | 231 |
| 488 | 3300046476 | Ga0495662_0056805 | Ga0495662_0056805_1021_1767 | 231 |
| 489 | 3300046517 | Ga0495630_0083896 | Ga0495630_0083896_774_1520 | 231 |
| 490 | 3300046531 | Ga0495665_0010339 | Ga0495665_0010339_1022_1768 | 231 |
| 491 | 3300046543 | Ga0495645_0088355 | Ga0495645_0088355_609_1355 | 231 |
| 492 | 3300046663 | Ga0495635_0043202 | Ga0495635_0043202_1403_2149 | 231 |
| 493 | 3300046689 | Ga0495613_0024468 | Ga0495613_0024468_3085_3831 | 231 |
| 494 | 3300047319 | Ga0495674_0491516 | Ga0495674_0491516_226_972 | 231 |
| 495 | 3300047322 | Ga0495680_0037414 | Ga0495680_0037414_1179_1925 | 231 |
| 496 | 3300048089 | Ga0495614_0012737 | Ga0495614_0012737_938_1684 | 231 |
| 497 | 3300053078 | Ga0495612_0017904 | Ga0495612_0017904_460_1203 | 231 |
| 498 | 3300053085 | Ga0495619_0005152 | Ga0495619_0005152_5876_6622 | 231 |
| 499 | 3300002074 | JGI24748J21848_1012936 | JGI24748J21848_10129361 | 232 |
| 500 | 3300005329 | Ga0070683_100081264 | Ga0070683_1000812642 | 232 |
| 501 | 3300005330 | Ga0070690_100024054 | Ga0070690_1000240543 | 232 |
| 502 | 3300005331 | Ga0070670_100031567 | Ga0070670_1000315672 | 232 |
| 503 | 3300005334 | Ga0068869_100087312 | Ga0068869_1000873122 | 232 |
| 504 | 3300005335 | Ga0070666_10001239 | Ga0070666_1000123916 | 232 |
| 505 | 3300005336 | Ga0070680_100046206 | Ga0070680_1000462063 | 232 |
| 506 | 3300005337 | Ga0070682_100069975 | Ga0070682_1000699753 | 232 |
| 507 | 3300005338 | Ga0068868_100001857 | Ga0068868_1000018579 | 232 |
| 508 | 3300005339 | Ga0070660_100164259 | Ga0070660_1001642591 | 232 |
| 509 | 3300005340 | Ga0070689_100003142 | Ga0070689_1000031424 | 232 |
| 510 | 3300005344 | Ga0070661_100085770 | Ga0070661_1000857701 | 232 |
| 511 | 3300005345 | Ga0070692_10390545 | Ga0070692_103905451 | 232 |
| 512 | 3300005354 | Ga0070675_100261794 | Ga0070675_1002617942 | 232 |
| 513 | 3300005355 | Ga0070671_100013348 | Ga0070671_1000133488 | 232 |
| 514 | 3300005364 | Ga0070673_100005623 | Ga0070673_1000056235 | 232 |
| 515 | 3300005365 | Ga0070688_100000458 | Ga0070688_1000004589 | 232 |
| 516 | 3300005366 | Ga0070659_100147820 | Ga0070659_1001478201 | 232 |
| 517 | 3300005436 | Ga0070713_100002402 | Ga0070713_1000024029 | 232 |
| 518 | 3300005438 | Ga0070701_10012622 | Ga0070701_100126221 | 232 |
| 519 | 3300005439 | Ga0070711_100003780 | Ga0070711_1000037805 | 232 |
| 520 | 3300005444 | Ga0070694_100037166 | Ga0070694_1000371663 | 232 |
| 521 | 3300005445 | Ga0070708_100054327 | Ga0070708_1000543274 | 232 |
| 522 | 3300005458 | Ga0070681_10217907 | Ga0070681_102179073 | 232 |
| 523 | 3300005466 | Ga0070685_10008324 | Ga0070685_100083242 | 232 |
| 524 | 3300005468 | Ga0070707_100071004 | Ga0070707_1000710042 | 232 |
| 525 | 3300005518 | Ga0070699_100046715 | Ga0070699_1000467155 | 232 |
| 526 | 3300005530 | Ga0070679_100046471 | Ga0070679_1000464712 | 232 |
| 527 | 3300005536 | Ga0070697_100013500 | Ga0070697_1000135007 | 232 |
| 528 | 3300005539 | Ga0068853_100222230 | Ga0068853_1002222303 | 232 |
| 529 | 3300005544 | Ga0070686_100040050 | Ga0070686_1000400504 | 232 |
| 530 | 3300005547 | Ga0070693_100024807 | Ga0070693_1000248074 | 232 |
| 531 | 3300005548 | Ga0070665_100001524 | Ga0070665_1000015244 | 232 |
| 532 | 3300005578 | Ga0068854_100029133 | Ga0068854_1000291334 | 232 |
| 533 | 3300005614 | Ga0068856_100013862 | Ga0068856_1000138626 | 232 |
| 534 | 3300005617 | Ga0068859_100002028 | Ga0068859_10000202822 | 232 |
| 535 | 3300005618 | Ga0068864_100000455 | Ga0068864_10000045513 | 232 |
| 536 | 3300005719 | Ga0068861_100489192 | Ga0068861_1004891921 | 232 |
| 537 | 3300005841 | Ga0068863_100009317 | Ga0068863_1000093177 | 232 |
| 538 | 3300005842 | Ga0068858_100000850 | Ga0068858_1000008503 | 232 |
| 539 | 3300006173 | Ga0070716_100011269 | Ga0070716_1000112692 | 232 |
| 540 | 3300006175 | Ga0070712_100004102 | Ga0070712_1000041027 | 232 |
| 541 | 3300006871 | Ga0075434_100110026 | Ga0075434_1001100262 | 232 |
| 542 | 3300006931 | Ga0097620_100002027 | Ga0097620_10000202722 | 232 |
| 543 | 3300007076 | Ga0075435_100043986 | Ga0075435_1000439862 | 232 |
| 544 | 3300009093 | Ga0105240_10090010 | Ga0105240_100900102 | 232 |
| 545 | 3300009098 | Ga0105245_10013288 | Ga0105245_100132885 | 232 |
| 546 | 3300009098 | Ga0105245_10189531 | Ga0105245_101895312 | 232 |
| 547 | 3300009101 | Ga0105247_10029095 | Ga0105247_100290955 | 232 |
| 548 | 3300009177 | Ga0105248_10032092 | Ga0105248_100320926 | 232 |
| 549 | 3300009545 | Ga0105237_10028957 | Ga0105237_100289572 | 232 |
| 550 | 3300010375 | Ga0105239_10092064 | Ga0105239_100920642 | 232 |
| 551 | 3300011119 | Ga0105246_10051342 | Ga0105246_100513423 | 232 |
| 552 | 3300011119 | Ga0105246_10395288 | Ga0105246_103952882 | 232 |
| 553 | 3300013100 | Ga0157373_10019865 | Ga0157373_100198651 | 232 |
| 554 | 3300013104 | Ga0157370_10553279 | Ga0157370_105532791 | 232 |
| 555 | 3300013296 | Ga0157374_10003271 | Ga0157374_100032714 | 232 |
| 556 | 3300013297 | Ga0157378_10064824 | Ga0157378_100648242 | 232 |
| 557 | 3300013306 | Ga0163162_10020054 | Ga0163162_100200546 | 232 |
| 558 | 3300013308 | Ga0157375_10011902 | Ga0157375_100119029 | 232 |
| 559 | 3300014325 | Ga0163163_10000310 | Ga0163163_1000031050 | 232 |
| 560 | 3300014745 | Ga0157377_10126571 | Ga0157377_101265712 | 232 |
| 561 | 3300014968 | Ga0157379_10000626 | Ga0157379_100006266 | 232 |
| 562 | 3300025903 | Ga0207680_10004784 | Ga0207680_100047848 | 232 |
| 563 | 3300025908 | Ga0207643_10238416 | Ga0207643_102384162 | 232 |
| 564 | 3300025911 | Ga0207654_10129434 | Ga0207654_101294341 | 232 |
| 565 | 3300025912 | Ga0207707_10013250 | Ga0207707_100132503 | 232 |
| 566 | 3300025913 | Ga0207695_10220565 | Ga0207695_102205652 | 232 |
| 567 | 3300025915 | Ga0207693_10000485 | Ga0207693_100004856 | 232 |
| 568 | 3300025915 | Ga0207693_10055636 | Ga0207693_100556362 | 232 |
| 569 | 3300025916 | Ga0207663_10041522 | Ga0207663_100415223 | 232 |
| 570 | 3300025917 | Ga0207660_10114229 | Ga0207660_101142292 | 232 |
| 571 | 3300025918 | Ga0207662_10054613 | Ga0207662_100546132 | 232 |
| 572 | 3300025919 | Ga0207657_10002577 | Ga0207657_1000257711 | 232 |
| 573 | 3300025925 | Ga0207650_10020951 | Ga0207650_100209516 | 232 |
| 574 | 3300025927 | Ga0207687_10001442 | Ga0207687_1000144216 | 232 |
| 575 | 3300025927 | Ga0207687_10042059 | Ga0207687_100420593 | 232 |
| 576 | 3300025928 | Ga0207700_10010411 | Ga0207700_100104112 | 232 |
| 577 | 3300025928 | Ga0207700_10036619 | Ga0207700_100366191 | 232 |
| 578 | 3300025929 | Ga0207664_10015854 | Ga0207664_100158544 | 232 |
| 579 | 3300025931 | Ga0207644_10010849 | Ga0207644_100108495 | 232 |
| 580 | 3300025932 | Ga0207690_10166598 | Ga0207690_101665983 | 232 |
| 581 | 3300025939 | Ga0207665_10052801 | Ga0207665_100528014 | 232 |
| 582 | 3300025941 | Ga0207711_10000115 | Ga0207711_1000011555 | 232 |
| 583 | 3300025942 | Ga0207689_10013293 | Ga0207689_100132939 | 232 |
| 584 | 3300025949 | Ga0207667_10106771 | Ga0207667_101067711 | 232 |
| 585 | 3300025960 | Ga0207651_10000427 | Ga0207651_1000042713 | 232 |
| 586 | 3300025981 | Ga0207640_10009888 | Ga0207640_100098882 | 232 |
| 587 | 3300025986 | Ga0207658_10027345 | Ga0207658_100273452 | 232 |
| 588 | 3300026023 | Ga0207677_10000210 | Ga0207677_1000021022 | 232 |
| 589 | 3300026035 | Ga0207703_10000438 | Ga0207703_100004386 | 232 |
| 590 | 3300026041 | Ga0207639_10120046 | Ga0207639_101200462 | 232 |
| 591 | 3300026078 | Ga0207702_10056716 | Ga0207702_100567165 | 232 |
| 592 | 3300026078 | Ga0207702_10461156 | Ga0207702_104611562 | 232 |
| 593 | 3300026088 | Ga0207641_10001573 | Ga0207641_1000157318 | 232 |
| 594 | 3300026095 | Ga0207676_10000415 | Ga0207676_1000041529 | 232 |
| 595 | 3300026116 | Ga0207674_10050952 | Ga0207674_100509523 | 232 |
| 596 | 3300026118 | Ga0207675_100272663 | Ga0207675_1002726632 | 232 |
| 597 | 3300028379 | Ga0268266_10008005 | Ga0268266_100080055 | 232 |
| 598 | 3300028381 | Ga0268264_10001696 | Ga0268264_1000169615 | 232 |
| 599 | 3300035086 | Ga0373934_0021469 | Ga0373934_0021469_184_924 | 232 |
| 600 | 3300035113 | Ga0373936_0145769 | Ga0373936_0145769_175_915 | 232 |
| 601 | 3300035117 | Ga0373953_0097056 | Ga0373953_0097056_427_1167 | 232 |
| 602 | 3300035118 | Ga0373954_0003066 | Ga0373954_0003066_3597_4337 | 232 |
| 603 | 3300035119 | Ga0373956_0134589 | Ga0373956_0134589_36_776 | 232 |
| 604 | 3300035120 | Ga0373957_0003850 | Ga0373957_0003850_3260_4000 | 232 |
| 605 | 3300035172 | Ga0373955_0003010 | Ga0373955_0003010_5081_5821 | 232 |
| 606 | 3300035410 | Ga0373924_0006705 | Ga0373924_0006705_1908_2648 | 232 |
| 607 | 3300035724 | Ga0373933_0015824 | Ga0373933_0015824_478_1218 | 232 |
| 608 | 3300035724 | Ga0373933_0026781 | Ga0373933_0026781_1461_2201 | 232 |
| 609 | 3300035725 | Ga0373947_0032374 | Ga0373947_0032374_922_1662 | 232 |
| 610 | 3300036401 | Ga0373937_0009175 | Ga0373937_0009175_3046_3786 | 232 |
| 611 | 3300036401 | Ga0373937_0024904 | Ga0373937_0024904_1254_1994 | 232 |
| 612 | 3300046462 | Ga0495651_0360249 | Ga0495651_0360249_84_824 | 232 |
| 613 | 3300046499 | Ga0495594_0097429 | Ga0495594_0097429_701_1447 | 232 |
| 614 | 3300046679 | Ga0495623_0059055 | Ga0495623_0059055_965_1705 | 232 |
| 615 | 3300047444 | Ga0495675_0079181 | Ga0495675_0079181_604_1344 | 232 |
| 616 | 3300047471 | Ga0495684_0039104 | Ga0495684_0039104_176_922 | 232 |
| 617 | 3300048088 | Ga0495602_0219067 | Ga0495602_0219067_67_807 | 232 |
| 618 | 3300048903 | Ga0496100_0064502 | Ga0496100_0064502_372_1112 | 232 |
| 619 | 3300048904 | Ga0496101_0010694 | Ga0496101_0010694_3153_3893 | 232 |
| 620 | 3300048907 | Ga0496104_0023522 | Ga0496104_0023522_4873_5613 | 232 |
| 621 | 3300048908 | Ga0496105_0019861 | Ga0496105_0019861_4641_5381 | 232 |
| 622 | 3300048909 | Ga0496106_0101829 | Ga0496106_0101829_434_1180 | 232 |
| 623 | 3300048912 | Ga0496109_0020289 | Ga0496109_0020289_458_1198 | 232 |
| 624 | 3300048913 | Ga0496110_0137917 | Ga0496110_0137917_222_962 | 232 |
| 625 | 3300048915 | Ga0496112_0002173 | Ga0496112_0002173_2539_3279 | 232 |
| 626 | 3300048915 | Ga0496112_0154404 | Ga0496112_0154404_22_768 | 232 |
| 627 | 3300048917 | Ga0496114_0028308 | Ga0496114_0028308_3243_3983 | 232 |
| 628 | 3300050513 | nmdc:mga0rr50_88706_c1 | nmdc:mga0rr50_88706_c1_343_1083 | 232 |
| 629 | 3300050514 | nmdc:mga08x19_49289_c1 | nmdc:mga08x19_49289_c1_1007_1756 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar