F470732

General Info

Members Datasets Scaffolds Average Seq Length
629 280 623 233

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10304412|Ga0105237_103044123
Length 250
Sequence MLDVHPGPLALFGGFMEPRSQTVFNHGTAPAVGVAESQNRVLRNTYWLLSLSMLPTVAGAWAGMQLNFLSLFAASPVMAPLLMFGVMIGALFGVTALRNSAWGVPALFGFTFIAGLMLAPILSVALGFRNGGQLIGLAGGMTAVIFFAMAGIATVTKRDFSFMGKFLFIGLVLLIVASLANIFLQIPALSVTVSAIAVLLFSAYLLHDVSRIVRGGETNYITATLSLFLDVYNIFISLLNILLMFSGQRD

Samples

Sample ID Description Type Environment
1 2643221664 Massilia sp. Root418 Isolate Unclassified
2 2738541280 Massilia sp. GV090 Isolate Unclassified
3 2738541300 Massilia sp. GV016 Isolate Unclassified
4 2738543018 Massilia sp. GV045 Isolate Unclassified
5 2738543030 Massilia sp. GV097 Isolate Unclassified
6 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
273 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 2.54
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1012936 3300002074 Bacteria 986
2 Ga0070658_10622671 3300005327 Bacteria 936
3 Ga0070676_10000975 3300005328 Bacteria 14221
4 Ga0070676_10290665 3300005328 Bacteria 1104
5 Ga0070676_10341499 3300005328 Bacteria 1027
6 Ga0070676_10362219 3300005328 Bacteria 999
7 Ga0070683_100081264 3300005329 Bacteria 3034
8 Ga0070683_100093131 3300005329 Bacteria 2830
9 Ga0070683_100171932 3300005329 Bacteria 2057
10 Ga0070690_100024054 3300005330 Bacteria 3743
11 Ga0070670_100030196 3300005331 Bacteria 4667
12 Ga0070670_100031567 3300005331 Bacteria 4563
13 Ga0070670_100034350 3300005331 Bacteria 4363
14 Ga0070670_100118242 3300005331 Bacteria 2286
15 Ga0070670_100155446 3300005331 Bacteria 1980
16 Ga0070670_100284706 3300005331 Bacteria 1443
17 Ga0070677_10000807 3300005333 Bacteria 10366
18 Ga0070677_10114922 3300005333 Bacteria 1207
19 Ga0068869_100072952 3300005334 Bacteria 2544
20 Ga0068869_100087312 3300005334 Bacteria 2339
21 Ga0068869_100100776 3300005334 Bacteria 2184
22 Ga0070666_10001239 3300005335 Bacteria 15435
23 Ga0070666_10009140 3300005335 Bacteria 6179
24 Ga0070680_100046206 3300005336 Bacteria 3541
25 Ga0070680_100212762 3300005336 Bacteria 1631
26 Ga0070682_100069975 3300005337 Bacteria 2242
27 Ga0068868_100001857 3300005338 Bacteria 14499
28 Ga0068868_100005645 3300005338 Bacteria 8806
29 Ga0068868_100173623 3300005338 Bacteria 1785
30 Ga0070660_100014044 3300005339 Bacteria 5764
31 Ga0070660_100100830 3300005339 Bacteria 2287
32 Ga0070660_100164259 3300005339 Bacteria 1790
33 Ga0070660_100332316 3300005339 Bacteria 1250
34 Ga0070689_100003142 3300005340 Bacteria 10924
35 Ga0070689_100669986 3300005340 Bacteria 904
36 Ga0070661_100085770 3300005344 Bacteria 2327
37 Ga0070661_100161304 3300005344 Bacteria 1698
38 Ga0070661_100219051 3300005344 Bacteria 1459
39 Ga0070692_10036823 3300005345 Bacteria 2485
40 Ga0070692_10390545 3300005345 Bacteria 876
41 Ga0070668_100009765 3300005347 Bacteria 7114
42 Ga0070668_100011053 3300005347 Bacteria 6720
43 Ga0070668_100024428 3300005347 Bacteria 4579
44 Ga0070668_100092604 3300005347 Bacteria 2384
45 Ga0070669_100130606 3300005353 Bacteria 1926
46 Ga0070675_100013624 3300005354 Bacteria 6394
47 Ga0070675_100028134 3300005354 Bacteria 4523
48 Ga0070675_100030634 3300005354 Bacteria 4344
49 Ga0070675_100261794 3300005354 Bacteria 1516
50 Ga0070671_100002986 3300005355 Bacteria 13164
51 Ga0070671_100013348 3300005355 Bacteria 6621
52 Ga0070671_100052646 3300005355 Bacteria 3384
53 Ga0070671_100297517 3300005355 Bacteria 1374
54 Ga0070671_100346011 3300005355 Bacteria 1269
55 Ga0070674_100014547 3300005356 Bacteria 4894
56 Ga0070674_100065882 3300005356 Bacteria 2544
57 Ga0070674_100086827 3300005356 Bacteria 2248
58 Ga0070674_100401046 3300005356 Bacteria 1121
59 Ga0070673_100005623 3300005364 Bacteria 8043
60 Ga0070673_100005830 3300005364 Bacteria 7938
61 Ga0070673_100043334 3300005364 Bacteria 3476
62 Ga0070673_100051987 3300005364 Bacteria 3212
63 Ga0070673_100124315 3300005364 Bacteria 2156
64 Ga0070688_100000458 3300005365 Bacteria 20699
65 Ga0070688_100204330 3300005365 Bacteria 1384
66 Ga0070659_100124663 3300005366 Bacteria 2089
67 Ga0070659_100147820 3300005366 Bacteria 1915
68 Ga0070659_100165857 3300005366 Bacteria 1807
69 Ga0070659_100288401 3300005366 Bacteria 1366
70 Ga0070667_100003537 3300005367 Bacteria 13310
71 Ga0070667_100013731 3300005367 Bacteria 6695
72 Ga0070667_100237462 3300005367 Bacteria 1626
73 Ga0070667_100267578 3300005367 Bacteria 1532
74 Ga0070709_10001951 3300005434 Bacteria 11233
75 Ga0070714_100009134 3300005435 Bacteria 7777
76 Ga0070714_100040356 3300005435 Bacteria 3934
77 Ga0070714_100209573 3300005435 Bacteria 1786
78 Ga0070714_100738068 3300005435 Bacteria 951
79 Ga0070714_100854003 3300005435 Bacteria 883
80 Ga0070713_100002402 3300005436 Bacteria 12211
81 Ga0070713_100020507 3300005436 Bacteria 5068
82 Ga0070713_100142839 3300005436 Bacteria 2122
83 Ga0070713_100214158 3300005436 Bacteria 1745
84 Ga0070710_10036498 3300005437 Bacteria 2688
85 Ga0070701_10012622 3300005438 Bacteria 3816
86 Ga0070711_100003780 3300005439 Bacteria 8880
87 Ga0070711_100239915 3300005439 Bacteria 1417
88 Ga0070694_100037166 3300005444 Bacteria 3229
89 Ga0070708_100054327 3300005445 Bacteria 3557
90 Ga0070663_100008281 3300005455 Bacteria 6387
91 Ga0070663_100123186 3300005455 Bacteria 1961
92 Ga0070663_100146392 3300005455 Bacteria 1808
93 Ga0070663_100238322 3300005455 Bacteria 1435
94 Ga0070678_100001518 3300005456 Bacteria 12390
95 Ga0070678_100007823 3300005456 Bacteria 6360
96 Ga0070678_100093439 3300005456 Bacteria 2313
97 Ga0070662_100084522 3300005457 Bacteria 2371
98 Ga0070662_100316928 3300005457 Bacteria 1271
99 Ga0070662_100788667 3300005457 Bacteria 807
100 Ga0070681_10005398 3300005458 Bacteria 12344
101 Ga0070681_10008601 3300005458 Bacteria 10006
102 Ga0070681_10217907 3300005458 Bacteria 1824
103 Ga0070681_10348590 3300005458 Bacteria 1391
104 Ga0068867_100008965 3300005459 Bacteria 7058
105 Ga0068867_100026811 3300005459 Bacteria 4139
106 Ga0068867_100487133 3300005459 Bacteria 1058
107 Ga0070685_10008324 3300005466 Bacteria 5324
108 Ga0070685_10225443 3300005466 Bacteria 1230
109 Ga0070707_100071004 3300005468 Bacteria 3354
110 Ga0070698_100589264 3300005471 Bacteria 1052
111 Ga0070699_100023002 3300005518 Bacteria 5370
112 Ga0070699_100046715 3300005518 Bacteria 3746
113 Ga0070679_100011162 3300005530 Bacteria 8557
114 Ga0070679_100046471 3300005530 Bacteria 4327
115 Ga0070679_100151429 3300005530 Bacteria 2296
116 Ga0070679_100215667 3300005530 Bacteria 1882
117 Ga0070679_100310377 3300005530 Bacteria 1527
118 Ga0070684_100042537 3300005535 Bacteria 3922
119 Ga0070684_100081329 3300005535 Bacteria 2866
120 Ga0070697_100013500 3300005536 Bacteria 6408
121 Ga0068853_100046600 3300005539 Bacteria 3718
122 Ga0068853_100178978 3300005539 Bacteria 1922
123 Ga0068853_100222230 3300005539 Bacteria 1725
124 Ga0068853_100400438 3300005539 Bacteria 1285
125 Ga0070672_100000308 3300005543 Bacteria 27646
126 Ga0070672_100002977 3300005543 Bacteria 10912
127 Ga0070672_100023780 3300005543 Bacteria 4520
128 Ga0070672_100028844 3300005543 Bacteria 4155
129 Ga0070672_100039503 3300005543 Bacteria 3615
130 Ga0070672_100079170 3300005543 Bacteria 2630
131 Ga0070686_100040050 3300005544 Bacteria 2922
132 Ga0070696_100035587 3300005546 Bacteria 3429
133 Ga0070696_100064816 3300005546 Bacteria 2560
134 Ga0070693_100024807 3300005547 Bacteria 3220
135 Ga0070665_100001417 3300005548 Bacteria 28129
136 Ga0070665_100001524 3300005548 Bacteria 26828
137 Ga0070665_100007532 3300005548 Bacteria 11066
138 Ga0070665_100021232 3300005548 Bacteria 6529
139 Ga0070665_100089954 3300005548 Bacteria 3075
140 Ga0068855_100001119 3300005563 Bacteria 33345
141 Ga0070664_100000934 3300005564 Bacteria 22823
142 Ga0070664_100067175 3300005564 Bacteria 3064
143 Ga0070664_100271007 3300005564 Bacteria 1529
144 Ga0070664_100595648 3300005564 Bacteria 1025
145 Ga0068857_100002116 3300005577 Bacteria 16149
146 Ga0068857_100028759 3300005577 Bacteria 4904
147 Ga0068857_100160467 3300005577 Bacteria 2040
148 Ga0068854_100003623 3300005578 Bacteria 9664
149 Ga0068854_100021061 3300005578 Bacteria 4420
150 Ga0068854_100029133 3300005578 Bacteria 3820
151 Ga0068854_100193172 3300005578 Bacteria 1596
152 Ga0068856_100006845 3300005614 Bacteria 11150
153 Ga0068856_100013862 3300005614 Bacteria 7795
154 Ga0068856_100185290 3300005614 Bacteria 2095
155 Ga0068852_100000768 3300005616 Bacteria 21136
156 Ga0068852_100012670 3300005616 Bacteria 6413
157 Ga0068852_100112895 3300005616 Bacteria 2473
158 Ga0068852_100147553 3300005616 Bacteria 2183
159 Ga0068852_100150540 3300005616 Bacteria 2163
160 Ga0068859_100002028 3300005617 Bacteria 20687
161 Ga0068859_100156595 3300005617 Bacteria 2356
162 Ga0068859_100302767 3300005617 Bacteria 1692
163 Ga0068864_100000455 3300005618 Bacteria 35377
164 Ga0068864_100000740 3300005618 Bacteria 27362
165 Ga0068864_100063009 3300005618 Bacteria 3213
166 Ga0068864_100177810 3300005618 Bacteria 1944
167 Ga0068864_100502645 3300005618 Bacteria 1166
168 Ga0068864_100649693 3300005618 Bacteria 1027
169 Ga0068866_10000548 3300005718 Bacteria 17150
170 Ga0068866_10208924 3300005718 Bacteria 1171
171 Ga0068861_100207468 3300005719 Bacteria 1648
172 Ga0068861_100307053 3300005719 Bacteria 1376
173 Ga0068861_100489192 3300005719 Bacteria 1110
174 Ga0068851_10006873 3300005834 Bacteria 5212
175 Ga0068851_10078478 3300005834 Bacteria 1720
176 Ga0068870_10004919 3300005840 Bacteria 5785
177 Ga0068863_100009317 3300005841 Bacteria 9581
178 Ga0068863_100036668 3300005841 Bacteria 4670
179 Ga0068863_100050940 3300005841 Bacteria 3924
180 Ga0068863_100401422 3300005841 Bacteria 1341
181 Ga0068863_100670217 3300005841 Bacteria 1029
182 Ga0068858_100000850 3300005842 Bacteria 31613
183 Ga0068858_100032194 3300005842 Bacteria 4870
184 Ga0068858_100141381 3300005842 Bacteria 2259
185 Ga0068858_100389535 3300005842 Bacteria 1338
186 Ga0068858_100452841 3300005842 Bacteria 1237
187 Ga0068860_100008471 3300005843 Bacteria 10247
188 Ga0068860_100022393 3300005843 Bacteria 6112
189 Ga0068860_100353651 3300005843 Bacteria 1446
190 Ga0068860_100399763 3300005843 Bacteria 1359
191 Ga0068862_100029944 3300005844 Bacteria 4587
192 Ga0068862_100111823 3300005844 Bacteria 2398
193 Ga0081455_10172117 3300005937 Bacteria 1648
194 Ga0070716_100011269 3300006173 Bacteria 4501
195 Ga0070712_100004102 3300006175 Bacteria 8949
196 Ga0070712_100255614 3300006175 Bacteria 1402
197 Ga0075366_10133174 3300006195 Bacteria 1500
198 Ga0097621_100005686 3300006237 Bacteria 8801
199 Ga0097621_100027814 3300006237 Bacteria 4451
200 Ga0097621_100072662 3300006237 Bacteria 2845
201 Ga0097621_100419683 3300006237 Bacteria 1201
202 Ga0097621_100456682 3300006237 Bacteria 1152
203 Ga0068871_100050572 3300006358 Bacteria 3362
204 Ga0068871_100285365 3300006358 Bacteria 1445
205 Ga0075428_100170197 3300006844 Bacteria 2362
206 Ga0075428_100235058 3300006844 Bacteria 1978
207 Ga0075434_100110026 3300006871 Bacteria 2766
208 Ga0068865_100085048 3300006881 Bacteria 2281
209 Ga0068865_100138120 3300006881 Bacteria 1834
210 Ga0068865_100195897 3300006881 Bacteria 1566
211 Ga0097620_100002027 3300006931 Bacteria 20687
212 Ga0097620_100156598 3300006931 Bacteria 2356
213 Ga0097620_100302747 3300006931 Bacteria 1692
214 Ga0075435_100043986 3300007076 Bacteria 3577
215 Ga0105240_10000332 3300009093 Bacteria 88613
216 Ga0105240_10090010 3300009093 Bacteria 3752
217 Ga0105240_10090143 3300009093 Bacteria 3749
218 Ga0105240_10810231 3300009093 Bacteria 1014
219 Ga0105245_10013288 3300009098 Bacteria 7172
220 Ga0105245_10189531 3300009098 Bacteria 1969
221 Ga0105247_10029095 3300009101 Bacteria 3346
222 Ga0105243_10057543 3300009148 Bacteria 3096
223 Ga0105241_10004491 3300009174 Bacteria 10319
224 Ga0105241_10024851 3300009174 Bacteria 4451
225 Ga0105241_10044096 3300009174 Bacteria 3379
226 Ga0105248_10032092 3300009177 Bacteria 5869
227 Ga0105248_10121389 3300009177 Bacteria 2948
228 Ga0105248_10310224 3300009177 Bacteria 1777
229 Ga0105248_10354239 3300009177 Bacteria 1652
230 Ga0105248_10860738 3300009177 Bacteria 1023
231 Ga0105237_10028957 3300009545 Bacteria 5634
232 Ga0105237_10304412 3300009545 Bacteria 1597
233 Ga0105238_10000244 3300009551 Bacteria 60605
234 Ga0105238_10198644 3300009551 Bacteria 1981
235 Ga0105239_10073547 3300010375 Bacteria 3757
236 Ga0105239_10092064 3300010375 Bacteria 3346
237 Ga0105246_10051342 3300011119 Bacteria 2832
238 Ga0105246_10395288 3300011119 Bacteria 1146
239 Ga0157373_10019865 3300013100 Bacteria 4887
240 Ga0157373_10024332 3300013100 Bacteria 4388
241 Ga0157373_10051274 3300013100 Bacteria 2940
242 Ga0157373_10370840 3300013100 Bacteria 1023
243 Ga0157373_10485500 3300013100 Bacteria 891
244 Ga0157371_10023665 3300013102 Bacteria 4491
245 Ga0157371_10253857 3300013102 Bacteria 1267
246 Ga0157370_10005883 3300013104 Bacteria 13674
247 Ga0157370_10009707 3300013104 Bacteria 10233
248 Ga0157370_10026468 3300013104 Bacteria 5727
249 Ga0157370_10279217 3300013104 Bacteria 1543
250 Ga0157370_10553279 3300013104 Bacteria 1055
251 Ga0157369_10005394 3300013105 Bacteria 14884
252 Ga0157369_10194997 3300013105 Bacteria 2127
253 Ga0157369_10201144 3300013105 Bacteria 2091
254 Ga0157369_10787895 3300013105 Bacteria 977
255 Ga0157374_10003271 3300013296 Bacteria 13608
256 Ga0157374_10215666 3300013296 Bacteria 1882
257 Ga0157374_10807317 3300013296 Bacteria 954
258 Ga0157378_10005893 3300013297 Bacteria 10735
259 Ga0157378_10064824 3300013297 Bacteria 3269
260 Ga0157378_10137993 3300013297 Bacteria 2262
261 Ga0157378_10165684 3300013297 Bacteria 2070
262 Ga0163162_10020054 3300013306 Bacteria 6566
263 Ga0163162_10061410 3300013306 Bacteria 3796
264 Ga0163162_10169699 3300013306 Bacteria 2306
265 Ga0163162_10290493 3300013306 Bacteria 1767
266 Ga0163162_10343862 3300013306 Bacteria 1624
267 Ga0163162_10510112 3300013306 Bacteria 1333
268 Ga0157372_10002879 3300013307 Bacteria 18604
269 Ga0157372_10057898 3300013307 Bacteria 4332
270 Ga0157372_10132165 3300013307 Bacteria 2872
271 Ga0157372_10271123 3300013307 Bacteria 1972
272 Ga0157375_10006021 3300013308 Bacteria 10577
273 Ga0157375_10011902 3300013308 Bacteria 7697
274 Ga0157375_10035555 3300013308 Bacteria 4756
275 Ga0157375_10068797 3300013308 Bacteria 3544
276 Ga0157375_10243716 3300013308 Bacteria 1957
277 Ga0157375_10439583 3300013308 Bacteria 1470
278 Ga0163163_10000310 3300014325 Bacteria 47904
279 Ga0163163_10043746 3300014325 Bacteria 4392
280 Ga0163163_10349037 3300014325 Bacteria 1535
281 Ga0157380_10043712 3300014326 Bacteria 3508
282 Ga0182008_10067352 3300014497 Bacteria 1762
283 Ga0182008_10082404 3300014497 Bacteria 1583
284 Ga0157377_10126571 3300014745 Bacteria 1555
285 Ga0157377_10451438 3300014745 Bacteria 887
286 Ga0157379_10000626 3300014968 Bacteria 28509
287 Ga0157379_10136790 3300014968 Bacteria 2207
288 Ga0157376_10005464 3300014969 Bacteria 8883
289 Ga0157376_10111908 3300014969 Bacteria 2405
290 Ga0157376_10234134 3300014969 Bacteria 1707
291 Ga0157376_10358740 3300014969 Bacteria 1397
292 Ga0163161_10038381 3300017792 Bacteria 3435
293 Ga0163161_10293990 3300017792 Bacteria 1277
294 Ga0197907_10357466 3300020069 Bacteria 869
295 Ga0206356_10470992 3300020070 Bacteria 1566
296 Ga0206350_10016023 3300020080 Bacteria 825
297 Ga0206354_10100971 3300020081 Bacteria 773
298 Ga0154015_1377351 3300020610 Bacteria 1473
299 Ga0154015_1531000 3300020610 Bacteria 1266
300 Ga0224712_10100485 3300022467 Bacteria 1226
301 Ga0207697_10022631 3300025315 Bacteria 2574
302 Ga0207656_10025393 3300025321 Bacteria 2405
303 Ga0207682_10000061 3300025893 Bacteria 46850
304 Ga0207682_10115312 3300025893 Bacteria 1186
305 Ga0207692_10283412 3300025898 Bacteria 1003
306 Ga0207642_10029855 3300025899 Bacteria 2263
307 Ga0207710_10272210 3300025900 Bacteria 851
308 Ga0207688_10013116 3300025901 Bacteria 4505
309 Ga0207688_10180618 3300025901 Bacteria 1258
310 Ga0207680_10004784 3300025903 Bacteria 6447
311 Ga0207680_10014384 3300025903 Bacteria 4093
312 Ga0207680_10286128 3300025903 Bacteria 1146
313 Ga0207680_10368882 3300025903 Bacteria 1010
314 Ga0207699_10134270 3300025906 Bacteria 1618
315 Ga0207645_10002609 3300025907 Bacteria 14052
316 Ga0207643_10005370 3300025908 Bacteria 6859
317 Ga0207643_10031149 3300025908 Bacteria 2972
318 Ga0207643_10190550 3300025908 Bacteria 1245
319 Ga0207643_10238416 3300025908 Bacteria 1117
320 Ga0207705_10083383 3300025909 Bacteria 2332
321 Ga0207705_10085213 3300025909 Bacteria 2308
322 Ga0207705_10274479 3300025909 Bacteria 1289
323 Ga0207705_10480875 3300025909 Bacteria 964
324 Ga0207705_10551014 3300025909 Bacteria 896
325 Ga0207654_10129434 3300025911 Bacteria 1596
326 Ga0207654_10238568 3300025911 Bacteria 1214
327 Ga0207707_10013250 3300025912 Bacteria 7183
328 Ga0207707_10033435 3300025912 Bacteria 4500
329 Ga0207707_10109658 3300025912 Bacteria 2413
330 Ga0207707_10403609 3300025912 Bacteria 1173
331 Ga0207695_10039493 3300025913 Bacteria 5073
332 Ga0207695_10066294 3300025913 Bacteria 3709
333 Ga0207695_10111471 3300025913 Bacteria 2715
334 Ga0207695_10220565 3300025913 Bacteria 1804
335 Ga0207671_10283072 3300025914 Bacteria 1308
336 Ga0207693_10000485 3300025915 Bacteria 36061
337 Ga0207693_10055636 3300025915 Bacteria 3104
338 Ga0207693_10171803 3300025915 Bacteria 1707
339 Ga0207693_10363514 3300025915 Bacteria 1132
340 Ga0207663_10041522 3300025916 Bacteria 2803
341 Ga0207660_10114229 3300025917 Bacteria 2036
342 Ga0207660_10337101 3300025917 Bacteria 1207
343 Ga0207660_10455997 3300025917 Bacteria 1034
344 Ga0207662_10054613 3300025918 Bacteria 2382
345 Ga0207662_10146324 3300025918 Bacteria 1500
346 Ga0207657_10000240 3300025919 Bacteria 58053
347 Ga0207657_10002577 3300025919 Bacteria 19605
348 Ga0207657_10701394 3300025919 Bacteria 786
349 Ga0207649_10042056 3300025920 Bacteria 2785
350 Ga0207649_10069389 3300025920 Bacteria 2244
351 Ga0207649_10089399 3300025920 Bacteria 2013
352 Ga0207652_10008752 3300025921 Bacteria 8147
353 Ga0207652_10050689 3300025921 Bacteria 3557
354 Ga0207652_10174010 3300025921 Bacteria 1932
355 Ga0207652_10343166 3300025921 Bacteria 1348
356 Ga0207652_10493927 3300025921 Bacteria 1102
357 Ga0207652_10640028 3300025921 Bacteria 951
358 Ga0207681_10024021 3300025923 Bacteria 3907
359 Ga0207681_10083649 3300025923 Bacteria 2259
360 Ga0207694_10171593 3300025924 Bacteria 1756
361 Ga0207694_10373780 3300025924 Bacteria 1182
362 Ga0207650_10020951 3300025925 Bacteria 4618
363 Ga0207650_10021783 3300025925 Bacteria 4532
364 Ga0207650_10066683 3300025925 Bacteria 2699
365 Ga0207650_10183340 3300025925 Bacteria 1669
366 Ga0207659_10019552 3300025926 Bacteria 4461
367 Ga0207659_10029096 3300025926 Bacteria 3761
368 Ga0207659_10073026 3300025926 Bacteria 2510
369 Ga0207659_10089151 3300025926 Bacteria 2300
370 Ga0207659_10195386 3300025926 Bacteria 1612
371 Ga0207687_10001442 3300025927 Bacteria 16268
372 Ga0207687_10042059 3300025927 Bacteria 3141
373 Ga0207700_10010411 3300025928 Bacteria 5867
374 Ga0207700_10015613 3300025928 Bacteria 5016
375 Ga0207700_10036619 3300025928 Bacteria 3547
376 Ga0207700_10159423 3300025928 Bacteria 1873
377 Ga0207700_10394235 3300025928 Bacteria 1212
378 Ga0207664_10009373 3300025929 Bacteria 6867
379 Ga0207664_10015854 3300025929 Bacteria 5486
380 Ga0207664_10134989 3300025929 Bacteria 2081
381 Ga0207664_10160377 3300025929 Bacteria 1918
382 Ga0207664_10508323 3300025929 Bacteria 1079
383 Ga0207644_10010849 3300025931 Bacteria 6015
384 Ga0207644_10014416 3300025931 Bacteria 5288
385 Ga0207644_10015490 3300025931 Bacteria 5119
386 Ga0207644_10103945 3300025931 Bacteria 2138
387 Ga0207690_10042995 3300025932 Bacteria 2971
388 Ga0207690_10166598 3300025932 Bacteria 1647
389 Ga0207690_10352325 3300025932 Bacteria 1164
390 Ga0207706_10053246 3300025933 Bacteria 3573
391 Ga0207686_10058449 3300025934 Bacteria 2431
392 Ga0207686_10454499 3300025934 Bacteria 986
393 Ga0207709_10516106 3300025935 Bacteria 935
394 Ga0207670_10173526 3300025936 Bacteria 1618
395 Ga0207669_10125310 3300025937 Bacteria 1753
396 Ga0207669_10158948 3300025937 Bacteria 1593
397 Ga0207669_10282044 3300025937 Bacteria 1253
398 Ga0207665_10052801 3300025939 Bacteria 2739
399 Ga0207691_10000016 3300025940 Bacteria 141024
400 Ga0207691_10000403 3300025940 Bacteria 43257
401 Ga0207691_10004470 3300025940 Bacteria 13543
402 Ga0207691_10005992 3300025940 Bacteria 11740
403 Ga0207691_10049904 3300025940 Bacteria 3833
404 Ga0207691_10094699 3300025940 Bacteria 2672
405 Ga0207711_10000115 3300025941 Bacteria 83472
406 Ga0207711_10415327 3300025941 Bacteria 1251
407 Ga0207711_10557049 3300025941 Bacteria 1069
408 Ga0207689_10007197 3300025942 Bacteria 9773
409 Ga0207689_10013293 3300025942 Bacteria 7022
410 Ga0207689_10237980 3300025942 Bacteria 1505
411 Ga0207661_10145483 3300025944 Bacteria 2044
412 Ga0207679_10151487 3300025945 Bacteria 1888
413 Ga0207679_10184331 3300025945 Bacteria 1729
414 Ga0207679_10297700 3300025945 Bacteria 1389
415 Ga0207679_10392443 3300025945 Bacteria 1219
416 Ga0207667_10071924 3300025949 Bacteria 3595
417 Ga0207667_10106771 3300025949 Bacteria 2888
418 Ga0207651_10000427 3300025960 Bacteria 17939
419 Ga0207651_10020040 3300025960 Bacteria 4025
420 Ga0207651_10026974 3300025960 Bacteria 3600
421 Ga0207651_10029467 3300025960 Bacteria 3478
422 Ga0207651_10035670 3300025960 Bacteria 3238
423 Ga0207668_10045746 3300025972 Bacteria 2986
424 Ga0207668_10097017 3300025972 Bacteria 2180
425 Ga0207668_10111456 3300025972 Bacteria 2054
426 Ga0207668_10182993 3300025972 Bacteria 1654
427 Ga0207640_10009888 3300025981 Bacteria 5355
428 Ga0207640_10023654 3300025981 Bacteria 3695
429 Ga0207640_10035643 3300025981 Bacteria 3115
430 Ga0207640_10056033 3300025981 Bacteria 2585
431 Ga0207640_10464380 3300025981 Bacteria 1046
432 Ga0207658_10017552 3300025986 Bacteria 4934
433 Ga0207658_10027345 3300025986 Bacteria 4006
434 Ga0207658_10105780 3300025986 Bacteria 2214
435 Ga0207658_10251010 3300025986 Bacteria 1503
436 Ga0207677_10000210 3300026023 Bacteria 47077
437 Ga0207677_10010883 3300026023 Bacteria 5163
438 Ga0207677_10106146 3300026023 Bacteria 2080
439 Ga0207677_10413495 3300026023 Bacteria 1147
440 Ga0207703_10000438 3300026035 Bacteria 43827
441 Ga0207639_10047455 3300026041 Bacteria 3246
442 Ga0207639_10120046 3300026041 Bacteria 2158
443 Ga0207639_10214358 3300026041 Bacteria 1659
444 Ga0207639_10419124 3300026041 Bacteria 1210
445 Ga0207678_10045920 3300026067 Bacteria 3777
446 Ga0207678_10150957 3300026067 Bacteria 1984
447 Ga0207678_10153548 3300026067 Bacteria 1966
448 Ga0207678_10272028 3300026067 Bacteria 1453
449 Ga0207708_10033508 3300026075 Bacteria 3903
450 Ga0207702_10016093 3300026078 Bacteria 6192
451 Ga0207702_10028889 3300026078 Bacteria 4611
452 Ga0207702_10056716 3300026078 Bacteria 3326
453 Ga0207702_10449489 3300026078 Bacteria 1250
454 Ga0207702_10461156 3300026078 Bacteria 1234
455 Ga0207702_10909325 3300026078 Bacteria 872
456 Ga0207641_10001573 3300026088 Bacteria 22307
457 Ga0207641_10047920 3300026088 Bacteria 3605
458 Ga0207641_10513885 3300026088 Bacteria 1164
459 Ga0207648_10022497 3300026089 Bacteria 5658
460 Ga0207648_10105331 3300026089 Bacteria 2474
461 Ga0207648_10377093 3300026089 Bacteria 1282
462 Ga0207648_10428040 3300026089 Bacteria 1203
463 Ga0207676_10000415 3300026095 Bacteria 36094
464 Ga0207676_10013255 3300026095 Bacteria 5921
465 Ga0207676_10047895 3300026095 Bacteria 3315
466 Ga0207676_10078201 3300026095 Bacteria 2678
467 Ga0207676_10410373 3300026095 Bacteria 1268
468 Ga0207676_10665449 3300026095 Bacteria 1006
469 Ga0207674_10000237 3300026116 Bacteria 68721
470 Ga0207674_10006274 3300026116 Bacteria 14012
471 Ga0207674_10050952 3300026116 Bacteria 4226
472 Ga0207674_10156279 3300026116 Bacteria 2236
473 Ga0207674_10705792 3300026116 Bacteria 974
474 Ga0207675_100028498 3300026118 Bacteria 5199
475 Ga0207675_100032081 3300026118 Bacteria 4893
476 Ga0207675_100046380 3300026118 Bacteria 4060
477 Ga0207675_100143050 3300026118 Bacteria 2273
478 Ga0207675_100272663 3300026118 Bacteria 1642
479 Ga0207683_10000322 3300026121 Bacteria 43758
480 Ga0207683_10005374 3300026121 Bacteria 10981
481 Ga0207683_10038415 3300026121 Bacteria 4172
482 Ga0207683_10322733 3300026121 Bacteria 1415
483 Ga0207698_10012505 3300026142 Bacteria 5558
484 Ga0207698_10086819 3300026142 Bacteria 2546
485 Ga0207698_10093281 3300026142 Bacteria 2471
486 Ga0207698_10115819 3300026142 Bacteria 2258
487 Ga0207698_10147089 3300026142 Bacteria 2039
488 Ga0207698_10260853 3300026142 Bacteria 1592
489 Ga0268266_10008005 3300028379 Bacteria 9450
490 Ga0268266_10027867 3300028379 Bacteria 4803
491 Ga0268266_10049569 3300028379 Bacteria 3601
492 Ga0268266_10142775 3300028379 Bacteria 2150
493 Ga0268266_10277195 3300028379 Bacteria 1558
494 Ga0268265_10038952 3300028380 Bacteria 3500
495 Ga0268265_10469516 3300028380 Bacteria 1179
496 Ga0268264_10001696 3300028381 Bacteria 20279
497 Ga0268264_10092407 3300028381 Bacteria 2612
498 Ga0268264_10351872 3300028381 Bacteria 1402
499 Ga0268264_10395140 3300028381 Bacteria 1327
500 Ga0268264_10558636 3300028381 Bacteria 1123
501 Ga0268264_10668912 3300028381 Bacteria 1029
502 Ga0268264_10735130 3300028381 Bacteria 982
503 Ga0265332_10002744 3300031238 Bacteria 8776
504 Ga0265325_10034431 3300031241 Bacteria 2694
505 Ga0265329_10022400 3300031242 Bacteria 2114
506 Ga0265331_10016184 3300031250 Bacteria 3920
507 Ga0265327_10015235 3300031251 Bacteria 4978
508 Ga0265316_10297821 3300031344 Bacteria 1175
509 Ga0307516_10031515 3300031730 Bacteria 5343
510 Ga0307413_10174906 3300031824 Bacteria 1524
511 Ga0307410_10191898 3300031852 Bacteria 1554
512 Ga0307412_10222448 3300031911 Bacteria 1448
513 Ga0307412_10376139 3300031911 Bacteria 1148
514 Ga0307409_100029964 3300031995 Bacteria 3903
515 Ga0307416_100301141 3300032002 Bacteria 1594
516 Ga0307414_10130847 3300032004 Bacteria 1948
517 Ga0307411_10006056 3300032005 Bacteria 6013
518 Ga0307411_10125323 3300032005 Bacteria 1867
519 Ga0373928_0022491 3300035084 Bacteria 1338
520 Ga0373934_0021469 3300035086 Bacteria 2485
521 Ga0373936_0145769 3300035113 Bacteria 1024
522 Ga0373953_0097056 3300035117 Bacteria 1237
523 Ga0373954_0003066 3300035118 Bacteria 7055
524 Ga0373956_0134589 3300035119 Bacteria 1158
525 Ga0373957_0003850 3300035120 Bacteria 4500
526 Ga0373943_0033714 3300035170 Bacteria 2441
527 Ga0373946_0114061 3300035171 Bacteria 1226
528 Ga0373955_0003010 3300035172 Bacteria 7384
529 Ga0373924_0006705 3300035410 Bacteria 4134
530 Ga0373931_0044303 3300035691 Bacteria 2346
531 Ga0373927_0080462 3300035695 Bacteria 2111
532 Ga0373933_0015824 3300035724 Bacteria 4209
533 Ga0373933_0026781 3300035724 Bacteria 3314
534 Ga0373947_0032374 3300035725 Bacteria 3081
535 Ga0373937_0009175 3300036401 Bacteria 8586
536 Ga0373937_0024904 3300036401 Bacteria 5401
537 Ga0373937_0524797 3300036401 Bacteria 1125
538 Ga0373925_0059311 3300037068 Bacteria 2870
539 Ga0373925_0112638 3300037068 Bacteria 2103
540 Ga0395899_0104107 3300037312 Bacteria 2046
541 Ga0395900_0341325 3300037418 Bacteria 1473
542 Ga0395898_0199776 3300037466 Bacteria 1909
543 Ga0395901_0069237 3300038443 Bacteria 3675
544 Ga0395901_0324675 3300038443 Bacteria 1592
545 Ga0451577_0002330 3300042876 Bacteria 22882
546 Ga0451577_0423642 3300042876 Bacteria 1209
547 Ga0453683_0086917 3300044673 Bacteria 1959
548 Ga0466963_0021552 3300044694 Bacteria 4068
549 Ga0453684_0008886 3300044712 Bacteria 17799
550 Ga0453684_0110465 3300044712 Bacteria 3341
551 Ga0451576_0002999 3300045051 Bacteria 23862
552 Ga0451576_0315382 3300045051 Bacteria 1636
553 Ga0451576_0320270 3300045051 Bacteria 1622
554 Ga0495629_0106737 3300046459 Bacteria 1953
555 Ga0495651_0360249 3300046462 Bacteria 959
556 Ga0495580_0119055 3300046472 Bacteria 1833
557 Ga0495639_0053629 3300046475 Bacteria 1837
558 Ga0495662_0056805 3300046476 Bacteria 1890
559 Ga0495594_0097429 3300046499 Bacteria 1653
560 Ga0495606_0037758 3300046507 Bacteria 3276
561 Ga0495606_0053060 3300046507 Bacteria 2632
562 Ga0495630_0083896 3300046517 Bacteria 2406
563 Ga0495654_0021588 3300046530 Bacteria 3348
564 Ga0495665_0010339 3300046531 Bacteria 5050
565 Ga0495640_0211486 3300046533 Bacteria 1226
566 Ga0495609_0101809 3300046538 Bacteria 1244
567 Ga0495645_0088355 3300046543 Bacteria 2217
568 Ga0495645_0228964 3300046543 Bacteria 1246
569 Ga0495635_0043202 3300046663 Bacteria 3110
570 Ga0495659_0000122 3300046664 Bacteria 34041
571 Ga0495623_0059055 3300046679 Bacteria 2410
572 Ga0495613_0024468 3300046689 Bacteria 4499
573 Ga0495671_0000430 3300046692 Bacteria 33279
574 Ga0495660_0002980 3300046810 Bacteria 10569
575 Ga0495674_0491516 3300047319 Bacteria 982
576 Ga0495672_0000176 3300047320 Bacteria 92728
577 Ga0495676_0508718 3300047321 Bacteria 790
578 Ga0495680_0037414 3300047322 Bacteria 3887
579 Ga0495675_0079181 3300047444 Bacteria 2070
580 Ga0495684_0039104 3300047471 Bacteria 3636
581 Ga0495684_0334449 3300047471 Bacteria 1079
582 Ga0495686_0009713 3300047472 Bacteria 6907
583 Ga0495602_0219067 3300048088 Bacteria 1438
584 Ga0495614_0012737 3300048089 Bacteria 3690
585 Ga0496100_0064502 3300048903 Bacteria 2424
586 Ga0496101_0010694 3300048904 Bacteria 6065
587 Ga0496101_0462870 3300048904 Bacteria 1001
588 Ga0496104_0023522 3300048907 Bacteria 5665
589 Ga0496105_0019861 3300048908 Bacteria 5421
590 Ga0496106_0101829 3300048909 Bacteria 2228
591 Ga0496106_0653294 3300048909 Bacteria 840
592 Ga0496109_0020289 3300048912 Bacteria 5869
593 Ga0496109_0408504 3300048912 Bacteria 1283
594 Ga0496110_0137917 3300048913 Bacteria 2205
595 Ga0496112_0002173 3300048915 Bacteria 15586
596 Ga0496112_0026219 3300048915 Bacteria 5605
597 Ga0496112_0154404 3300048915 Bacteria 2263
598 Ga0496114_0028308 3300048917 Bacteria 4597
599 Ga0496114_0362275 3300048917 Bacteria 1283
600 Ga0496125_0182914 3300048928 Bacteria 1394
601 Ga0501310_002663 3300049130 Bacteria 1706
602 Ga0501033_0171338 3300049570 Bacteria 1559
603 Ga0501038_0445391 3300049574 Bacteria 996
604 Ga0501040_0247710 3300049576 Bacteria 1271
605 Ga0501067_0037399 3300049583 Bacteria 2696
606 Ga0501219_012304 3300049703 Bacteria 662
607 Ga0501035_0006955 3300049822 Bacteria 10565
608 Ga0501044_0001056 3300049823 Bacteria 33138
609 Ga0501045_0437962 3300049824 Bacteria 972
610 nmdc:mga0rr50_88706_c1 3300050513 Bacteria 2403
611 nmdc:mga08x19_30093_c1 3300050514 Bacteria 3409
612 nmdc:mga08x19_49289_c1 3300050514 Bacteria 2700
613 Ga0495612_0017904 3300053078 Bacteria 2836
614 Ga0495619_0005152 3300053085 Bacteria 8295
615 Ga0500634_0016000 3300053161 Bacteria 3997
616 Ga0587093_025330 3300059478 Bacteria 822
617 Ga0587090_040772 3300059510 Bacteria 816
618 Ga0587113_010239 3300059625 Bacteria 862
619 Ga0587115_014942 3300059626 Bacteria 1022
620 Ga0587128_026143 3300059630 Bacteria 934
621 Ga0587068_031069 3300059641 Bacteria 926
622 Ga0587075_017360 3300059644 Bacteria 1034
623 Ga0587078_016403 3300059646 Bacteria 902

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053161 Ga0500634_0016000 Ga0500634_0016000_3400_3984 180
2 3300046543 Ga0495645_0228964 Ga0495645_0228964_12_608 184
3 3300047471 Ga0495684_0334449 Ga0495684_0334449_10_606 184
4 3300048928 Ga0496125_0182914 Ga0496125_0182914_542_1222 187
5 3300025945 Ga0207679_10297700 Ga0207679_102977002 193
6 3300049703 Ga0501219_012304 Ga0501219_012304_28_651 193
7 3300048917 Ga0496114_0362275 Ga0496114_0362275_510_1208 195
8 3300013104 Ga0157370_10005883 Ga0157370_100058835 200
9 3300013105 Ga0157369_10194997 Ga0157369_101949972 200
10 3300013307 Ga0157372_10132165 Ga0157372_101321653 200
11 3300005328 Ga0070676_10341499 Ga0070676_103414991 203
12 3300005355 Ga0070671_100346011 Ga0070671_1003460112 203
13 3300005356 Ga0070674_100065882 Ga0070674_1000658824 203
14 3300005456 Ga0070678_100093439 Ga0070678_1000934392 203
15 3300005548 Ga0070665_100021232 Ga0070665_1000212323 203
16 3300005618 Ga0068864_100502645 Ga0068864_1005026452 203
17 3300009177 Ga0105248_10121389 Ga0105248_101213893 203
18 3300013308 Ga0157375_10243716 Ga0157375_102437162 203
19 3300014969 Ga0157376_10358740 Ga0157376_103587401 203
20 3300017792 Ga0163161_10293990 Ga0163161_102939902 203
21 3300025926 Ga0207659_10195386 Ga0207659_101953863 203
22 3300025937 Ga0207669_10282044 Ga0207669_102820443 203
23 3300026088 Ga0207641_10513885 Ga0207641_105138852 203
24 3300026121 Ga0207683_10038415 Ga0207683_100384153 203
25 3300028381 Ga0268264_10668912 Ga0268264_106689121 203
26 3300005333 Ga0070677_10114922 Ga0070677_101149221 204
27 3300005334 Ga0068869_100072952 Ga0068869_1000729521 204
28 3300005364 Ga0070673_100124315 Ga0070673_1001243151 204
29 3300005543 Ga0070672_100028844 Ga0070672_1000288444 204
30 3300005718 Ga0068866_10208924 Ga0068866_102089242 204
31 3300005842 Ga0068858_100452841 Ga0068858_1004528413 204
32 3300005843 Ga0068860_100022393 Ga0068860_1000223933 204
33 3300006237 Ga0097621_100027814 Ga0097621_1000278145 204
34 3300006881 Ga0068865_100195897 Ga0068865_1001958972 204
35 3300009148 Ga0105243_10057543 Ga0105243_100575431 204
36 3300013306 Ga0163162_10290493 Ga0163162_102904931 204
37 3300013308 Ga0157375_10439583 Ga0157375_104395832 204
38 3300014326 Ga0157380_10043712 Ga0157380_100437124 204
39 3300025893 Ga0207682_10115312 Ga0207682_101153121 204
40 3300025908 Ga0207643_10031149 Ga0207643_100311492 204
41 3300025918 Ga0207662_10146324 Ga0207662_101463242 204
42 3300025923 Ga0207681_10083649 Ga0207681_100836493 204
43 3300025935 Ga0207709_10516106 Ga0207709_105161061 204
44 3300025936 Ga0207670_10173526 Ga0207670_101735262 204
45 3300025940 Ga0207691_10049904 Ga0207691_100499042 204
46 3300025942 Ga0207689_10007197 Ga0207689_100071977 204
47 3300025960 Ga0207651_10035670 Ga0207651_100356704 204
48 3300026075 Ga0207708_10033508 Ga0207708_100335081 204
49 3300026089 Ga0207648_10377093 Ga0207648_103770932 204
50 3300026118 Ga0207675_100028498 Ga0207675_1000284986 204
51 3300026121 Ga0207683_10322733 Ga0207683_103227331 204
52 3300028380 Ga0268265_10469516 Ga0268265_104695161 204
53 3300028381 Ga0268264_10092407 Ga0268264_100924072 204
54 3300028381 Ga0268264_10735130 Ga0268264_107351301 204
55 3300005937 Ga0081455_10172117 Ga0081455_101721172 205
56 3300006358 Ga0068871_100285365 Ga0068871_1002853652 205
57 3300013297 Ga0157378_10165684 Ga0157378_101656843 205
58 3300014969 Ga0157376_10234134 Ga0157376_102341341 205
59 3300005459 Ga0068867_100487133 Ga0068867_1004871332 206
60 3300009177 Ga0105248_10310224 Ga0105248_103102241 206
61 3300005327 Ga0070658_10622671 Ga0070658_106226711 207
62 3300005329 Ga0070683_100171932 Ga0070683_1001719324 207
63 3300005334 Ga0068869_100100776 Ga0068869_1001007762 207
64 3300005435 Ga0070714_100854003 Ga0070714_1008540031 207
65 3300005458 Ga0070681_10005398 Ga0070681_100053981 207
66 3300005530 Ga0070679_100215667 Ga0070679_1002156672 207
67 3300005564 Ga0070664_100595648 Ga0070664_1005956481 207
68 3300005844 Ga0068862_100111823 Ga0068862_1001118232 207
69 3300009093 Ga0105240_10810231 Ga0105240_108102311 207
70 3300013105 Ga0157369_10005394 Ga0157369_1000539414 207
71 3300013307 Ga0157372_10057898 Ga0157372_100578983 207
72 3300025909 Ga0207705_10480875 Ga0207705_104808751 207
73 3300025919 Ga0207657_10701394 Ga0207657_107013941 207
74 3300025921 Ga0207652_10174010 Ga0207652_101740102 207
75 3300025926 Ga0207659_10073026 Ga0207659_100730262 207
76 3300025928 Ga0207700_10394235 Ga0207700_103942351 207
77 3300025929 Ga0207664_10160377 Ga0207664_101603773 207
78 3300026078 Ga0207702_10449489 Ga0207702_104494892 207
79 3300026078 Ga0207702_10909325 Ga0207702_109093251 207
80 3300026116 Ga0207674_10156279 Ga0207674_101562791 207
81 3300036401 Ga0373937_0524797 Ga0373937_0524797_331_1062 207
82 3300037312 Ga0395899_0104107 Ga0395899_0104107_664_1371 207
83 3300037418 Ga0395900_0341325 Ga0395900_0341325_593_1300 207
84 3300037466 Ga0395898_0199776 Ga0395898_0199776_900_1607 207
85 3300038443 Ga0395901_0069237 Ga0395901_0069237_1838_2545 207
86 3300005328 Ga0070676_10362219 Ga0070676_103622191 208
87 3300005331 Ga0070670_100030196 Ga0070670_1000301964 208
88 3300005331 Ga0070670_100034350 Ga0070670_1000343503 208
89 3300005618 Ga0068864_100177810 Ga0068864_1001778102 208
90 3300005841 Ga0068863_100401422 Ga0068863_1004014221 208
91 3300006844 Ga0075428_100170197 Ga0075428_1001701973 208
92 3300014497 Ga0182008_10067352 Ga0182008_100673521 208
93 3300025925 Ga0207650_10066683 Ga0207650_100666832 208
94 3300026095 Ga0207676_10013255 Ga0207676_100132555 208
95 3300031730 Ga0307516_10031515 Ga0307516_100315153 208
96 3300050514 nmdc:mga08x19_30093_c1 nmdc:mga08x19_30093_c1_1535_2209 208
97 iso_pu_bacteria 2643221664 2644357137 208
98 iso_pu_bacteria 2738541280 2738741600 208
99 iso_pu_bacteria 2738541300 2738843784 208
100 iso_pu_bacteria 2738543018 2739275135 208
101 iso_pu_bacteria 2738543030 2739344179 208
102 3300005436 Ga0070713_100142839 Ga0070713_1001428392 209
103 3300013104 Ga0157370_10009707 Ga0157370_100097077 209
104 3300025912 Ga0207707_10403609 Ga0207707_104036092 209
105 3300044694 Ga0466963_0021552 Ga0466963_0021552_313_1020 209
106 3300047321 Ga0495676_0508718 Ga0495676_0508718_86_775 209
107 3300005336 Ga0070680_100212762 Ga0070680_1002127622 210
108 3300005339 Ga0070660_100332316 Ga0070660_1003323162 210
109 3300005366 Ga0070659_100288401 Ga0070659_1002884012 210
110 3300005530 Ga0070679_100310377 Ga0070679_1003103771 210
111 3300005616 Ga0068852_100112895 Ga0068852_1001128952 210
112 3300025917 Ga0207660_10337101 Ga0207660_103371012 210
113 3300025921 Ga0207652_10493927 Ga0207652_104939271 210
114 3300025921 Ga0207652_10640028 Ga0207652_106400281 210
115 3300026142 Ga0207698_10260853 Ga0207698_102608531 210
116 3300042876 Ga0451577_0423642 Ga0451577_0423642_260_973 210
117 3300048909 Ga0496106_0653294 Ga0496106_0653294_114_827 210
118 3300049583 Ga0501067_0037399 Ga0501067_0037399_1889_2602 210
119 3300005564 Ga0070664_100271007 Ga0070664_1002710072 211
120 3300005577 Ga0068857_100160467 Ga0068857_1001604672 211
121 3300006237 Ga0097621_100419683 Ga0097621_1004196832 211
122 3300006844 Ga0075428_100235058 Ga0075428_1002350583 211
123 3300013100 Ga0157373_10485500 Ga0157373_104855001 211
124 3300025915 Ga0207693_10171803 Ga0207693_101718031 211
125 3300025920 Ga0207649_10089399 Ga0207649_100893992 211
126 3300025945 Ga0207679_10392443 Ga0207679_103924432 211
127 3300026095 Ga0207676_10665449 Ga0207676_106654491 211
128 3300049576 Ga0501040_0247710 Ga0501040_0247710_157_861 211
129 3300005435 Ga0070714_100209573 Ga0070714_1002095731 212
130 3300046507 Ga0495606_0037758 Ga0495606_0037758_1842_2525 212
131 3300046530 Ga0495654_0021588 Ga0495654_0021588_1714_2397 212
132 3300046664 Ga0495659_0000122 Ga0495659_0000122_4678_5361 212
133 3300046692 Ga0495671_0000430 Ga0495671_0000430_26948_27631 212
134 3300047320 Ga0495672_0000176 Ga0495672_0000176_64044_64727 212
135 3300049130 Ga0501310_002663 Ga0501310_002663_1004_1687 212
136 3300005328 Ga0070676_10000975 Ga0070676_100009759 213
137 3300005331 Ga0070670_100118242 Ga0070670_1001182421 213
138 3300005333 Ga0070677_10000807 Ga0070677_1000080712 213
139 3300005338 Ga0068868_100005645 Ga0068868_1000056451 213
140 3300005347 Ga0070668_100011053 Ga0070668_1000110535 213
141 3300005354 Ga0070675_100028134 Ga0070675_1000281344 213
142 3300005355 Ga0070671_100002986 Ga0070671_10000298613 213
143 3300005356 Ga0070674_100014547 Ga0070674_1000145475 213
144 3300005364 Ga0070673_100005830 Ga0070673_1000058308 213
145 3300005365 Ga0070688_100204330 Ga0070688_1002043301 213
146 3300005367 Ga0070667_100003537 Ga0070667_10000353714 213
147 3300005367 Ga0070667_100013731 Ga0070667_10001373111 213
148 3300005434 Ga0070709_10001951 Ga0070709_1000195111 213
149 3300005435 Ga0070714_100040356 Ga0070714_1000403565 213
150 3300005436 Ga0070713_100020507 Ga0070713_1000205071 213
151 3300005437 Ga0070710_10036498 Ga0070710_100364983 213
152 3300005455 Ga0070663_100146392 Ga0070663_1001463922 213
153 3300005456 Ga0070678_100001518 Ga0070678_1000015186 213
154 3300005458 Ga0070681_10348590 Ga0070681_103485901 213
155 3300005459 Ga0068867_100008965 Ga0068867_1000089652 213
156 3300005518 Ga0070699_100023002 Ga0070699_1000230026 213
157 3300005530 Ga0070679_100151429 Ga0070679_1001514292 213
158 3300005543 Ga0070672_100002977 Ga0070672_10000297713 213
159 3300005543 Ga0070672_100079170 Ga0070672_1000791704 213
160 3300005546 Ga0070696_100035587 Ga0070696_1000355873 213
161 3300005548 Ga0070665_100001417 Ga0070665_10000141714 213
162 3300005616 Ga0068852_100012670 Ga0068852_1000126708 213
163 3300005617 Ga0068859_100156595 Ga0068859_1001565952 213
164 3300005719 Ga0068861_100307053 Ga0068861_1003070531 213
165 3300005840 Ga0068870_10004919 Ga0068870_100049195 213
166 3300005841 Ga0068863_100036668 Ga0068863_1000366686 213
167 3300005842 Ga0068858_100141381 Ga0068858_1001413812 213
168 3300005843 Ga0068860_100008471 Ga0068860_1000084719 213
169 3300006237 Ga0097621_100005686 Ga0097621_1000056865 213
170 3300006358 Ga0068871_100050572 Ga0068871_1000505721 213
171 3300006931 Ga0097620_100156598 Ga0097620_1001565983 213
172 3300013104 Ga0157370_10026468 Ga0157370_100264681 213
173 3300013307 Ga0157372_10271123 Ga0157372_102711233 213
174 3300013308 Ga0157375_10006021 Ga0157375_100060218 213
175 3300014745 Ga0157377_10451438 Ga0157377_104514381 213
176 3300014969 Ga0157376_10111908 Ga0157376_101119082 213
177 3300025315 Ga0207697_10022631 Ga0207697_100226314 213
178 3300025893 Ga0207682_10000061 Ga0207682_1000006138 213
179 3300025898 Ga0207692_10283412 Ga0207692_102834121 213
180 3300025903 Ga0207680_10286128 Ga0207680_102861281 213
181 3300025906 Ga0207699_10134270 Ga0207699_101342701 213
182 3300025907 Ga0207645_10002609 Ga0207645_100026098 213
183 3300025908 Ga0207643_10005370 Ga0207643_100053709 213
184 3300025909 Ga0207705_10274479 Ga0207705_102744792 213
185 3300025912 Ga0207707_10109658 Ga0207707_101096583 213
186 3300025913 Ga0207695_10039493 Ga0207695_100394935 213
187 3300025917 Ga0207660_10455997 Ga0207660_104559971 213
188 3300025921 Ga0207652_10343166 Ga0207652_103431662 213
189 3300025925 Ga0207650_10183340 Ga0207650_101833402 213
190 3300025926 Ga0207659_10029096 Ga0207659_100290964 213
191 3300025928 Ga0207700_10015613 Ga0207700_100156136 213
192 3300025929 Ga0207664_10009373 Ga0207664_100093737 213
193 3300025931 Ga0207644_10015490 Ga0207644_100154906 213
194 3300025934 Ga0207686_10454499 Ga0207686_104544991 213
195 3300025940 Ga0207691_10000016 Ga0207691_10000016142 213
196 3300025940 Ga0207691_10094699 Ga0207691_100946994 213
197 3300025960 Ga0207651_10020040 Ga0207651_100200405 213
198 3300025972 Ga0207668_10045746 Ga0207668_100457465 213
199 3300025981 Ga0207640_10464380 Ga0207640_104643801 213
200 3300025986 Ga0207658_10251010 Ga0207658_102510102 213
201 3300026023 Ga0207677_10010883 Ga0207677_100108836 213
202 3300026067 Ga0207678_10045920 Ga0207678_100459202 213
203 3300026088 Ga0207641_10047920 Ga0207641_100479204 213
204 3300026089 Ga0207648_10022497 Ga0207648_100224972 213
205 3300026118 Ga0207675_100046380 Ga0207675_1000463806 213
206 3300026121 Ga0207683_10000322 Ga0207683_1000032212 213
207 3300026142 Ga0207698_10093281 Ga0207698_100932815 213
208 3300028379 Ga0268266_10027867 Ga0268266_100278674 213
209 3300028381 Ga0268264_10558636 Ga0268264_105586361 213
210 3300042876 Ga0451577_0002330 Ga0451577_0002330_6630_7313 213
211 3300044712 Ga0453684_0008886 Ga0453684_0008886_14164_14847 213
212 3300044712 Ga0453684_0110465 Ga0453684_0110465_1024_1707 213
213 3300045051 Ga0451576_0002999 Ga0451576_0002999_55_738 213
214 3300045051 Ga0451576_0320270 Ga0451576_0320270_635_1318 213
215 3300026116 Ga0207674_10705792 Ga0207674_107057921 214
216 3300031911 Ga0307412_10376139 Ga0307412_103761392 214
217 3300032005 Ga0307411_10125323 Ga0307411_101253232 214
218 3300046507 Ga0495606_0053060 Ga0495606_0053060_664_1353 214
219 3300046538 Ga0495609_0101809 Ga0495609_0101809_454_1143 214
220 3300046810 Ga0495660_0002980 Ga0495660_0002980_5603_6292 214
221 3300047472 Ga0495686_0009713 Ga0495686_0009713_3508_4197 214
222 iso_pu_bacteria 2887375801 2887377906 214
223 3300005842 Ga0068858_100389535 Ga0068858_1003895351 215
224 3300006195 Ga0075366_10133174 Ga0075366_101331742 215
225 3300025901 Ga0207688_10013116 Ga0207688_100131163 215
226 3300044673 Ga0453683_0086917 Ga0453683_0086917_287_976 215
227 3300045051 Ga0451576_0315382 Ga0451576_0315382_840_1529 215
228 3300049824 Ga0501045_0437962 Ga0501045_0437962_193_909 215
229 3300005331 Ga0070670_100284706 Ga0070670_1002847062 216
230 3300005340 Ga0070689_100669986 Ga0070689_1006699861 216
231 3300005347 Ga0070668_100024428 Ga0070668_1000244283 216
232 3300005364 Ga0070673_100051987 Ga0070673_1000519872 216
233 3300005367 Ga0070667_100237462 Ga0070667_1002374622 216
234 3300005455 Ga0070663_100123186 Ga0070663_1001231861 216
235 3300005457 Ga0070662_100084522 Ga0070662_1000845222 216
236 3300005539 Ga0068853_100400438 Ga0068853_1004004382 216
237 3300005548 Ga0070665_100089954 Ga0070665_1000899543 216
238 3300005578 Ga0068854_100193172 Ga0068854_1001931721 216
239 3300005616 Ga0068852_100147553 Ga0068852_1001475531 216
240 3300005834 Ga0068851_10006873 Ga0068851_100068737 216
241 3300005841 Ga0068863_100670217 Ga0068863_1006702172 216
242 3300006881 Ga0068865_100085048 Ga0068865_1000850482 216
243 3300013306 Ga0163162_10510112 Ga0163162_105101121 216
244 3300025960 Ga0207651_10026974 Ga0207651_100269744 216
245 3300025986 Ga0207658_10105780 Ga0207658_101057803 216
246 3300026041 Ga0207639_10419124 Ga0207639_104191242 216
247 3300026067 Ga0207678_10150957 Ga0207678_101509572 216
248 3300026118 Ga0207675_100143050 Ga0207675_1001430504 216
249 3300026142 Ga0207698_10115819 Ga0207698_101158192 216
250 3300028379 Ga0268266_10142775 Ga0268266_101427752 216
251 3300032002 Ga0307416_100301141 Ga0307416_1003011412 216
252 3300005436 Ga0070713_100214158 Ga0070713_1002141584 217
253 3300006175 Ga0070712_100255614 Ga0070712_1002556141 217
254 3300025915 Ga0207693_10363514 Ga0207693_103635142 217
255 3300025928 Ga0207700_10159423 Ga0207700_101594233 217
256 3300009177 Ga0105248_10860738 Ga0105248_108607381 219
257 3300005329 Ga0070683_100093131 Ga0070683_1000931314 220
258 3300005339 Ga0070660_100100830 Ga0070660_1001008303 220
259 3300005344 Ga0070661_100161304 Ga0070661_1001613044 220
260 3300005345 Ga0070692_10036823 Ga0070692_100368231 220
261 3300005356 Ga0070674_100401046 Ga0070674_1004010461 220
262 3300005366 Ga0070659_100165857 Ga0070659_1001658572 220
263 3300005435 Ga0070714_100738068 Ga0070714_1007380681 220
264 3300005455 Ga0070663_100008281 Ga0070663_1000082812 220
265 3300005455 Ga0070663_100238322 Ga0070663_1002383221 220
266 3300005471 Ga0070698_100589264 Ga0070698_1005892641 220
267 3300005535 Ga0070684_100081329 Ga0070684_1000813294 220
268 3300005539 Ga0068853_100178978 Ga0068853_1001789782 220
269 3300005546 Ga0070696_100064816 Ga0070696_1000648163 220
270 3300005564 Ga0070664_100067175 Ga0070664_1000671753 220
271 3300005577 Ga0068857_100028759 Ga0068857_1000287594 220
272 3300005578 Ga0068854_100021061 Ga0068854_1000210615 220
273 3300005614 Ga0068856_100185290 Ga0068856_1001852902 220
274 3300005616 Ga0068852_100150540 Ga0068852_1001505402 220
275 3300005718 Ga0068866_10000548 Ga0068866_1000054817 220
276 3300005834 Ga0068851_10078478 Ga0068851_100784782 220
277 3300006881 Ga0068865_100138120 Ga0068865_1001381202 220
278 3300009093 Ga0105240_10090143 Ga0105240_100901434 220
279 3300009174 Ga0105241_10004491 Ga0105241_1000449110 220
280 3300009174 Ga0105241_10024851 Ga0105241_100248515 220
281 3300009545 Ga0105237_10304412 Ga0105237_103044123 220
282 3300009551 Ga0105238_10198644 Ga0105238_101986442 220
283 3300010375 Ga0105239_10073547 Ga0105239_100735474 220
284 3300013100 Ga0157373_10024332 Ga0157373_100243324 220
285 3300013100 Ga0157373_10370840 Ga0157373_103708401 220
286 3300013102 Ga0157371_10253857 Ga0157371_102538572 220
287 3300013104 Ga0157370_10279217 Ga0157370_102792171 220
288 3300013105 Ga0157369_10201144 Ga0157369_102011442 220
289 3300013306 Ga0163162_10169699 Ga0163162_101696992 220
290 3300014497 Ga0182008_10082404 Ga0182008_100824042 220
291 3300020069 Ga0197907_10357466 Ga0197907_103574661 220
292 3300020070 Ga0206356_10470992 Ga0206356_104709922 220
293 3300020080 Ga0206350_10016023 Ga0206350_100160231 220
294 3300020081 Ga0206354_10100971 Ga0206354_101009711 220
295 3300020610 Ga0154015_1377351 Ga0154015_13773513 220
296 3300020610 Ga0154015_1531000 Ga0154015_15310001 220
297 3300025321 Ga0207656_10025393 Ga0207656_100253933 220
298 3300025899 Ga0207642_10029855 Ga0207642_100298551 220
299 3300025909 Ga0207705_10085213 Ga0207705_100852134 220
300 3300025912 Ga0207707_10033435 Ga0207707_100334355 220
301 3300025913 Ga0207695_10066294 Ga0207695_100662944 220
302 3300025914 Ga0207671_10283072 Ga0207671_102830723 220
303 3300025919 Ga0207657_10000240 Ga0207657_1000024052 220
304 3300025920 Ga0207649_10069389 Ga0207649_100693891 220
305 3300025921 Ga0207652_10008752 Ga0207652_100087527 220
306 3300025924 Ga0207694_10373780 Ga0207694_103737802 220
307 3300025929 Ga0207664_10508323 Ga0207664_105083232 220
308 3300025932 Ga0207690_10042995 Ga0207690_100429952 220
309 3300025934 Ga0207686_10058449 Ga0207686_100584493 220
310 3300025937 Ga0207669_10125310 Ga0207669_101253102 220
311 3300025942 Ga0207689_10237980 Ga0207689_102379802 220
312 3300025945 Ga0207679_10184331 Ga0207679_101843312 220
313 3300025981 Ga0207640_10023654 Ga0207640_100236544 220
314 3300025981 Ga0207640_10035643 Ga0207640_100356434 220
315 3300026023 Ga0207677_10413495 Ga0207677_104134951 220
316 3300026041 Ga0207639_10047455 Ga0207639_100474554 220
317 3300026067 Ga0207678_10153548 Ga0207678_101535482 220
318 3300026067 Ga0207678_10272028 Ga0207678_102720281 220
319 3300026078 Ga0207702_10028889 Ga0207702_100288895 220
320 3300026089 Ga0207648_10428040 Ga0207648_104280402 220
321 3300026116 Ga0207674_10000237 Ga0207674_1000023732 220
322 3300026142 Ga0207698_10012505 Ga0207698_100125056 220
323 3300026142 Ga0207698_10086819 Ga0207698_100868192 220
324 3300028381 Ga0268264_10395140 Ga0268264_103951402 220
325 3300038443 Ga0395901_0324675 Ga0395901_0324675_485_1237 220
326 3300049570 Ga0501033_0171338 Ga0501033_0171338_172_882 220
327 3300049574 Ga0501038_0445391 Ga0501038_0445391_111_821 220
328 3300049822 Ga0501035_0006955 Ga0501035_0006955_858_1568 220
329 3300049823 Ga0501044_0001056 Ga0501044_0001056_31545_32255 220
330 3300059478 Ga0587093_025330 Ga0587093_025330_19_726 220
331 3300059510 Ga0587090_040772 Ga0587090_040772_11_763 220
332 3300059625 Ga0587113_010239 Ga0587113_010239_57_809 220
333 3300059626 Ga0587115_014942 Ga0587115_014942_250_1002 220
334 3300059630 Ga0587128_026143 Ga0587128_026143_129_881 220
335 3300059641 Ga0587068_031069 Ga0587068_031069_121_873 220
336 3300059644 Ga0587075_017360 Ga0587075_017360_214_966 220
337 3300059646 Ga0587078_016403 Ga0587078_016403_97_804 220
338 3300025909 Ga0207705_10551014 Ga0207705_105510141 221
339 3300005328 Ga0070676_10290665 Ga0070676_102906652 222
340 3300005459 Ga0068867_100026811 Ga0068867_1000268114 222
341 3300031824 Ga0307413_10174906 Ga0307413_101749061 222
342 3300031852 Ga0307410_10191898 Ga0307410_101918982 222
343 3300031911 Ga0307412_10222448 Ga0307412_102224482 222
344 3300031995 Ga0307409_100029964 Ga0307409_1000299642 222
345 3300032004 Ga0307414_10130847 Ga0307414_101308471 222
346 3300032005 Ga0307411_10006056 Ga0307411_100060562 222
347 3300005339 Ga0070660_100014044 Ga0070660_1000140447 223
348 3300005344 Ga0070661_100219051 Ga0070661_1002190513 223
349 3300005366 Ga0070659_100124663 Ga0070659_1001246633 223
350 3300005435 Ga0070714_100009134 Ga0070714_1000091343 223
351 3300005458 Ga0070681_10008601 Ga0070681_1000860110 223
352 3300005530 Ga0070679_100011162 Ga0070679_10001116211 223
353 3300005535 Ga0070684_100042537 Ga0070684_1000425372 223
354 3300005539 Ga0068853_100046600 Ga0068853_1000466003 223
355 3300005563 Ga0068855_100001119 Ga0068855_10000111925 223
356 3300005564 Ga0070664_100000934 Ga0070664_10000093415 223
357 3300005577 Ga0068857_100002116 Ga0068857_10000211620 223
358 3300005578 Ga0068854_100003623 Ga0068854_1000036239 223
359 3300005614 Ga0068856_100006845 Ga0068856_10000684512 223
360 3300005616 Ga0068852_100000768 Ga0068852_1000007688 223
361 3300009093 Ga0105240_10000332 Ga0105240_1000033278 223
362 3300009174 Ga0105241_10044096 Ga0105241_100440963 223
363 3300009551 Ga0105238_10000244 Ga0105238_1000024424 223
364 3300013100 Ga0157373_10051274 Ga0157373_100512743 223
365 3300013102 Ga0157371_10023665 Ga0157371_100236653 223
366 3300013105 Ga0157369_10787895 Ga0157369_107878951 223
367 3300013296 Ga0157374_10215666 Ga0157374_102156662 223
368 3300013307 Ga0157372_10002879 Ga0157372_1000287910 223
369 3300022467 Ga0224712_10100485 Ga0224712_101004852 223
370 3300025909 Ga0207705_10083383 Ga0207705_100833832 223
371 3300025911 Ga0207654_10238568 Ga0207654_102385681 223
372 3300025913 Ga0207695_10111471 Ga0207695_101114712 223
373 3300025920 Ga0207649_10042056 Ga0207649_100420563 223
374 3300025921 Ga0207652_10050689 Ga0207652_100506892 223
375 3300025924 Ga0207694_10171593 Ga0207694_101715932 223
376 3300025929 Ga0207664_10134989 Ga0207664_101349892 223
377 3300025932 Ga0207690_10352325 Ga0207690_103523252 223
378 3300025944 Ga0207661_10145483 Ga0207661_101454833 223
379 3300025945 Ga0207679_10151487 Ga0207679_101514872 223
380 3300025949 Ga0207667_10071924 Ga0207667_100719242 223
381 3300025981 Ga0207640_10056033 Ga0207640_100560333 223
382 3300026041 Ga0207639_10214358 Ga0207639_102143582 223
383 3300026078 Ga0207702_10016093 Ga0207702_100160939 223
384 3300026116 Ga0207674_10006274 Ga0207674_1000627417 223
385 3300026142 Ga0207698_10147089 Ga0207698_101470893 223
386 3300046533 Ga0495640_0211486 Ga0495640_0211486_110_850 223
387 3300005331 Ga0070670_100155446 Ga0070670_1001554464 224
388 3300005335 Ga0070666_10009140 Ga0070666_100091402 224
389 3300005338 Ga0068868_100173623 Ga0068868_1001736232 224
390 3300005347 Ga0070668_100009765 Ga0070668_1000097652 224
391 3300005347 Ga0070668_100092604 Ga0070668_1000926042 224
392 3300005354 Ga0070675_100013624 Ga0070675_1000136246 224
393 3300005355 Ga0070671_100052646 Ga0070671_1000526464 224
394 3300005355 Ga0070671_100297517 Ga0070671_1002975172 224
395 3300005356 Ga0070674_100086827 Ga0070674_1000868272 224
396 3300005364 Ga0070673_100043334 Ga0070673_1000433343 224
397 3300005367 Ga0070667_100267578 Ga0070667_1002675782 224
398 3300005456 Ga0070678_100007823 Ga0070678_1000078234 224
399 3300005457 Ga0070662_100316928 Ga0070662_1003169282 224
400 3300005466 Ga0070685_10225443 Ga0070685_102254431 224
401 3300005543 Ga0070672_100000308 Ga0070672_1000003087 224
402 3300005543 Ga0070672_100039503 Ga0070672_1000395031 224
403 3300005548 Ga0070665_100007532 Ga0070665_1000075326 224
404 3300005618 Ga0068864_100063009 Ga0068864_1000630095 224
405 3300005719 Ga0068861_100207468 Ga0068861_1002074682 224
406 3300005843 Ga0068860_100399763 Ga0068860_1003997632 224
407 3300005844 Ga0068862_100029944 Ga0068862_1000299444 224
408 3300006237 Ga0097621_100072662 Ga0097621_1000726622 224
409 3300009177 Ga0105248_10354239 Ga0105248_103542392 224
410 3300013296 Ga0157374_10807317 Ga0157374_108073171 224
411 3300013297 Ga0157378_10005893 Ga0157378_1000589313 224
412 3300013297 Ga0157378_10137993 Ga0157378_101379932 224
413 3300013306 Ga0163162_10343862 Ga0163162_103438622 224
414 3300013308 Ga0157375_10035555 Ga0157375_100355553 224
415 3300013308 Ga0157375_10068797 Ga0157375_100687973 224
416 3300014325 Ga0163163_10349037 Ga0163163_103490373 224
417 3300014969 Ga0157376_10005464 Ga0157376_100054642 224
418 3300017792 Ga0163161_10038381 Ga0163161_100383813 224
419 3300025901 Ga0207688_10180618 Ga0207688_101806181 224
420 3300025903 Ga0207680_10014384 Ga0207680_100143842 224
421 3300025923 Ga0207681_10024021 Ga0207681_100240216 224
422 3300025926 Ga0207659_10019552 Ga0207659_100195524 224
423 3300025931 Ga0207644_10014416 Ga0207644_100144165 224
424 3300025931 Ga0207644_10103945 Ga0207644_101039452 224
425 3300025933 Ga0207706_10053246 Ga0207706_100532461 224
426 3300025937 Ga0207669_10158948 Ga0207669_101589482 224
427 3300025940 Ga0207691_10000403 Ga0207691_1000040324 224
428 3300025940 Ga0207691_10004470 Ga0207691_1000447015 224
429 3300025941 Ga0207711_10557049 Ga0207711_105570491 224
430 3300025960 Ga0207651_10029467 Ga0207651_100294673 224
431 3300025972 Ga0207668_10111456 Ga0207668_101114562 224
432 3300025972 Ga0207668_10182993 Ga0207668_101829931 224
433 3300026023 Ga0207677_10106146 Ga0207677_101061462 224
434 3300026095 Ga0207676_10047895 Ga0207676_100478955 224
435 3300026118 Ga0207675_100032081 Ga0207675_1000320814 224
436 3300026121 Ga0207683_10005374 Ga0207683_100053747 224
437 3300028379 Ga0268266_10049569 Ga0268266_100495695 224
438 3300028380 Ga0268265_10038952 Ga0268265_100389522 224
439 3300005543 Ga0070672_100023780 Ga0070672_1000237801 225
440 3300005618 Ga0068864_100649693 Ga0068864_1006496931 225
441 3300005842 Ga0068858_100032194 Ga0068858_1000321943 225
442 3300005843 Ga0068860_100353651 Ga0068860_1003536512 225
443 3300013306 Ga0163162_10061410 Ga0163162_100614101 225
444 3300014968 Ga0157379_10136790 Ga0157379_101367902 225
445 3300025900 Ga0207710_10272210 Ga0207710_102722101 225
446 3300025941 Ga0207711_10415327 Ga0207711_104153272 225
447 3300025986 Ga0207658_10017552 Ga0207658_100175526 225
448 3300026089 Ga0207648_10105331 Ga0207648_101053311 225
449 3300026095 Ga0207676_10410373 Ga0207676_104103732 225
450 3300028381 Ga0268264_10351872 Ga0268264_103518722 225
451 3300031238 Ga0265332_10002744 Ga0265332_100027448 225
452 3300031241 Ga0265325_10034431 Ga0265325_100344313 225
453 3300031242 Ga0265329_10022400 Ga0265329_100224002 225
454 3300031250 Ga0265331_10016184 Ga0265331_100161844 225
455 3300031251 Ga0265327_10015235 Ga0265327_100152351 225
456 3300031344 Ga0265316_10297821 Ga0265316_102978211 225
457 3300035084 Ga0373928_0022491 Ga0373928_0022491_99_824 225
458 3300035691 Ga0373931_0044303 Ga0373931_0044303_1338_2063 225
459 3300048904 Ga0496101_0462870 Ga0496101_0462870_54_779 225
460 3300048912 Ga0496109_0408504 Ga0496109_0408504_441_1166 225
461 3300048915 Ga0496112_0026219 Ga0496112_0026219_2667_3392 225
462 3300005353 Ga0070669_100130606 Ga0070669_1001306062 227
463 3300005354 Ga0070675_100030634 Ga0070675_1000306345 227
464 3300005439 Ga0070711_100239915 Ga0070711_1002399153 227
465 3300005457 Ga0070662_100788667 Ga0070662_1007886671 227
466 3300005617 Ga0068859_100302767 Ga0068859_1003027671 227
467 3300005618 Ga0068864_100000740 Ga0068864_1000007405 227
468 3300005841 Ga0068863_100050940 Ga0068863_1000509405 227
469 3300006237 Ga0097621_100456682 Ga0097621_1004566822 227
470 3300006931 Ga0097620_100302747 Ga0097620_1003027472 227
471 3300014325 Ga0163163_10043746 Ga0163163_100437466 227
472 3300025903 Ga0207680_10368882 Ga0207680_103688822 227
473 3300025908 Ga0207643_10190550 Ga0207643_101905502 227
474 3300025925 Ga0207650_10021783 Ga0207650_100217834 227
475 3300025926 Ga0207659_10089151 Ga0207659_100891513 227
476 3300025940 Ga0207691_10005992 Ga0207691_100059924 227
477 3300025972 Ga0207668_10097017 Ga0207668_100970172 227
478 3300026095 Ga0207676_10078201 Ga0207676_100782012 227
479 3300028379 Ga0268266_10277195 Ga0268266_102771952 227
480 3300035170 Ga0373943_0033714 Ga0373943_0033714_868_1611 231
481 3300035171 Ga0373946_0114061 Ga0373946_0114061_336_1109 231
482 3300035695 Ga0373927_0080462 Ga0373927_0080462_894_1640 231
483 3300037068 Ga0373925_0059311 Ga0373925_0059311_406_1152 231
484 3300037068 Ga0373925_0112638 Ga0373925_0112638_1267_2010 231
485 3300046459 Ga0495629_0106737 Ga0495629_0106737_476_1222 231
486 3300046472 Ga0495580_0119055 Ga0495580_0119055_994_1740 231
487 3300046475 Ga0495639_0053629 Ga0495639_0053629_861_1607 231
488 3300046476 Ga0495662_0056805 Ga0495662_0056805_1021_1767 231
489 3300046517 Ga0495630_0083896 Ga0495630_0083896_774_1520 231
490 3300046531 Ga0495665_0010339 Ga0495665_0010339_1022_1768 231
491 3300046543 Ga0495645_0088355 Ga0495645_0088355_609_1355 231
492 3300046663 Ga0495635_0043202 Ga0495635_0043202_1403_2149 231
493 3300046689 Ga0495613_0024468 Ga0495613_0024468_3085_3831 231
494 3300047319 Ga0495674_0491516 Ga0495674_0491516_226_972 231
495 3300047322 Ga0495680_0037414 Ga0495680_0037414_1179_1925 231
496 3300048089 Ga0495614_0012737 Ga0495614_0012737_938_1684 231
497 3300053078 Ga0495612_0017904 Ga0495612_0017904_460_1203 231
498 3300053085 Ga0495619_0005152 Ga0495619_0005152_5876_6622 231
499 3300002074 JGI24748J21848_1012936 JGI24748J21848_10129361 232
500 3300005329 Ga0070683_100081264 Ga0070683_1000812642 232
501 3300005330 Ga0070690_100024054 Ga0070690_1000240543 232
502 3300005331 Ga0070670_100031567 Ga0070670_1000315672 232
503 3300005334 Ga0068869_100087312 Ga0068869_1000873122 232
504 3300005335 Ga0070666_10001239 Ga0070666_1000123916 232
505 3300005336 Ga0070680_100046206 Ga0070680_1000462063 232
506 3300005337 Ga0070682_100069975 Ga0070682_1000699753 232
507 3300005338 Ga0068868_100001857 Ga0068868_1000018579 232
508 3300005339 Ga0070660_100164259 Ga0070660_1001642591 232
509 3300005340 Ga0070689_100003142 Ga0070689_1000031424 232
510 3300005344 Ga0070661_100085770 Ga0070661_1000857701 232
511 3300005345 Ga0070692_10390545 Ga0070692_103905451 232
512 3300005354 Ga0070675_100261794 Ga0070675_1002617942 232
513 3300005355 Ga0070671_100013348 Ga0070671_1000133488 232
514 3300005364 Ga0070673_100005623 Ga0070673_1000056235 232
515 3300005365 Ga0070688_100000458 Ga0070688_1000004589 232
516 3300005366 Ga0070659_100147820 Ga0070659_1001478201 232
517 3300005436 Ga0070713_100002402 Ga0070713_1000024029 232
518 3300005438 Ga0070701_10012622 Ga0070701_100126221 232
519 3300005439 Ga0070711_100003780 Ga0070711_1000037805 232
520 3300005444 Ga0070694_100037166 Ga0070694_1000371663 232
521 3300005445 Ga0070708_100054327 Ga0070708_1000543274 232
522 3300005458 Ga0070681_10217907 Ga0070681_102179073 232
523 3300005466 Ga0070685_10008324 Ga0070685_100083242 232
524 3300005468 Ga0070707_100071004 Ga0070707_1000710042 232
525 3300005518 Ga0070699_100046715 Ga0070699_1000467155 232
526 3300005530 Ga0070679_100046471 Ga0070679_1000464712 232
527 3300005536 Ga0070697_100013500 Ga0070697_1000135007 232
528 3300005539 Ga0068853_100222230 Ga0068853_1002222303 232
529 3300005544 Ga0070686_100040050 Ga0070686_1000400504 232
530 3300005547 Ga0070693_100024807 Ga0070693_1000248074 232
531 3300005548 Ga0070665_100001524 Ga0070665_1000015244 232
532 3300005578 Ga0068854_100029133 Ga0068854_1000291334 232
533 3300005614 Ga0068856_100013862 Ga0068856_1000138626 232
534 3300005617 Ga0068859_100002028 Ga0068859_10000202822 232
535 3300005618 Ga0068864_100000455 Ga0068864_10000045513 232
536 3300005719 Ga0068861_100489192 Ga0068861_1004891921 232
537 3300005841 Ga0068863_100009317 Ga0068863_1000093177 232
538 3300005842 Ga0068858_100000850 Ga0068858_1000008503 232
539 3300006173 Ga0070716_100011269 Ga0070716_1000112692 232
540 3300006175 Ga0070712_100004102 Ga0070712_1000041027 232
541 3300006871 Ga0075434_100110026 Ga0075434_1001100262 232
542 3300006931 Ga0097620_100002027 Ga0097620_10000202722 232
543 3300007076 Ga0075435_100043986 Ga0075435_1000439862 232
544 3300009093 Ga0105240_10090010 Ga0105240_100900102 232
545 3300009098 Ga0105245_10013288 Ga0105245_100132885 232
546 3300009098 Ga0105245_10189531 Ga0105245_101895312 232
547 3300009101 Ga0105247_10029095 Ga0105247_100290955 232
548 3300009177 Ga0105248_10032092 Ga0105248_100320926 232
549 3300009545 Ga0105237_10028957 Ga0105237_100289572 232
550 3300010375 Ga0105239_10092064 Ga0105239_100920642 232
551 3300011119 Ga0105246_10051342 Ga0105246_100513423 232
552 3300011119 Ga0105246_10395288 Ga0105246_103952882 232
553 3300013100 Ga0157373_10019865 Ga0157373_100198651 232
554 3300013104 Ga0157370_10553279 Ga0157370_105532791 232
555 3300013296 Ga0157374_10003271 Ga0157374_100032714 232
556 3300013297 Ga0157378_10064824 Ga0157378_100648242 232
557 3300013306 Ga0163162_10020054 Ga0163162_100200546 232
558 3300013308 Ga0157375_10011902 Ga0157375_100119029 232
559 3300014325 Ga0163163_10000310 Ga0163163_1000031050 232
560 3300014745 Ga0157377_10126571 Ga0157377_101265712 232
561 3300014968 Ga0157379_10000626 Ga0157379_100006266 232
562 3300025903 Ga0207680_10004784 Ga0207680_100047848 232
563 3300025908 Ga0207643_10238416 Ga0207643_102384162 232
564 3300025911 Ga0207654_10129434 Ga0207654_101294341 232
565 3300025912 Ga0207707_10013250 Ga0207707_100132503 232
566 3300025913 Ga0207695_10220565 Ga0207695_102205652 232
567 3300025915 Ga0207693_10000485 Ga0207693_100004856 232
568 3300025915 Ga0207693_10055636 Ga0207693_100556362 232
569 3300025916 Ga0207663_10041522 Ga0207663_100415223 232
570 3300025917 Ga0207660_10114229 Ga0207660_101142292 232
571 3300025918 Ga0207662_10054613 Ga0207662_100546132 232
572 3300025919 Ga0207657_10002577 Ga0207657_1000257711 232
573 3300025925 Ga0207650_10020951 Ga0207650_100209516 232
574 3300025927 Ga0207687_10001442 Ga0207687_1000144216 232
575 3300025927 Ga0207687_10042059 Ga0207687_100420593 232
576 3300025928 Ga0207700_10010411 Ga0207700_100104112 232
577 3300025928 Ga0207700_10036619 Ga0207700_100366191 232
578 3300025929 Ga0207664_10015854 Ga0207664_100158544 232
579 3300025931 Ga0207644_10010849 Ga0207644_100108495 232
580 3300025932 Ga0207690_10166598 Ga0207690_101665983 232
581 3300025939 Ga0207665_10052801 Ga0207665_100528014 232
582 3300025941 Ga0207711_10000115 Ga0207711_1000011555 232
583 3300025942 Ga0207689_10013293 Ga0207689_100132939 232
584 3300025949 Ga0207667_10106771 Ga0207667_101067711 232
585 3300025960 Ga0207651_10000427 Ga0207651_1000042713 232
586 3300025981 Ga0207640_10009888 Ga0207640_100098882 232
587 3300025986 Ga0207658_10027345 Ga0207658_100273452 232
588 3300026023 Ga0207677_10000210 Ga0207677_1000021022 232
589 3300026035 Ga0207703_10000438 Ga0207703_100004386 232
590 3300026041 Ga0207639_10120046 Ga0207639_101200462 232
591 3300026078 Ga0207702_10056716 Ga0207702_100567165 232
592 3300026078 Ga0207702_10461156 Ga0207702_104611562 232
593 3300026088 Ga0207641_10001573 Ga0207641_1000157318 232
594 3300026095 Ga0207676_10000415 Ga0207676_1000041529 232
595 3300026116 Ga0207674_10050952 Ga0207674_100509523 232
596 3300026118 Ga0207675_100272663 Ga0207675_1002726632 232
597 3300028379 Ga0268266_10008005 Ga0268266_100080055 232
598 3300028381 Ga0268264_10001696 Ga0268264_1000169615 232
599 3300035086 Ga0373934_0021469 Ga0373934_0021469_184_924 232
600 3300035113 Ga0373936_0145769 Ga0373936_0145769_175_915 232
601 3300035117 Ga0373953_0097056 Ga0373953_0097056_427_1167 232
602 3300035118 Ga0373954_0003066 Ga0373954_0003066_3597_4337 232
603 3300035119 Ga0373956_0134589 Ga0373956_0134589_36_776 232
604 3300035120 Ga0373957_0003850 Ga0373957_0003850_3260_4000 232
605 3300035172 Ga0373955_0003010 Ga0373955_0003010_5081_5821 232
606 3300035410 Ga0373924_0006705 Ga0373924_0006705_1908_2648 232
607 3300035724 Ga0373933_0015824 Ga0373933_0015824_478_1218 232
608 3300035724 Ga0373933_0026781 Ga0373933_0026781_1461_2201 232
609 3300035725 Ga0373947_0032374 Ga0373947_0032374_922_1662 232
610 3300036401 Ga0373937_0009175 Ga0373937_0009175_3046_3786 232
611 3300036401 Ga0373937_0024904 Ga0373937_0024904_1254_1994 232
612 3300046462 Ga0495651_0360249 Ga0495651_0360249_84_824 232
613 3300046499 Ga0495594_0097429 Ga0495594_0097429_701_1447 232
614 3300046679 Ga0495623_0059055 Ga0495623_0059055_965_1705 232
615 3300047444 Ga0495675_0079181 Ga0495675_0079181_604_1344 232
616 3300047471 Ga0495684_0039104 Ga0495684_0039104_176_922 232
617 3300048088 Ga0495602_0219067 Ga0495602_0219067_67_807 232
618 3300048903 Ga0496100_0064502 Ga0496100_0064502_372_1112 232
619 3300048904 Ga0496101_0010694 Ga0496101_0010694_3153_3893 232
620 3300048907 Ga0496104_0023522 Ga0496104_0023522_4873_5613 232
621 3300048908 Ga0496105_0019861 Ga0496105_0019861_4641_5381 232
622 3300048909 Ga0496106_0101829 Ga0496106_0101829_434_1180 232
623 3300048912 Ga0496109_0020289 Ga0496109_0020289_458_1198 232
624 3300048913 Ga0496110_0137917 Ga0496110_0137917_222_962 232
625 3300048915 Ga0496112_0002173 Ga0496112_0002173_2539_3279 232
626 3300048915 Ga0496112_0154404 Ga0496112_0154404_22_768 232
627 3300048917 Ga0496114_0028308 Ga0496114_0028308_3243_3983 232
628 3300050513 nmdc:mga0rr50_88706_c1 nmdc:mga0rr50_88706_c1_343_1083 232
629 3300050514 nmdc:mga08x19_49289_c1 nmdc:mga08x19_49289_c1_1007_1756 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

39

242

0.88

Feature Viewer

pLDDT pTM Quality
67.2 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map