F470780
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 629 | 301 | 608 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300049766|Ga0501269_005691|Ga0501269_005691_205_1002 |
| Length | 265 |
| Sequence | VRSITKNFFENGGNNMGRFSGKVALVTGASSGLGAATALRLAAEGAQVFGIARNAEGLRAVQEQAQQSGGIIATASIDVGQPQQCAQAVRDCVAKFGRLDALINVAGRHDFRHTPSVTEQQWLQDLAVNLNGPFFLSQAAIPHLLEAHGNIVNVASIAGLQGQPYSAAYCSAKHGLLGLTKALAMEYMKAPLRVNAIVPGGMDTPQVQNIQIPPDVDFDLVMRSAAPRGFMHVDDVAALIAFLASDEAKAVHGSIQVIDNGKTVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 3 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 6 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 7 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 8 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 9 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 10 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 11 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 12 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 13 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 14 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 15 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 16 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 17 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 18 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 19 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 20 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 21 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 22 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 25 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 28 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 29 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 196 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 199 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 202 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 203 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 246 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 247 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 248 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 249 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 250 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 251 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 277 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 285 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 286 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 287 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 292 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 293 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 294 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 297 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 298 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 300 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 301 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.66 |
| Metatranscriptomes | 0 |
| Isolates | 3.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.94 |
| Nodule | 0.16 |
| Rhizoplane | 10.65 |
| Rhizosphere | 64.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1008134 | 3300000546 | Bacteria | 1129 |
| 2 | JGI24737J22298_10072145 | 3300001990 | Bacteria | 1030 |
| 3 | JGI24743J22301_10031981 | 3300001991 | Bacteria | 1038 |
| 4 | JGI24738J21930_10033576 | 3300002075 | Bacteria | 1046 |
| 5 | JGI24749J21850_1014986 | 3300002076 | Bacteria | 1087 |
| 6 | JGI24744J21845_10002400 | 3300002077 | Bacteria | 3821 |
| 7 | JGI24744J21845_10013718 | 3300002077 | Bacteria | 1633 |
| 8 | JGI24034J26672_10001885 | 3300002239 | Bacteria | 2832 |
| 9 | JGI24742J22300_10015242 | 3300002244 | Bacteria | 1293 |
| 10 | JGI25165J46597_1000526 | 3300003214 | Bacteria | 35868 |
| 11 | rootH2_10127436 | 3300003320 | Bacteria | 3729 |
| 12 | Ga0055540_1002937 | 3300003792 | Bacteria | 8582 |
| 13 | Ga0055540_1004066 | 3300003792 | Bacteria | 6783 |
| 14 | Ga0065707_10090393 | 3300005295 | Unclassified | 4138 |
| 15 | Ga0070676_10091353 | 3300005328 | Bacteria | 1865 |
| 16 | Ga0070683_100436637 | 3300005329 | Bacteria | 1249 |
| 17 | Ga0070690_100007865 | 3300005330 | Bacteria | 6115 |
| 18 | Ga0070690_100117761 | 3300005330 | Bacteria | 1780 |
| 19 | Ga0070670_100000017 | 3300005331 | Bacteria | 224429 |
| 20 | Ga0070670_100686103 | 3300005331 | Bacteria | 920 |
| 21 | Ga0070677_10020264 | 3300005333 | Bacteria | 2420 |
| 22 | Ga0068869_100053124 | 3300005334 | Bacteria | 2944 |
| 23 | Ga0070666_10237220 | 3300005335 | Bacteria | 1289 |
| 24 | Ga0070680_100319953 | 3300005336 | Bacteria | 1317 |
| 25 | Ga0070682_100045732 | 3300005337 | Bacteria | 2715 |
| 26 | Ga0070682_100094360 | 3300005337 | Bacteria | 1963 |
| 27 | Ga0068868_100090357 | 3300005338 | Bacteria | 2466 |
| 28 | Ga0068868_100123106 | 3300005338 | Bacteria | 2116 |
| 29 | Ga0070689_100017204 | 3300005340 | Bacteria | 5306 |
| 30 | Ga0070692_10056348 | 3300005345 | Bacteria | 2058 |
| 31 | Ga0070668_100000348 | 3300005347 | Bacteria | 30448 |
| 32 | Ga0070668_100007133 | 3300005347 | Bacteria | 8281 |
| 33 | Ga0070668_100395599 | 3300005347 | Bacteria | 1179 |
| 34 | Ga0070669_100000420 | 3300005353 | Bacteria | 32410 |
| 35 | Ga0070669_100002285 | 3300005353 | Bacteria | 13896 |
| 36 | Ga0070669_100263965 | 3300005353 | Bacteria | 1375 |
| 37 | Ga0070675_100134685 | 3300005354 | Bacteria | 2108 |
| 38 | Ga0070671_100000173 | 3300005355 | Bacteria | 42660 |
| 39 | Ga0070671_100011926 | 3300005355 | Bacteria | 6991 |
| 40 | Ga0070674_100068165 | 3300005356 | Bacteria | 2505 |
| 41 | Ga0070674_100074076 | 3300005356 | Bacteria | 2415 |
| 42 | Ga0070673_100237947 | 3300005364 | Bacteria | 1582 |
| 43 | Ga0070688_100001099 | 3300005365 | Bacteria | 13504 |
| 44 | Ga0070688_100016522 | 3300005365 | Bacteria | 4221 |
| 45 | Ga0070688_100070898 | 3300005365 | Bacteria | 2230 |
| 46 | Ga0070659_100052685 | 3300005366 | Bacteria | 3201 |
| 47 | Ga0070667_100000033 | 3300005367 | Bacteria | 175463 |
| 48 | Ga0070667_100000203 | 3300005367 | Bacteria | 70031 |
| 49 | Ga0070667_100002627 | 3300005367 | Bacteria | 15564 |
| 50 | Ga0070667_100059843 | 3300005367 | Bacteria | 3223 |
| 51 | Ga0070667_100345141 | 3300005367 | Bacteria | 1347 |
| 52 | Ga0070709_10025899 | 3300005434 | Bacteria | 3469 |
| 53 | Ga0070714_100081655 | 3300005435 | Bacteria | 2815 |
| 54 | Ga0070714_100088977 | 3300005435 | Bacteria | 2702 |
| 55 | Ga0070714_100200572 | 3300005435 | Bacteria | 1825 |
| 56 | Ga0070714_100239670 | 3300005435 | Bacteria | 1674 |
| 57 | Ga0070714_100406900 | 3300005435 | Bacteria | 1287 |
| 58 | Ga0070710_10007428 | 3300005437 | Bacteria | 5307 |
| 59 | Ga0070710_10021899 | 3300005437 | Bacteria | 3336 |
| 60 | Ga0070701_10047826 | 3300005438 | Bacteria | 2204 |
| 61 | Ga0070711_100002238 | 3300005439 | Bacteria | 10973 |
| 62 | Ga0070711_100004016 | 3300005439 | Bacteria | 8650 |
| 63 | Ga0070705_100049195 | 3300005440 | Bacteria | 2446 |
| 64 | Ga0070705_100118242 | 3300005440 | Bacteria | 1707 |
| 65 | Ga0070705_100712886 | 3300005440 | Unclassified | 789 |
| 66 | Ga0070700_100272454 | 3300005441 | Bacteria | 1224 |
| 67 | Ga0070694_100076135 | 3300005444 | Bacteria | 2323 |
| 68 | Ga0070708_100390236 | 3300005445 | Bacteria | 1313 |
| 69 | Ga0070708_100564515 | 3300005445 | Bacteria | 1073 |
| 70 | Ga0070663_100054078 | 3300005455 | Bacteria | 2868 |
| 71 | Ga0070663_100159134 | 3300005455 | Bacteria | 1737 |
| 72 | Ga0070678_100046926 | 3300005456 | Bacteria | 3101 |
| 73 | Ga0070662_100062999 | 3300005457 | Bacteria | 2711 |
| 74 | Ga0070662_100090947 | 3300005457 | Bacteria | 2291 |
| 75 | Ga0068867_100192197 | 3300005459 | Bacteria | 1629 |
| 76 | Ga0070685_10000026 | 3300005466 | Bacteria | 98490 |
| 77 | Ga0070707_100517552 | 3300005468 | Bacteria | 1155 |
| 78 | Ga0068853_100000449 | 3300005539 | Bacteria | 28008 |
| 79 | Ga0068853_100066470 | 3300005539 | Bacteria | 3131 |
| 80 | Ga0070672_100040375 | 3300005543 | Bacteria | 3580 |
| 81 | Ga0070672_100082638 | 3300005543 | Bacteria | 2577 |
| 82 | Ga0070686_100081292 | 3300005544 | Bacteria | 2146 |
| 83 | Ga0070695_100010836 | 3300005545 | Bacteria | 5446 |
| 84 | Ga0070696_100004414 | 3300005546 | Bacteria | 9388 |
| 85 | Ga0070696_100068171 | 3300005546 | Bacteria | 2497 |
| 86 | Ga0070665_100001836 | 3300005548 | Bacteria | 24110 |
| 87 | Ga0070665_100005426 | 3300005548 | Bacteria | 13151 |
| 88 | Ga0070665_100038520 | 3300005548 | Bacteria | 4806 |
| 89 | Ga0070665_100106305 | 3300005548 | Bacteria | 2808 |
| 90 | Ga0070665_100667937 | 3300005548 | Bacteria | 1052 |
| 91 | Ga0070704_100001044 | 3300005549 | Bacteria | 14300 |
| 92 | Ga0070704_100618410 | 3300005549 | Bacteria | 953 |
| 93 | Ga0068855_100242569 | 3300005563 | Bacteria | 2013 |
| 94 | Ga0068854_100000321 | 3300005578 | Bacteria | 31597 |
| 95 | Ga0068854_100534239 | 3300005578 | Bacteria | 992 |
| 96 | Ga0068856_100094734 | 3300005614 | Bacteria | 2973 |
| 97 | Ga0068856_100821137 | 3300005614 | Bacteria | 949 |
| 98 | Ga0070702_100173446 | 3300005615 | Bacteria | 1405 |
| 99 | Ga0068852_100096733 | 3300005616 | Bacteria | 2654 |
| 100 | Ga0068859_100016348 | 3300005617 | Bacteria | 7454 |
| 101 | Ga0068859_100092049 | 3300005617 | Bacteria | 3083 |
| 102 | Ga0068859_100413498 | 3300005617 | Bacteria | 1445 |
| 103 | Ga0068864_100000029 | 3300005618 | Bacteria | 224429 |
| 104 | Ga0068866_10009653 | 3300005718 | Bacteria | 4106 |
| 105 | Ga0068866_10018060 | 3300005718 | Bacteria | 3184 |
| 106 | Ga0068861_100051568 | 3300005719 | Bacteria | 3123 |
| 107 | Ga0068870_10057947 | 3300005840 | Bacteria | 2073 |
| 108 | Ga0068863_100000193 | 3300005841 | Bacteria | 64832 |
| 109 | Ga0068863_100001954 | 3300005841 | Bacteria | 20472 |
| 110 | Ga0068863_100030472 | 3300005841 | Bacteria | 5151 |
| 111 | Ga0068858_100043939 | 3300005842 | Bacteria | 4143 |
| 112 | Ga0068858_100074999 | 3300005842 | Bacteria | 3141 |
| 113 | Ga0068858_100129475 | 3300005842 | Unclassified | 2365 |
| 114 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 115 | Ga0068860_100010618 | 3300005843 | Bacteria | 9094 |
| 116 | Ga0068860_100039508 | 3300005843 | Unclassified | 4513 |
| 117 | Ga0068860_100049331 | 3300005843 | Bacteria | 4009 |
| 118 | Ga0068862_100000205 | 3300005844 | Bacteria | 65575 |
| 119 | Ga0068862_100018287 | 3300005844 | Bacteria | 5837 |
| 120 | Ga0068862_100145357 | 3300005844 | Bacteria | 2107 |
| 121 | Ga0081455_10164274 | 3300005937 | Bacteria | 1698 |
| 122 | Ga0075365_10013585 | 3300006038 | Bacteria | 4878 |
| 123 | Ga0075365_10018705 | 3300006038 | Bacteria | 4266 |
| 124 | Ga0075365_10031171 | 3300006038 | Bacteria | 3419 |
| 125 | Ga0075365_10039796 | 3300006038 | Bacteria | 3063 |
| 126 | Ga0075365_10055298 | 3300006038 | Bacteria | 2634 |
| 127 | Ga0075365_10066709 | 3300006038 | Bacteria | 2415 |
| 128 | Ga0075365_10071417 | 3300006038 | Bacteria | 2337 |
| 129 | Ga0075365_10126683 | 3300006038 | Bacteria | 1765 |
| 130 | Ga0075368_10024160 | 3300006042 | Bacteria | 2326 |
| 131 | Ga0075363_100000554 | 3300006048 | Bacteria | 12187 |
| 132 | Ga0075363_100003560 | 3300006048 | Bacteria | 6655 |
| 133 | Ga0075363_100011065 | 3300006048 | Bacteria | 4309 |
| 134 | Ga0075363_100022370 | 3300006048 | Bacteria | 3195 |
| 135 | Ga0075363_100104347 | 3300006048 | Bacteria | 1571 |
| 136 | Ga0075364_10001678 | 3300006051 | Bacteria | 12156 |
| 137 | Ga0075364_10004508 | 3300006051 | Bacteria | 8022 |
| 138 | Ga0075364_10019518 | 3300006051 | Bacteria | 4256 |
| 139 | Ga0075364_10024634 | 3300006051 | Bacteria | 3823 |
| 140 | Ga0075364_10051813 | 3300006051 | Bacteria | 2681 |
| 141 | Ga0075432_10014978 | 3300006058 | Bacteria | 2643 |
| 142 | Ga0070715_10012635 | 3300006163 | Bacteria | 3080 |
| 143 | Ga0070716_100024724 | 3300006173 | Bacteria | 3199 |
| 144 | Ga0070716_100086409 | 3300006173 | Bacteria | 1886 |
| 145 | Ga0070712_100000234 | 3300006175 | Bacteria | 31041 |
| 146 | Ga0070712_100018426 | 3300006175 | Bacteria | 4535 |
| 147 | Ga0070712_100218577 | 3300006175 | Bacteria | 1507 |
| 148 | Ga0075362_10008677 | 3300006177 | Bacteria | 3902 |
| 149 | Ga0075362_10046645 | 3300006177 | Bacteria | 1928 |
| 150 | Ga0075367_10000654 | 3300006178 | Bacteria | 13274 |
| 151 | Ga0075367_10059805 | 3300006178 | Bacteria | 2270 |
| 152 | Ga0075367_10254894 | 3300006178 | Bacteria | 1101 |
| 153 | Ga0075369_10005335 | 3300006186 | Bacteria | 4792 |
| 154 | Ga0075369_10008693 | 3300006186 | Bacteria | 3919 |
| 155 | Ga0075369_10054688 | 3300006186 | Bacteria | 1733 |
| 156 | Ga0075369_10068485 | 3300006186 | Bacteria | 1560 |
| 157 | Ga0075369_10095053 | 3300006186 | Bacteria | 1332 |
| 158 | Ga0097621_100049630 | 3300006237 | Bacteria | 3410 |
| 159 | Ga0075370_10002494 | 3300006353 | Bacteria | 8543 |
| 160 | Ga0075370_10009607 | 3300006353 | Bacteria | 5031 |
| 161 | Ga0075370_10023151 | 3300006353 | Bacteria | 3419 |
| 162 | Ga0068871_100077502 | 3300006358 | Bacteria | 2747 |
| 163 | Ga0075430_100050818 | 3300006846 | Bacteria | 3494 |
| 164 | Ga0068865_100000092 | 3300006881 | Bacteria | 47619 |
| 165 | Ga0097620_100016348 | 3300006931 | Bacteria | 7454 |
| 166 | Ga0097620_100092043 | 3300006931 | Bacteria | 3083 |
| 167 | Ga0097620_100413433 | 3300006931 | Bacteria | 1445 |
| 168 | Ga0105240_10376953 | 3300009093 | Bacteria | 1603 |
| 169 | Ga0105245_10000740 | 3300009098 | Bacteria | 29493 |
| 170 | Ga0105247_10000082 | 3300009101 | Bacteria | 106460 |
| 171 | Ga0105247_10000501 | 3300009101 | Bacteria | 32252 |
| 172 | Ga0105247_10023229 | 3300009101 | Unclassified | 3736 |
| 173 | Ga0105247_10089294 | 3300009101 | Bacteria | 1954 |
| 174 | Ga0114129_10307259 | 3300009147 | Bacteria | 2112 |
| 175 | Ga0105243_10000869 | 3300009148 | Bacteria | 28571 |
| 176 | Ga0105243_10064558 | 3300009148 | Bacteria | 2938 |
| 177 | Ga0105241_10512481 | 3300009174 | Bacteria | 1071 |
| 178 | Ga0105242_10014536 | 3300009176 | Bacteria | 6099 |
| 179 | Ga0105242_10034802 | 3300009176 | Bacteria | 4038 |
| 180 | Ga0105248_10000084 | 3300009177 | Bacteria | 110380 |
| 181 | Ga0105248_10010522 | 3300009177 | Bacteria | 10190 |
| 182 | Ga0105248_10126492 | 3300009177 | Bacteria | 2882 |
| 183 | Ga0105237_10054571 | 3300009545 | Bacteria | 4004 |
| 184 | Ga0105237_10073970 | 3300009545 | Bacteria | 3399 |
| 185 | Ga0105237_10226491 | 3300009545 | Bacteria | 1870 |
| 186 | Ga0105237_10541311 | 3300009545 | Bacteria | 1171 |
| 187 | Ga0105249_10000285 | 3300009553 | Bacteria | 52372 |
| 188 | Ga0105249_10000664 | 3300009553 | Bacteria | 31235 |
| 189 | Ga0105249_10038581 | 3300009553 | Unclassified | 4335 |
| 190 | Ga0105239_10010411 | 3300010375 | Bacteria | 10404 |
| 191 | Ga0105239_10169471 | 3300010375 | Bacteria | 2441 |
| 192 | Ga0157371_10427291 | 3300013102 | Bacteria | 972 |
| 193 | Ga0157369_10180450 | 3300013105 | Bacteria | 2221 |
| 194 | Ga0157378_10007450 | 3300013297 | Bacteria | 9563 |
| 195 | Ga0157378_10049650 | 3300013297 | Bacteria | 3733 |
| 196 | Ga0163162_10070587 | 3300013306 | Bacteria | 3544 |
| 197 | Ga0163162_10080920 | 3300013306 | Bacteria | 3317 |
| 198 | Ga0163162_10210245 | 3300013306 | Bacteria | 2075 |
| 199 | Ga0157372_10007741 | 3300013307 | Bacteria | 11413 |
| 200 | Ga0163163_10001823 | 3300014325 | Bacteria | 17986 |
| 201 | Ga0163163_10007947 | 3300014325 | Bacteria | 9381 |
| 202 | Ga0157380_10007088 | 3300014326 | Bacteria | 7938 |
| 203 | Ga0157380_10025390 | 3300014326 | Bacteria | 4493 |
| 204 | Ga0157379_10020946 | 3300014968 | Bacteria | 5786 |
| 205 | Ga0157379_10031502 | 3300014968 | Bacteria | 4724 |
| 206 | Ga0157376_10031561 | 3300014969 | Bacteria | 4245 |
| 207 | Ga0163161_10031883 | 3300017792 | Bacteria | 3758 |
| 208 | Ga0163161_10087319 | 3300017792 | Bacteria | 2304 |
| 209 | Ga0163161_10596108 | 3300017792 | Bacteria | 910 |
| 210 | Ga0209233_1000281 | 3300025261 | Bacteria | 70619 |
| 211 | Ga0209673_1043491 | 3300025273 | Bacteria | 1253 |
| 212 | Ga0209051_1000569 | 3300025303 | Bacteria | 44797 |
| 213 | Ga0209051_1006132 | 3300025303 | Bacteria | 6835 |
| 214 | Ga0209051_1009513 | 3300025303 | Bacteria | 5001 |
| 215 | Ga0209051_1011492 | 3300025303 | Bacteria | 4365 |
| 216 | Ga0209051_1018781 | 3300025303 | Bacteria | 3044 |
| 217 | Ga0207696_1036209 | 3300025711 | Bacteria | 1465 |
| 218 | Ga0207692_10007185 | 3300025898 | Bacteria | 4551 |
| 219 | Ga0207642_10074826 | 3300025899 | Bacteria | 1624 |
| 220 | Ga0207642_10232949 | 3300025899 | Bacteria | 1036 |
| 221 | Ga0207710_10000263 | 3300025900 | Bacteria | 43581 |
| 222 | Ga0207710_10143351 | 3300025900 | Bacteria | 1155 |
| 223 | Ga0207710_10170096 | 3300025900 | Bacteria | 1065 |
| 224 | Ga0207688_10001118 | 3300025901 | Bacteria | 13776 |
| 225 | Ga0207688_10002079 | 3300025901 | Bacteria | 10764 |
| 226 | Ga0207647_10058688 | 3300025904 | Bacteria | 2356 |
| 227 | Ga0207699_10117847 | 3300025906 | Bacteria | 1712 |
| 228 | Ga0207699_10143443 | 3300025906 | Bacteria | 1572 |
| 229 | Ga0207699_10182004 | 3300025906 | Bacteria | 1413 |
| 230 | Ga0207645_10047049 | 3300025907 | Bacteria | 2755 |
| 231 | Ga0207693_10000356 | 3300025915 | Bacteria | 41988 |
| 232 | Ga0207693_10002084 | 3300025915 | Bacteria | 17484 |
| 233 | Ga0207693_10160377 | 3300025915 | Bacteria | 1769 |
| 234 | Ga0207663_10037154 | 3300025916 | Bacteria | 2934 |
| 235 | Ga0207663_10060366 | 3300025916 | Bacteria | 2403 |
| 236 | Ga0207660_10283338 | 3300025917 | Bacteria | 1316 |
| 237 | Ga0207662_10082901 | 3300025918 | Bacteria | 1959 |
| 238 | Ga0207681_10072281 | 3300025923 | Bacteria | 2409 |
| 239 | Ga0207681_10075326 | 3300025923 | Bacteria | 2366 |
| 240 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 241 | Ga0207687_10002709 | 3300025927 | Bacteria | 11986 |
| 242 | Ga0207687_10056680 | 3300025927 | Bacteria | 2749 |
| 243 | Ga0207664_10036724 | 3300025929 | Bacteria | 3787 |
| 244 | Ga0207664_10114519 | 3300025929 | Bacteria | 2247 |
| 245 | Ga0207644_10000057 | 3300025931 | Bacteria | 83320 |
| 246 | Ga0207644_10017532 | 3300025931 | Bacteria | 4837 |
| 247 | Ga0207690_10068559 | 3300025932 | Bacteria | 2438 |
| 248 | Ga0207706_10059222 | 3300025933 | Bacteria | 3373 |
| 249 | Ga0207706_10089356 | 3300025933 | Bacteria | 2708 |
| 250 | Ga0207686_10347776 | 3300025934 | Bacteria | 1115 |
| 251 | Ga0207709_10002697 | 3300025935 | Bacteria | 10980 |
| 252 | Ga0207670_10030495 | 3300025936 | Bacteria | 3446 |
| 253 | Ga0207669_10001194 | 3300025937 | Bacteria | 11040 |
| 254 | Ga0207669_10033173 | 3300025937 | Bacteria | 2910 |
| 255 | Ga0207669_10068882 | 3300025937 | Bacteria | 2212 |
| 256 | Ga0207704_10000278 | 3300025938 | Bacteria | 24597 |
| 257 | Ga0207704_10041624 | 3300025938 | Bacteria | 2696 |
| 258 | Ga0207665_10004039 | 3300025939 | Bacteria | 9800 |
| 259 | Ga0207665_10059921 | 3300025939 | Bacteria | 2577 |
| 260 | Ga0207691_10066489 | 3300025940 | Bacteria | 3261 |
| 261 | Ga0207691_10171417 | 3300025940 | Bacteria | 1900 |
| 262 | Ga0207711_10018990 | 3300025941 | Bacteria | 5719 |
| 263 | Ga0207711_10100343 | 3300025941 | Bacteria | 2560 |
| 264 | Ga0207661_10404055 | 3300025944 | Bacteria | 1239 |
| 265 | Ga0207651_10386070 | 3300025960 | Bacteria | 1188 |
| 266 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 267 | Ga0207712_10006873 | 3300025961 | Bacteria | 7182 |
| 268 | Ga0207712_10127585 | 3300025961 | Bacteria | 1934 |
| 269 | Ga0207712_10382346 | 3300025961 | Bacteria | 1179 |
| 270 | Ga0207668_10004370 | 3300025972 | Bacteria | 8299 |
| 271 | Ga0207668_10049188 | 3300025972 | Bacteria | 2896 |
| 272 | Ga0207640_10002672 | 3300025981 | Bacteria | 9537 |
| 273 | Ga0207640_10738039 | 3300025981 | Bacteria | 848 |
| 274 | Ga0207658_10000012 | 3300025986 | Bacteria | 224402 |
| 275 | Ga0207658_10004621 | 3300025986 | Bacteria | 9544 |
| 276 | Ga0207658_10143183 | 3300025986 | Bacteria | 1938 |
| 277 | Ga0207658_10220708 | 3300025986 | Bacteria | 1594 |
| 278 | Ga0207677_10047312 | 3300026023 | Bacteria | 2887 |
| 279 | Ga0207677_10170296 | 3300026023 | Bacteria | 1702 |
| 280 | Ga0207703_10006423 | 3300026035 | Bacteria | 9396 |
| 281 | Ga0207703_10052060 | 3300026035 | Bacteria | 3322 |
| 282 | Ga0207639_10007999 | 3300026041 | Bacteria | 7223 |
| 283 | Ga0207639_10038315 | 3300026041 | Bacteria | 3565 |
| 284 | Ga0207678_10021353 | 3300026067 | Bacteria | 5677 |
| 285 | Ga0207678_10063197 | 3300026067 | Bacteria | 3181 |
| 286 | Ga0207678_10071676 | 3300026067 | Bacteria | 2971 |
| 287 | Ga0207708_10006811 | 3300026075 | Bacteria | 8451 |
| 288 | Ga0207708_10056912 | 3300026075 | Bacteria | 2983 |
| 289 | Ga0207641_10000437 | 3300026088 | Bacteria | 47860 |
| 290 | Ga0207641_10046029 | 3300026088 | Bacteria | 3677 |
| 291 | Ga0207648_10002398 | 3300026089 | Bacteria | 20182 |
| 292 | Ga0207648_10087560 | 3300026089 | Bacteria | 2718 |
| 293 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 294 | Ga0207676_10519029 | 3300026095 | Bacteria | 1134 |
| 295 | Ga0207675_100000056 | 3300026118 | Bacteria | 82104 |
| 296 | Ga0207683_10000129 | 3300026121 | Bacteria | 61989 |
| 297 | Ga0207683_10062106 | 3300026121 | Bacteria | 3290 |
| 298 | Ga0207698_10085929 | 3300026142 | Bacteria | 2556 |
| 299 | Ga0207698_10130814 | 3300026142 | Bacteria | 2144 |
| 300 | Ga0209813_10020789 | 3300027866 | Bacteria | 1840 |
| 301 | Ga0268266_10002129 | 3300028379 | Bacteria | 21849 |
| 302 | Ga0268266_10027584 | 3300028379 | Bacteria | 4828 |
| 303 | Ga0268266_10242975 | 3300028379 | Bacteria | 1662 |
| 304 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 305 | Ga0268265_10001254 | 3300028380 | Bacteria | 21916 |
| 306 | Ga0268265_10038009 | 3300028380 | Bacteria | 3537 |
| 307 | Ga0268265_10155319 | 3300028380 | Bacteria | 1935 |
| 308 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 309 | Ga0268264_10000009 | 3300028381 | Bacteria | 724972 |
| 310 | Ga0268264_10012661 | 3300028381 | Bacteria | 6944 |
| 311 | Ga0307515_10042265 | 3300028794 | Bacteria | 7138 |
| 312 | Ga0307511_10006269 | 3300030521 | Bacteria | 11992 |
| 313 | Ga0265327_10000096 | 3300031251 | Bacteria | 193827 |
| 314 | Ga0265327_10009796 | 3300031251 | Bacteria | 6850 |
| 315 | Ga0307509_10210238 | 3300031507 | Bacteria | 1771 |
| 316 | Ga0307508_10019359 | 3300031616 | Bacteria | 6186 |
| 317 | Ga0307413_10099262 | 3300031824 | Bacteria | 1919 |
| 318 | Ga0307413_10545307 | 3300031824 | Bacteria | 940 |
| 319 | Ga0307410_10062385 | 3300031852 | Bacteria | 2554 |
| 320 | Ga0307406_10215058 | 3300031901 | Bacteria | 1425 |
| 321 | Ga0307406_10233557 | 3300031901 | Bacteria | 1375 |
| 322 | Ga0307406_10343322 | 3300031901 | Bacteria | 1164 |
| 323 | Ga0307406_10381700 | 3300031901 | Bacteria | 1111 |
| 324 | Ga0307409_100090124 | 3300031995 | Bacteria | 2509 |
| 325 | Ga0307409_100719856 | 3300031995 | Bacteria | 999 |
| 326 | Ga0307416_100162348 | 3300032002 | Bacteria | 2067 |
| 327 | Ga0307411_10217531 | 3300032005 | Bacteria | 1480 |
| 328 | Ga0373936_0003434 | 3300035113 | Bacteria | 5941 |
| 329 | Ga0373936_0011941 | 3300035113 | Bacteria | 3297 |
| 330 | Ga0373960_0035804 | 3300035121 | Bacteria | 1411 |
| 331 | Ga0436365_0954943 | 3300039437 | Bacteria | 17007 |
| 332 | Ga0439461_0029022 | 3300041410 | Bacteria | 1142 |
| 333 | Ga0439466_0002371 | 3300041411 | Bacteria | 7381 |
| 334 | Ga0439466_0072809 | 3300041411 | Bacteria | 1092 |
| 335 | Ga0439465_0003768 | 3300041413 | Bacteria | 4947 |
| 336 | Ga0439465_0024150 | 3300041413 | Bacteria | 1915 |
| 337 | Ga0439465_0040827 | 3300041413 | Bacteria | 1500 |
| 338 | Ga0439431_0005261 | 3300041997 | Bacteria | 2854 |
| 339 | Ga0439442_002853 | 3300042002 | Bacteria | 3400 |
| 340 | Ga0439445_0000932 | 3300042004 | Bacteria | 6212 |
| 341 | Ga0439445_0013049 | 3300042004 | Bacteria | 2006 |
| 342 | Ga0439434_0018676 | 3300042435 | Bacteria | 2077 |
| 343 | Ga0466972_0042893 | 3300044658 | Bacteria | 2198 |
| 344 | Ga0466972_0057636 | 3300044658 | Bacteria | 1865 |
| 345 | Ga0466972_0109485 | 3300044658 | Bacteria | 1305 |
| 346 | Ga0466972_0160989 | 3300044658 | Bacteria | 1054 |
| 347 | Ga0466965_0000815 | 3300044683 | Bacteria | 11764 |
| 348 | Ga0466965_0163961 | 3300044683 | Bacteria | 1166 |
| 349 | Ga0466966_0015836 | 3300044684 | Bacteria | 4982 |
| 350 | Ga0466966_0058415 | 3300044684 | Bacteria | 2438 |
| 351 | Ga0466966_0106289 | 3300044684 | Bacteria | 1732 |
| 352 | Ga0466961_0073423 | 3300044693 | Bacteria | 2169 |
| 353 | Ga0466963_0043118 | 3300044694 | Bacteria | 2965 |
| 354 | Ga0466963_0097588 | 3300044694 | Bacteria | 2008 |
| 355 | Ga0466963_0187608 | 3300044694 | Bacteria | 1444 |
| 356 | Ga0466963_0282439 | 3300044694 | Bacteria | 1167 |
| 357 | Ga0466964_0149297 | 3300044706 | Bacteria | 1082 |
| 358 | Ga0466968_0007837 | 3300044735 | Bacteria | 4074 |
| 359 | Ga0466968_0010904 | 3300044735 | Bacteria | 3532 |
| 360 | Ga0466968_0027134 | 3300044735 | Bacteria | 2355 |
| 361 | Ga0466968_0029062 | 3300044735 | Bacteria | 2284 |
| 362 | Ga0466970_0007848 | 3300044765 | Bacteria | 5357 |
| 363 | Ga0466970_0021458 | 3300044765 | Bacteria | 3363 |
| 364 | Ga0466957_0011255 | 3300044842 | Bacteria | 5153 |
| 365 | Ga0466957_0012008 | 3300044842 | Bacteria | 5007 |
| 366 | Ga0466957_0059405 | 3300044842 | Bacteria | 2343 |
| 367 | Ga0466957_0129488 | 3300044842 | Bacteria | 1615 |
| 368 | Ga0466960_0000085 | 3300044901 | Bacteria | 31262 |
| 369 | Ga0466960_0001165 | 3300044901 | Bacteria | 9449 |
| 370 | Ga0466960_0009668 | 3300044901 | Bacteria | 3983 |
| 371 | Ga0466960_0039951 | 3300044901 | Bacteria | 2216 |
| 372 | Ga0466959_0013228 | 3300045049 | Bacteria | 5977 |
| 373 | Ga0466959_0018177 | 3300045049 | Bacteria | 5160 |
| 374 | Ga0466959_0044887 | 3300045049 | Bacteria | 3255 |
| 375 | Ga0466959_0132573 | 3300045049 | Bacteria | 1765 |
| 376 | Ga0466958_0019581 | 3300045836 | Bacteria | 3941 |
| 377 | Ga0466958_0040203 | 3300045836 | Bacteria | 2810 |
| 378 | Ga0466958_0044770 | 3300045836 | Bacteria | 2668 |
| 379 | Ga0466958_0077103 | 3300045836 | Bacteria | 2047 |
| 380 | Ga0466958_0089843 | 3300045836 | Bacteria | 1900 |
| 381 | Ga0466958_0251819 | 3300045836 | Bacteria | 1130 |
| 382 | Ga0466967_0008554 | 3300045976 | Bacteria | 7516 |
| 383 | Ga0466967_0010813 | 3300045976 | Bacteria | 6869 |
| 384 | Ga0466967_0027720 | 3300045976 | Bacteria | 4716 |
| 385 | Ga0466967_0047150 | 3300045976 | Bacteria | 3755 |
| 386 | Ga0466967_0085250 | 3300045976 | Bacteria | 2860 |
| 387 | Ga0466967_0173184 | 3300045976 | Bacteria | 2032 |
| 388 | Ga0466967_0176570 | 3300045976 | Bacteria | 2012 |
| 389 | Ga0466967_0275603 | 3300045976 | Bacteria | 1613 |
| 390 | Ga0466967_0355057 | 3300045976 | Bacteria | 1419 |
| 391 | Ga0495617_008628 | 3300046452 | Bacteria | 3510 |
| 392 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 393 | Ga0495638_0001104 | 3300046460 | Bacteria | 26279 |
| 394 | Ga0495638_0043710 | 3300046460 | Bacteria | 2825 |
| 395 | Ga0495594_0134141 | 3300046499 | Bacteria | 1403 |
| 396 | Ga0495583_0001401 | 3300046506 | Bacteria | 24579 |
| 397 | Ga0495606_0023558 | 3300046507 | Bacteria | 4456 |
| 398 | Ga0495632_0001899 | 3300046519 | Bacteria | 16723 |
| 399 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 400 | Ga0495648_0007572 | 3300046524 | Bacteria | 8675 |
| 401 | Ga0495648_0118988 | 3300046524 | Bacteria | 1423 |
| 402 | Ga0495654_0027603 | 3300046530 | Bacteria | 2909 |
| 403 | Ga0495633_0024532 | 3300046558 | Bacteria | 2979 |
| 404 | Ga0495668_0019985 | 3300046616 | Bacteria | 3852 |
| 405 | Ga0495668_0054394 | 3300046616 | Bacteria | 2212 |
| 406 | Ga0495625_0000172 | 3300046660 | Bacteria | 101622 |
| 407 | Ga0495625_0000758 | 3300046660 | Bacteria | 45114 |
| 408 | Ga0495635_0180217 | 3300046663 | Bacteria | 1436 |
| 409 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 410 | Ga0495671_0013669 | 3300046692 | Bacteria | 4388 |
| 411 | Ga0495672_0000976 | 3300047320 | Bacteria | 29616 |
| 412 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 413 | Ga0495673_0002357 | 3300047469 | Bacteria | 13410 |
| 414 | Ga0495686_0009872 | 3300047472 | Bacteria | 6840 |
| 415 | Ga0496100_0000053 | 3300048903 | Bacteria | 70913 |
| 416 | Ga0496100_0000836 | 3300048903 | Bacteria | 14772 |
| 417 | Ga0496100_0027267 | 3300048903 | Bacteria | 3511 |
| 418 | Ga0496100_0099470 | 3300048903 | Bacteria | 2001 |
| 419 | Ga0496100_0124111 | 3300048903 | Bacteria | 1810 |
| 420 | Ga0496100_0155269 | 3300048903 | Bacteria | 1636 |
| 421 | Ga0496100_0305815 | 3300048903 | Bacteria | 1191 |
| 422 | Ga0496101_0000056 | 3300048904 | Bacteria | 135446 |
| 423 | Ga0496101_0000057 | 3300048904 | Bacteria | 134204 |
| 424 | Ga0496101_0000252 | 3300048904 | Bacteria | 38425 |
| 425 | Ga0496101_0004058 | 3300048904 | Bacteria | 9151 |
| 426 | Ga0496101_0026271 | 3300048904 | Bacteria | 4048 |
| 427 | Ga0496101_0054395 | 3300048904 | Bacteria | 2890 |
| 428 | Ga0496101_0169027 | 3300048904 | Bacteria | 1680 |
| 429 | Ga0496102_0000177 | 3300048905 | Bacteria | 86724 |
| 430 | Ga0496102_0000249 | 3300048905 | Bacteria | 70385 |
| 431 | Ga0496102_0017929 | 3300048905 | Bacteria | 6210 |
| 432 | Ga0496102_0025557 | 3300048905 | Bacteria | 5258 |
| 433 | Ga0496102_0077856 | 3300048905 | Bacteria | 3052 |
| 434 | Ga0496102_0090875 | 3300048905 | Bacteria | 2825 |
| 435 | Ga0496102_0154064 | 3300048905 | Bacteria | 2160 |
| 436 | Ga0496102_0216089 | 3300048905 | Bacteria | 1807 |
| 437 | Ga0496102_0255977 | 3300048905 | Bacteria | 1650 |
| 438 | Ga0496103_0000003 | 3300048906 | Bacteria | 603967 |
| 439 | Ga0496103_0001078 | 3300048906 | Bacteria | 19063 |
| 440 | Ga0496103_0001470 | 3300048906 | Bacteria | 15762 |
| 441 | Ga0496103_0004296 | 3300048906 | Bacteria | 8661 |
| 442 | Ga0496104_0015656 | 3300048907 | Bacteria | 6877 |
| 443 | Ga0496104_0026125 | 3300048907 | Bacteria | 5387 |
| 444 | Ga0496105_0100068 | 3300048908 | Bacteria | 2394 |
| 445 | Ga0496105_0151971 | 3300048908 | Bacteria | 1903 |
| 446 | Ga0496105_0211328 | 3300048908 | Bacteria | 1581 |
| 447 | Ga0496106_0000310 | 3300048909 | Bacteria | 34363 |
| 448 | Ga0496106_0005090 | 3300048909 | Bacteria | 9730 |
| 449 | Ga0496106_0005594 | 3300048909 | Bacteria | 9304 |
| 450 | Ga0496106_0009890 | 3300048909 | Bacteria | 7040 |
| 451 | Ga0496106_0025658 | 3300048909 | Bacteria | 4387 |
| 452 | Ga0496107_0000167 | 3300048910 | Bacteria | 33889 |
| 453 | Ga0496107_0037370 | 3300048910 | Bacteria | 3484 |
| 454 | Ga0496107_0041784 | 3300048910 | Bacteria | 3293 |
| 455 | Ga0496107_0042606 | 3300048910 | Bacteria | 3260 |
| 456 | Ga0496107_0069617 | 3300048910 | Bacteria | 2554 |
| 457 | Ga0496108_0000789 | 3300048911 | Bacteria | 24747 |
| 458 | Ga0496108_0006969 | 3300048911 | Bacteria | 9148 |
| 459 | Ga0496108_0076004 | 3300048911 | Bacteria | 2838 |
| 460 | Ga0496108_0081590 | 3300048911 | Bacteria | 2741 |
| 461 | Ga0496109_0000144 | 3300048912 | Bacteria | 71522 |
| 462 | Ga0496109_0008927 | 3300048912 | Bacteria | 8541 |
| 463 | Ga0496110_0054868 | 3300048913 | Bacteria | 3505 |
| 464 | Ga0496110_0603733 | 3300048913 | Bacteria | 995 |
| 465 | Ga0496110_0678054 | 3300048913 | Bacteria | 931 |
| 466 | Ga0496111_0057959 | 3300048914 | Bacteria | 2804 |
| 467 | Ga0496112_0023396 | 3300048915 | Bacteria | 5903 |
| 468 | Ga0496112_0035628 | 3300048915 | Bacteria | 4850 |
| 469 | Ga0496112_0736463 | 3300048915 | Bacteria | 913 |
| 470 | Ga0496112_0805692 | 3300048915 | Bacteria | 864 |
| 471 | Ga0496113_0042423 | 3300048916 | Bacteria | 3362 |
| 472 | Ga0496113_0043067 | 3300048916 | Bacteria | 3338 |
| 473 | Ga0496113_0088031 | 3300048916 | Bacteria | 2389 |
| 474 | Ga0496113_0408277 | 3300048916 | Bacteria | 1091 |
| 475 | Ga0496114_0003438 | 3300048917 | Bacteria | 12146 |
| 476 | Ga0496114_0004025 | 3300048917 | Bacteria | 11355 |
| 477 | Ga0496114_0246275 | 3300048917 | Bacteria | 1572 |
| 478 | Ga0496114_0892115 | 3300048917 | Bacteria | 770 |
| 479 | Ga0496115_0009423 | 3300048918 | Bacteria | 7255 |
| 480 | Ga0496115_0093676 | 3300048918 | Bacteria | 2456 |
| 481 | Ga0496115_0235002 | 3300048918 | Bacteria | 1511 |
| 482 | Ga0496116_0000013 | 3300048919 | Bacteria | 603993 |
| 483 | Ga0496116_0002742 | 3300048919 | Bacteria | 18096 |
| 484 | Ga0496116_0015310 | 3300048919 | Bacteria | 6067 |
| 485 | Ga0496117_0000013 | 3300048920 | Bacteria | 603995 |
| 486 | Ga0496117_0002764 | 3300048920 | Bacteria | 21490 |
| 487 | Ga0496117_0026656 | 3300048920 | Bacteria | 4518 |
| 488 | Ga0496117_0091746 | 3300048920 | Bacteria | 1953 |
| 489 | Ga0496118_0000011 | 3300048921 | Bacteria | 603995 |
| 490 | Ga0496118_0001041 | 3300048921 | Bacteria | 43205 |
| 491 | Ga0496118_0005770 | 3300048921 | Bacteria | 13909 |
| 492 | Ga0496118_0014837 | 3300048921 | Bacteria | 7262 |
| 493 | Ga0496119_0051911 | 3300048922 | Bacteria | 2515 |
| 494 | Ga0496119_0059043 | 3300048922 | Bacteria | 2307 |
| 495 | Ga0496119_0089330 | 3300048922 | Bacteria | 1754 |
| 496 | Ga0496119_0099397 | 3300048922 | Bacteria | 1636 |
| 497 | Ga0496120_0036818 | 3300048923 | Bacteria | 2908 |
| 498 | Ga0496120_0043410 | 3300048923 | Bacteria | 2619 |
| 499 | Ga0496120_0153927 | 3300048923 | Bacteria | 1153 |
| 500 | Ga0496120_0210352 | 3300048923 | Bacteria | 935 |
| 501 | Ga0496121_0000060 | 3300048924 | Bacteria | 276682 |
| 502 | Ga0496121_0000068 | 3300048924 | Bacteria | 259210 |
| 503 | Ga0496121_0002455 | 3300048924 | Bacteria | 28318 |
| 504 | Ga0496122_0000085 | 3300048925 | Bacteria | 208310 |
| 505 | Ga0496122_0033527 | 3300048925 | Bacteria | 4221 |
| 506 | Ga0496122_0135592 | 3300048925 | Bacteria | 1552 |
| 507 | Ga0496123_0007823 | 3300048926 | Bacteria | 9950 |
| 508 | Ga0496123_0084935 | 3300048926 | Bacteria | 1906 |
| 509 | Ga0496123_0089276 | 3300048926 | Bacteria | 1836 |
| 510 | Ga0496124_0000065 | 3300048927 | Bacteria | 223594 |
| 511 | Ga0496124_0201665 | 3300048927 | Unclassified | 1512 |
| 512 | Ga0496125_0000008 | 3300048928 | Bacteria | 704677 |
| 513 | Ga0496125_0014788 | 3300048928 | Bacteria | 7580 |
| 514 | Ga0496125_0023518 | 3300048928 | Bacteria | 5685 |
| 515 | Ga0496125_0060587 | 3300048928 | Unclassified | 3040 |
| 516 | Ga0496126_0000062 | 3300048929 | Bacteria | 259210 |
| 517 | Ga0496126_0002515 | 3300048929 | Bacteria | 24558 |
| 518 | Ga0496126_0005424 | 3300048929 | Bacteria | 14548 |
| 519 | Ga0496126_0007649 | 3300048929 | Bacteria | 11792 |
| 520 | Ga0496126_0020492 | 3300048929 | Bacteria | 6478 |
| 521 | Ga0496126_0044950 | 3300048929 | Bacteria | 4062 |
| 522 | Ga0496126_0296527 | 3300048929 | Bacteria | 1335 |
| 523 | Ga0501032_0002531 | 3300049569 | Bacteria | 14307 |
| 524 | Ga0501033_0019487 | 3300049570 | Bacteria | 5129 |
| 525 | Ga0501034_0004496 | 3300049571 | Bacteria | 15498 |
| 526 | Ga0501034_0027087 | 3300049571 | Bacteria | 5831 |
| 527 | Ga0501034_0345480 | 3300049571 | Bacteria | 1417 |
| 528 | Ga0501036_0109399 | 3300049572 | Bacteria | 2335 |
| 529 | Ga0501037_0016870 | 3300049573 | Bacteria | 5372 |
| 530 | Ga0501037_0036155 | 3300049573 | Bacteria | 3640 |
| 531 | Ga0501038_0003328 | 3300049574 | Bacteria | 14991 |
| 532 | Ga0501038_0288158 | 3300049574 | Bacteria | 1291 |
| 533 | Ga0501039_0016396 | 3300049575 | Bacteria | 5675 |
| 534 | Ga0501043_0015144 | 3300049579 | Bacteria | 6035 |
| 535 | Ga0501043_0167365 | 3300049579 | Bacteria | 1716 |
| 536 | Ga0501046_0004510 | 3300049580 | Bacteria | 12619 |
| 537 | Ga0501047_0003281 | 3300049581 | Bacteria | 15320 |
| 538 | Ga0501047_0003545 | 3300049581 | Bacteria | 14739 |
| 539 | Ga0501047_0549681 | 3300049581 | Bacteria | 979 |
| 540 | Ga0501067_0052394 | 3300049583 | Bacteria | 2261 |
| 541 | Ga0501070_0000482 | 3300049586 | Bacteria | 36204 |
| 542 | Ga0501070_0000727 | 3300049586 | Bacteria | 30087 |
| 543 | Ga0501073_0069478 | 3300049589 | Bacteria | 2454 |
| 544 | Ga0501073_0496065 | 3300049589 | Bacteria | 844 |
| 545 | Ga0501269_005691 | 3300049766 | Bacteria | 1498 |
| 546 | Ga0501035_0001028 | 3300049822 | Bacteria | 29311 |
| 547 | Ga0501044_0005626 | 3300049823 | Bacteria | 13922 |
| 548 | Ga0501044_0022865 | 3300049823 | Bacteria | 6658 |
| 549 | Ga0501044_0057575 | 3300049823 | Bacteria | 3988 |
| 550 | Ga0501044_0119936 | 3300049823 | Bacteria | 2632 |
| 551 | nmdc:mga03683_82844_c1 | 3300050489 | Bacteria | 1388 |
| 552 | nmdc:mga03n38_195307_c1 | 3300050490 | Bacteria | 1045 |
| 553 | nmdc:mga03n38_21170_c1 | 3300050490 | Bacteria | 2613 |
| 554 | nmdc:mga03n38_239606_c1 | 3300050490 | Bacteria | 954 |
| 555 | nmdc:mga03n38_340061_c1 | 3300050490 | Bacteria | 814 |
| 556 | nmdc:mga03n38_52259_c1 | 3300050490 | Bacteria | 1828 |
| 557 | nmdc:mga00v17_181211_c1 | 3300050491 | Bacteria | 1359 |
| 558 | nmdc:mga00v17_1894_c1 | 3300050491 | Bacteria | 10830 |
| 559 | nmdc:mga00v17_195664_c1 | 3300050491 | Bacteria | 1306 |
| 560 | nmdc:mga00v17_7928_c1 | 3300050491 | Bacteria | 5692 |
| 561 | nmdc:mga0yw44_11320_c1 | 3300050492 | Bacteria | 4598 |
| 562 | nmdc:mga0yw44_248671_c1 | 3300050492 | Bacteria | 1183 |
| 563 | nmdc:mga0yw44_3155_c1 | 3300050492 | Bacteria | 7235 |
| 564 | nmdc:mga0yw44_3189_c1 | 3300050492 | Bacteria | 7214 |
| 565 | nmdc:mga0yw44_44846_c1 | 3300050492 | Bacteria | 2647 |
| 566 | nmdc:mga0yw44_8456_c1 | 3300050492 | Bacteria | 5131 |
| 567 | nmdc:mga0yw44_90875_c1 | 3300050492 | Bacteria | 1929 |
| 568 | nmdc:mga0k408_131690_c1 | 3300050493 | Bacteria | 1484 |
| 569 | nmdc:mga06z11_12813_c1 | 3300050494 | Bacteria | 3658 |
| 570 | nmdc:mga04h51_24837_c1 | 3300050495 | Bacteria | 1839 |
| 571 | nmdc:mga07m45_112328_c1 | 3300050496 | Bacteria | 1570 |
| 572 | nmdc:mga07m45_11600_c1 | 3300050496 | Bacteria | 4634 |
| 573 | nmdc:mga07m45_200698_c1 | 3300050496 | Bacteria | 1160 |
| 574 | nmdc:mga07m45_24877_c1 | 3300050496 | Bacteria | 3283 |
| 575 | nmdc:mga07m45_2918_c2 | 3300050496 | Bacteria | 7019 |
| 576 | nmdc:mga07m45_414007_c1 | 3300050496 | Bacteria | 782 |
| 577 | nmdc:mga0qj67_10116_c2 | 3300050509 | Bacteria | 3497 |
| 578 | nmdc:mga0qj67_41182_c1 | 3300050509 | Bacteria | 3632 |
| 579 | nmdc:mga06r32_131751_c1 | 3300050510 | Bacteria | 2472 |
| 580 | nmdc:mga0sz30_102619_c1 | 3300050516 | Bacteria | 1250 |
| 581 | nmdc:mga0sz30_155251_c1 | 3300050516 | Bacteria | 1013 |
| 582 | nmdc:mga0sz30_22039_c1 | 3300050516 | Bacteria | 2582 |
| 583 | nmdc:mga0sz30_3132_c1 | 3300050516 | Bacteria | 5922 |
| 584 | nmdc:mga0sz30_41466_c1 | 3300050516 | Bacteria | 1935 |
| 585 | nmdc:mga0sz30_4588_c1 | 3300050516 | Bacteria | 5005 |
| 586 | nmdc:mga0sz30_55656_c1 | 3300050516 | Bacteria | 1684 |
| 587 | Ga0500610_0022572 | 3300053079 | Bacteria | 3104 |
| 588 | Ga0500635_0005847 | 3300053080 | Bacteria | 3256 |
| 589 | Ga0500643_000188 | 3300053087 | Bacteria | 59049 |
| 590 | Ga0500643_022210 | 3300053087 | Bacteria | 2046 |
| 591 | Ga0500641_0033329 | 3300053096 | Bacteria | 2044 |
| 592 | Ga0500556_0020040 | 3300053104 | Bacteria | 2135 |
| 593 | Ga0500562_010314 | 3300053108 | Bacteria | 2367 |
| 594 | Ga0500595_007848 | 3300053119 | Unclassified | 4396 |
| 595 | Ga0500652_000245 | 3300053131 | Bacteria | 20504 |
| 596 | Ga0500559_0017140 | 3300053136 | Bacteria | 3058 |
| 597 | Ga0500559_0134306 | 3300053136 | Bacteria | 1156 |
| 598 | Ga0500616_0011256 | 3300053153 | Bacteria | 5298 |
| 599 | Ga0500619_059017 | 3300053154 | Bacteria | 1259 |
| 600 | Ga0500624_000036 | 3300053157 | Bacteria | 94678 |
| 601 | Ga0500639_074720 | 3300053163 | Bacteria | 1718 |
| 602 | Ga0500636_0253619 | 3300053177 | Bacteria | 895 |
| 603 | Ga0500645_000093 | 3300053730 | Bacteria | 69740 |
| 604 | Ga0500661_007944 | 3300055283 | Unclassified | 1955 |
| 605 | Ga0466962_0001495 | 3300061719 | Bacteria | 10904 |
| 606 | Ga0466962_0038218 | 3300061719 | Bacteria | 2298 |
| 607 | Ga0466962_0057859 | 3300061719 | Bacteria | 1851 |
| 608 | Ga0466962_0253898 | 3300061719 | Bacteria | 864 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050496 | nmdc:mga07m45_414007_c1 | nmdc:mga07m45_414007_c1_115_720 | 201 |
| 2 | 3300048917 | Ga0496114_0892115 | Ga0496114_0892115_52_666 | 204 |
| 3 | 3300049589 | Ga0501073_0496065 | Ga0501073_0496065_216_830 | 204 |
| 4 | 3300048904 | Ga0496101_0169027 | Ga0496101_0169027_28_684 | 214 |
| 5 | 3300049574 | Ga0501038_0288158 | Ga0501038_0288158_400_1143 | 222 |
| 6 | 3300046452 | Ga0495617_008628 | Ga0495617_008628_2639_3421 | 223 |
| 7 | 3300046460 | Ga0495638_0000012 | Ga0495638_0000012_59234_60016 | 223 |
| 8 | 3300046519 | Ga0495632_0001899 | Ga0495632_0001899_6418_7200 | 223 |
| 9 | 3300046524 | Ga0495648_0000038 | Ga0495648_0000038_131597_132379 | 223 |
| 10 | 3300044706 | Ga0466964_0149297 | Ga0466964_0149297_380_1069 | 229 |
| 11 | 3300046506 | Ga0495583_0001401 | Ga0495583_0001401_5969_6751 | 229 |
| 12 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_119410_120192 | 229 |
| 13 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_192111_192893 | 229 |
| 14 | 3300053080 | Ga0500635_0005847 | Ga0500635_0005847_2060_2749 | 229 |
| 15 | 3300053131 | Ga0500652_000245 | Ga0500652_000245_495_1184 | 229 |
| 16 | 3300035113 | Ga0373936_0003434 | Ga0373936_0003434_1002_1763 | 233 |
| 17 | 3300046524 | Ga0495648_0118988 | Ga0495648_0118988_83_844 | 233 |
| 18 | iso_pu_bacteria | 2738541264 | 2738669417 | 233 |
| 19 | iso_pu_bacteria | 2738541356 | 2739148541 | 233 |
| 20 | 3300031616 | Ga0307508_10019359 | Ga0307508_100193595 | 234 |
| 21 | 3300053136 | Ga0500559_0134306 | Ga0500559_0134306_61_804 | 234 |
| 22 | 3300030521 | Ga0307511_10006269 | Ga0307511_1000626912 | 235 |
| 23 | 3300053163 | Ga0500639_074720 | Ga0500639_074720_762_1517 | 235 |
| 24 | 3300044683 | Ga0466965_0163961 | Ga0466965_0163961_74_826 | 236 |
| 25 | 3300003792 | Ga0055540_1004066 | Ga0055540_10040668 | 237 |
| 26 | 3300005367 | Ga0070667_100002627 | Ga0070667_10000262713 | 237 |
| 27 | 3300031251 | Ga0265327_10009796 | Ga0265327_100097968 | 237 |
| 28 | 3300005468 | Ga0070707_100517552 | Ga0070707_1005175522 | 238 |
| 29 | 3300005548 | Ga0070665_100667937 | Ga0070665_1006679371 | 238 |
| 30 | 3300009545 | Ga0105237_10073970 | Ga0105237_100739704 | 239 |
| 31 | 3300035113 | Ga0373936_0011941 | Ga0373936_0011941_1153_1914 | 239 |
| 32 | iso_pu_bacteria | 2547132424 | 2548696281 | 242 |
| 33 | iso_pu_bacteria | 2565956761 | 2566995958 | 242 |
| 34 | iso_pu_bacteria | 2643221687 | 2644488960 | 242 |
| 35 | iso_pu_bacteria | 2643221715 | 2644638542 | 242 |
| 36 | iso_pu_bacteria | 2738541274 | 2738703751 | 242 |
| 37 | iso_pu_bacteria | 2738541308 | 2738891599 | 242 |
| 38 | iso_pu_bacteria | 2738543028 | 2739330640 | 242 |
| 39 | iso_pu_bacteria | 2744054611 | 2744955712 | 242 |
| 40 | iso_pu_bacteria | 2842134933 | 2842137378 | 242 |
| 41 | iso_pu_bacteria | 2902792274 | 2902796929 | 242 |
| 42 | iso_pu_bacteria | 2902799365 | 2902799645 | 242 |
| 43 | iso_pu_bacteria | 2902810491 | 2902812531 | 242 |
| 44 | iso_pu_bacteria | 2902837492 | 2902838731 | 242 |
| 45 | iso_pu_bacteria | 2904535858 | 2904540594 | 242 |
| 46 | iso_pu_bacteria | 2922554459 | 2922554678 | 242 |
| 47 | iso_pu_bacteria | 2929212328 | 2929216389 | 242 |
| 48 | iso_pu_bacteria | 2939582691 | 2939588468 | 242 |
| 49 | 3300009147 | Ga0114129_10307259 | Ga0114129_103072593 | 243 |
| 50 | 3300050509 | nmdc:mga0qj67_10116_c2 | nmdc:mga0qj67_10116_c2_1466_2209 | 243 |
| 51 | 3300053136 | Ga0500559_0017140 | Ga0500559_0017140_407_1150 | 243 |
| 52 | iso_pu_bacteria | 2751185725 | 2753035658 | 243 |
| 53 | iso_pu_bacteria | 2751185792 | 2753326316 | 243 |
| 54 | 3300006058 | Ga0075432_10014978 | Ga0075432_100149783 | 245 |
| 55 | 3300031901 | Ga0307406_10343322 | Ga0307406_103433222 | 245 |
| 56 | 3300032005 | Ga0307411_10217531 | Ga0307411_102175312 | 245 |
| 57 | 3300046616 | Ga0495668_0019985 | Ga0495668_0019985_3082_3834 | 245 |
| 58 | 3300046616 | Ga0495668_0054394 | Ga0495668_0054394_1402_2154 | 245 |
| 59 | 3300048911 | Ga0496108_0076004 | Ga0496108_0076004_2017_2769 | 245 |
| 60 | 3300048928 | Ga0496125_0023518 | Ga0496125_0023518_1925_2677 | 245 |
| 61 | 3300000546 | LJNas_1008134 | LJNas_10081342 | 246 |
| 62 | 3300001990 | JGI24737J22298_10072145 | JGI24737J22298_100721452 | 246 |
| 63 | 3300001991 | JGI24743J22301_10031981 | JGI24743J22301_100319812 | 246 |
| 64 | 3300002075 | JGI24738J21930_10033576 | JGI24738J21930_100335762 | 246 |
| 65 | 3300002076 | JGI24749J21850_1014986 | JGI24749J21850_10149862 | 246 |
| 66 | 3300002077 | JGI24744J21845_10002400 | JGI24744J21845_100024002 | 246 |
| 67 | 3300002077 | JGI24744J21845_10013718 | JGI24744J21845_100137182 | 246 |
| 68 | 3300002239 | JGI24034J26672_10001885 | JGI24034J26672_100018853 | 246 |
| 69 | 3300002244 | JGI24742J22300_10015242 | JGI24742J22300_100152422 | 246 |
| 70 | 3300003214 | JGI25165J46597_1000526 | JGI25165J46597_100052625 | 246 |
| 71 | 3300003320 | rootH2_10127436 | rootH2_101274362 | 246 |
| 72 | 3300003792 | Ga0055540_1002937 | Ga0055540_10029375 | 246 |
| 73 | 3300005295 | Ga0065707_10090393 | Ga0065707_100903932 | 246 |
| 74 | 3300005328 | Ga0070676_10091353 | Ga0070676_100913532 | 246 |
| 75 | 3300005329 | Ga0070683_100436637 | Ga0070683_1004366371 | 246 |
| 76 | 3300005330 | Ga0070690_100007865 | Ga0070690_1000078652 | 246 |
| 77 | 3300005330 | Ga0070690_100117761 | Ga0070690_1001177612 | 246 |
| 78 | 3300005331 | Ga0070670_100000017 | Ga0070670_100000017164 | 246 |
| 79 | 3300005331 | Ga0070670_100686103 | Ga0070670_1006861031 | 246 |
| 80 | 3300005333 | Ga0070677_10020264 | Ga0070677_100202642 | 246 |
| 81 | 3300005334 | Ga0068869_100053124 | Ga0068869_1000531242 | 246 |
| 82 | 3300005335 | Ga0070666_10237220 | Ga0070666_102372201 | 246 |
| 83 | 3300005336 | Ga0070680_100319953 | Ga0070680_1003199532 | 246 |
| 84 | 3300005337 | Ga0070682_100045732 | Ga0070682_1000457323 | 246 |
| 85 | 3300005337 | Ga0070682_100094360 | Ga0070682_1000943602 | 246 |
| 86 | 3300005338 | Ga0068868_100090357 | Ga0068868_1000903573 | 246 |
| 87 | 3300005338 | Ga0068868_100123106 | Ga0068868_1001231062 | 246 |
| 88 | 3300005340 | Ga0070689_100017204 | Ga0070689_1000172047 | 246 |
| 89 | 3300005345 | Ga0070692_10056348 | Ga0070692_100563482 | 246 |
| 90 | 3300005347 | Ga0070668_100000348 | Ga0070668_1000003482 | 246 |
| 91 | 3300005347 | Ga0070668_100007133 | Ga0070668_1000071335 | 246 |
| 92 | 3300005347 | Ga0070668_100395599 | Ga0070668_1003955992 | 246 |
| 93 | 3300005353 | Ga0070669_100000420 | Ga0070669_1000004209 | 246 |
| 94 | 3300005353 | Ga0070669_100002285 | Ga0070669_10000228514 | 246 |
| 95 | 3300005353 | Ga0070669_100263965 | Ga0070669_1002639652 | 246 |
| 96 | 3300005354 | Ga0070675_100134685 | Ga0070675_1001346853 | 246 |
| 97 | 3300005355 | Ga0070671_100000173 | Ga0070671_10000017314 | 246 |
| 98 | 3300005355 | Ga0070671_100011926 | Ga0070671_1000119268 | 246 |
| 99 | 3300005356 | Ga0070674_100068165 | Ga0070674_1000681654 | 246 |
| 100 | 3300005356 | Ga0070674_100074076 | Ga0070674_1000740762 | 246 |
| 101 | 3300005364 | Ga0070673_100237947 | Ga0070673_1002379472 | 246 |
| 102 | 3300005365 | Ga0070688_100001099 | Ga0070688_1000010996 | 246 |
| 103 | 3300005365 | Ga0070688_100016522 | Ga0070688_1000165222 | 246 |
| 104 | 3300005365 | Ga0070688_100070898 | Ga0070688_1000708982 | 246 |
| 105 | 3300005366 | Ga0070659_100052685 | Ga0070659_1000526852 | 246 |
| 106 | 3300005367 | Ga0070667_100000033 | Ga0070667_1000000338 | 246 |
| 107 | 3300005367 | Ga0070667_100000203 | Ga0070667_10000020312 | 246 |
| 108 | 3300005367 | Ga0070667_100059843 | Ga0070667_1000598433 | 246 |
| 109 | 3300005367 | Ga0070667_100345141 | Ga0070667_1003451411 | 246 |
| 110 | 3300005434 | Ga0070709_10025899 | Ga0070709_100258993 | 246 |
| 111 | 3300005435 | Ga0070714_100081655 | Ga0070714_1000816553 | 246 |
| 112 | 3300005435 | Ga0070714_100088977 | Ga0070714_1000889773 | 246 |
| 113 | 3300005435 | Ga0070714_100200572 | Ga0070714_1002005723 | 246 |
| 114 | 3300005435 | Ga0070714_100239670 | Ga0070714_1002396702 | 246 |
| 115 | 3300005435 | Ga0070714_100406900 | Ga0070714_1004069001 | 246 |
| 116 | 3300005437 | Ga0070710_10007428 | Ga0070710_100074283 | 246 |
| 117 | 3300005437 | Ga0070710_10021899 | Ga0070710_100218993 | 246 |
| 118 | 3300005438 | Ga0070701_10047826 | Ga0070701_100478263 | 246 |
| 119 | 3300005439 | Ga0070711_100002238 | Ga0070711_1000022382 | 246 |
| 120 | 3300005439 | Ga0070711_100004016 | Ga0070711_1000040162 | 246 |
| 121 | 3300005440 | Ga0070705_100049195 | Ga0070705_1000491952 | 246 |
| 122 | 3300005440 | Ga0070705_100118242 | Ga0070705_1001182422 | 246 |
| 123 | 3300005440 | Ga0070705_100712886 | Ga0070705_1007128861 | 246 |
| 124 | 3300005441 | Ga0070700_100272454 | Ga0070700_1002724542 | 246 |
| 125 | 3300005444 | Ga0070694_100076135 | Ga0070694_1000761353 | 246 |
| 126 | 3300005445 | Ga0070708_100390236 | Ga0070708_1003902361 | 246 |
| 127 | 3300005445 | Ga0070708_100564515 | Ga0070708_1005645151 | 246 |
| 128 | 3300005455 | Ga0070663_100054078 | Ga0070663_1000540782 | 246 |
| 129 | 3300005455 | Ga0070663_100159134 | Ga0070663_1001591342 | 246 |
| 130 | 3300005456 | Ga0070678_100046926 | Ga0070678_1000469262 | 246 |
| 131 | 3300005457 | Ga0070662_100062999 | Ga0070662_1000629993 | 246 |
| 132 | 3300005457 | Ga0070662_100090947 | Ga0070662_1000909472 | 246 |
| 133 | 3300005459 | Ga0068867_100192197 | Ga0068867_1001921972 | 246 |
| 134 | 3300005466 | Ga0070685_10000026 | Ga0070685_1000002613 | 246 |
| 135 | 3300005539 | Ga0068853_100000449 | Ga0068853_10000044933 | 246 |
| 136 | 3300005539 | Ga0068853_100066470 | Ga0068853_1000664703 | 246 |
| 137 | 3300005543 | Ga0070672_100040375 | Ga0070672_1000403753 | 246 |
| 138 | 3300005543 | Ga0070672_100082638 | Ga0070672_1000826383 | 246 |
| 139 | 3300005544 | Ga0070686_100081292 | Ga0070686_1000812923 | 246 |
| 140 | 3300005545 | Ga0070695_100010836 | Ga0070695_1000108361 | 246 |
| 141 | 3300005546 | Ga0070696_100004414 | Ga0070696_1000044142 | 246 |
| 142 | 3300005546 | Ga0070696_100068171 | Ga0070696_1000681712 | 246 |
| 143 | 3300005548 | Ga0070665_100001836 | Ga0070665_10000183627 | 246 |
| 144 | 3300005548 | Ga0070665_100005426 | Ga0070665_1000054263 | 246 |
| 145 | 3300005548 | Ga0070665_100038520 | Ga0070665_1000385202 | 246 |
| 146 | 3300005548 | Ga0070665_100106305 | Ga0070665_1001063053 | 246 |
| 147 | 3300005549 | Ga0070704_100001044 | Ga0070704_1000010441 | 246 |
| 148 | 3300005549 | Ga0070704_100618410 | Ga0070704_1006184101 | 246 |
| 149 | 3300005563 | Ga0068855_100242569 | Ga0068855_1002425692 | 246 |
| 150 | 3300005578 | Ga0068854_100000321 | Ga0068854_10000032113 | 246 |
| 151 | 3300005578 | Ga0068854_100534239 | Ga0068854_1005342392 | 246 |
| 152 | 3300005614 | Ga0068856_100094734 | Ga0068856_1000947342 | 246 |
| 153 | 3300005614 | Ga0068856_100821137 | Ga0068856_1008211372 | 246 |
| 154 | 3300005615 | Ga0070702_100173446 | Ga0070702_1001734462 | 246 |
| 155 | 3300005616 | Ga0068852_100096733 | Ga0068852_1000967333 | 246 |
| 156 | 3300005617 | Ga0068859_100016348 | Ga0068859_1000163482 | 246 |
| 157 | 3300005617 | Ga0068859_100092049 | Ga0068859_1000920492 | 246 |
| 158 | 3300005617 | Ga0068859_100413498 | Ga0068859_1004134982 | 246 |
| 159 | 3300005618 | Ga0068864_100000029 | Ga0068864_10000002950 | 246 |
| 160 | 3300005718 | Ga0068866_10009653 | Ga0068866_100096535 | 246 |
| 161 | 3300005718 | Ga0068866_10018060 | Ga0068866_100180602 | 246 |
| 162 | 3300005719 | Ga0068861_100051568 | Ga0068861_1000515682 | 246 |
| 163 | 3300005840 | Ga0068870_10057947 | Ga0068870_100579472 | 246 |
| 164 | 3300005841 | Ga0068863_100000193 | Ga0068863_10000019342 | 246 |
| 165 | 3300005841 | Ga0068863_100001954 | Ga0068863_10000195411 | 246 |
| 166 | 3300005841 | Ga0068863_100030472 | Ga0068863_1000304723 | 246 |
| 167 | 3300005842 | Ga0068858_100043939 | Ga0068858_1000439395 | 246 |
| 168 | 3300005842 | Ga0068858_100074999 | Ga0068858_1000749993 | 246 |
| 169 | 3300005842 | Ga0068858_100129475 | Ga0068858_1001294752 | 246 |
| 170 | 3300005843 | Ga0068860_100000010 | Ga0068860_1000000109 | 246 |
| 171 | 3300005843 | Ga0068860_100010618 | Ga0068860_10001061814 | 246 |
| 172 | 3300005843 | Ga0068860_100039508 | Ga0068860_1000395082 | 246 |
| 173 | 3300005843 | Ga0068860_100049331 | Ga0068860_1000493311 | 246 |
| 174 | 3300005844 | Ga0068862_100000205 | Ga0068862_10000020540 | 246 |
| 175 | 3300005844 | Ga0068862_100018287 | Ga0068862_1000182872 | 246 |
| 176 | 3300005844 | Ga0068862_100145357 | Ga0068862_1001453573 | 246 |
| 177 | 3300005937 | Ga0081455_10164274 | Ga0081455_101642742 | 246 |
| 178 | 3300006038 | Ga0075365_10013585 | Ga0075365_100135852 | 246 |
| 179 | 3300006038 | Ga0075365_10018705 | Ga0075365_100187053 | 246 |
| 180 | 3300006038 | Ga0075365_10031171 | Ga0075365_100311713 | 246 |
| 181 | 3300006038 | Ga0075365_10039796 | Ga0075365_100397961 | 246 |
| 182 | 3300006038 | Ga0075365_10055298 | Ga0075365_100552982 | 246 |
| 183 | 3300006038 | Ga0075365_10066709 | Ga0075365_100667092 | 246 |
| 184 | 3300006038 | Ga0075365_10071417 | Ga0075365_100714171 | 246 |
| 185 | 3300006038 | Ga0075365_10126683 | Ga0075365_101266832 | 246 |
| 186 | 3300006042 | Ga0075368_10024160 | Ga0075368_100241602 | 246 |
| 187 | 3300006048 | Ga0075363_100000554 | Ga0075363_1000005542 | 246 |
| 188 | 3300006048 | Ga0075363_100003560 | Ga0075363_1000035603 | 246 |
| 189 | 3300006048 | Ga0075363_100011065 | Ga0075363_1000110652 | 246 |
| 190 | 3300006048 | Ga0075363_100022370 | Ga0075363_1000223702 | 246 |
| 191 | 3300006048 | Ga0075363_100104347 | Ga0075363_1001043471 | 246 |
| 192 | 3300006051 | Ga0075364_10001678 | Ga0075364_100016784 | 246 |
| 193 | 3300006051 | Ga0075364_10004508 | Ga0075364_100045088 | 246 |
| 194 | 3300006051 | Ga0075364_10019518 | Ga0075364_100195187 | 246 |
| 195 | 3300006051 | Ga0075364_10024634 | Ga0075364_100246343 | 246 |
| 196 | 3300006051 | Ga0075364_10051813 | Ga0075364_100518133 | 246 |
| 197 | 3300006163 | Ga0070715_10012635 | Ga0070715_100126353 | 246 |
| 198 | 3300006173 | Ga0070716_100024724 | Ga0070716_1000247242 | 246 |
| 199 | 3300006173 | Ga0070716_100086409 | Ga0070716_1000864092 | 246 |
| 200 | 3300006175 | Ga0070712_100000234 | Ga0070712_10000023421 | 246 |
| 201 | 3300006175 | Ga0070712_100018426 | Ga0070712_1000184262 | 246 |
| 202 | 3300006175 | Ga0070712_100218577 | Ga0070712_1002185772 | 246 |
| 203 | 3300006177 | Ga0075362_10008677 | Ga0075362_100086774 | 246 |
| 204 | 3300006177 | Ga0075362_10046645 | Ga0075362_100466452 | 246 |
| 205 | 3300006178 | Ga0075367_10000654 | Ga0075367_100006547 | 246 |
| 206 | 3300006178 | Ga0075367_10059805 | Ga0075367_100598052 | 246 |
| 207 | 3300006178 | Ga0075367_10254894 | Ga0075367_102548942 | 246 |
| 208 | 3300006186 | Ga0075369_10005335 | Ga0075369_100053351 | 246 |
| 209 | 3300006186 | Ga0075369_10008693 | Ga0075369_100086934 | 246 |
| 210 | 3300006186 | Ga0075369_10054688 | Ga0075369_100546882 | 246 |
| 211 | 3300006186 | Ga0075369_10068485 | Ga0075369_100684852 | 246 |
| 212 | 3300006186 | Ga0075369_10095053 | Ga0075369_100950532 | 246 |
| 213 | 3300006237 | Ga0097621_100049630 | Ga0097621_1000496304 | 246 |
| 214 | 3300006353 | Ga0075370_10002494 | Ga0075370_1000249410 | 246 |
| 215 | 3300006353 | Ga0075370_10009607 | Ga0075370_100096072 | 246 |
| 216 | 3300006353 | Ga0075370_10023151 | Ga0075370_100231514 | 246 |
| 217 | 3300006358 | Ga0068871_100077502 | Ga0068871_1000775023 | 246 |
| 218 | 3300006846 | Ga0075430_100050818 | Ga0075430_1000508183 | 246 |
| 219 | 3300006881 | Ga0068865_100000092 | Ga0068865_10000009224 | 246 |
| 220 | 3300006931 | Ga0097620_100016348 | Ga0097620_1000163488 | 246 |
| 221 | 3300006931 | Ga0097620_100092043 | Ga0097620_1000920432 | 246 |
| 222 | 3300006931 | Ga0097620_100413433 | Ga0097620_1004134332 | 246 |
| 223 | 3300009093 | Ga0105240_10376953 | Ga0105240_103769532 | 246 |
| 224 | 3300009098 | Ga0105245_10000740 | Ga0105245_1000074026 | 246 |
| 225 | 3300009101 | Ga0105247_10000082 | Ga0105247_1000008234 | 246 |
| 226 | 3300009101 | Ga0105247_10000501 | Ga0105247_100005013 | 246 |
| 227 | 3300009101 | Ga0105247_10023229 | Ga0105247_100232292 | 246 |
| 228 | 3300009101 | Ga0105247_10089294 | Ga0105247_100892942 | 246 |
| 229 | 3300009148 | Ga0105243_10000869 | Ga0105243_1000086912 | 246 |
| 230 | 3300009148 | Ga0105243_10064558 | Ga0105243_100645583 | 246 |
| 231 | 3300009174 | Ga0105241_10512481 | Ga0105241_105124811 | 246 |
| 232 | 3300009176 | Ga0105242_10014536 | Ga0105242_100145366 | 246 |
| 233 | 3300009176 | Ga0105242_10034802 | Ga0105242_100348023 | 246 |
| 234 | 3300009177 | Ga0105248_10000084 | Ga0105248_10000084101 | 246 |
| 235 | 3300009177 | Ga0105248_10010522 | Ga0105248_100105223 | 246 |
| 236 | 3300009177 | Ga0105248_10126492 | Ga0105248_101264923 | 246 |
| 237 | 3300009545 | Ga0105237_10054571 | Ga0105237_100545714 | 246 |
| 238 | 3300009545 | Ga0105237_10226491 | Ga0105237_102264912 | 246 |
| 239 | 3300009545 | Ga0105237_10541311 | Ga0105237_105413112 | 246 |
| 240 | 3300009553 | Ga0105249_10000285 | Ga0105249_100002859 | 246 |
| 241 | 3300009553 | Ga0105249_10000664 | Ga0105249_100006644 | 246 |
| 242 | 3300009553 | Ga0105249_10038581 | Ga0105249_100385813 | 246 |
| 243 | 3300010375 | Ga0105239_10010411 | Ga0105239_100104112 | 246 |
| 244 | 3300010375 | Ga0105239_10169471 | Ga0105239_101694712 | 246 |
| 245 | 3300013102 | Ga0157371_10427291 | Ga0157371_104272912 | 246 |
| 246 | 3300013105 | Ga0157369_10180450 | Ga0157369_101804502 | 246 |
| 247 | 3300013297 | Ga0157378_10007450 | Ga0157378_100074502 | 246 |
| 248 | 3300013297 | Ga0157378_10049650 | Ga0157378_100496503 | 246 |
| 249 | 3300013306 | Ga0163162_10070587 | Ga0163162_100705873 | 246 |
| 250 | 3300013306 | Ga0163162_10080920 | Ga0163162_100809204 | 246 |
| 251 | 3300013306 | Ga0163162_10210245 | Ga0163162_102102452 | 246 |
| 252 | 3300013307 | Ga0157372_10007741 | Ga0157372_1000774112 | 246 |
| 253 | 3300014325 | Ga0163163_10001823 | Ga0163163_100018235 | 246 |
| 254 | 3300014325 | Ga0163163_10007947 | Ga0163163_100079478 | 246 |
| 255 | 3300014326 | Ga0157380_10007088 | Ga0157380_1000708812 | 246 |
| 256 | 3300014326 | Ga0157380_10025390 | Ga0157380_100253903 | 246 |
| 257 | 3300014968 | Ga0157379_10020946 | Ga0157379_100209463 | 246 |
| 258 | 3300014968 | Ga0157379_10031502 | Ga0157379_100315029 | 246 |
| 259 | 3300014969 | Ga0157376_10031561 | Ga0157376_100315613 | 246 |
| 260 | 3300017792 | Ga0163161_10031883 | Ga0163161_100318832 | 246 |
| 261 | 3300017792 | Ga0163161_10087319 | Ga0163161_100873193 | 246 |
| 262 | 3300017792 | Ga0163161_10596108 | Ga0163161_105961081 | 246 |
| 263 | 3300025261 | Ga0209233_1000281 | Ga0209233_100028110 | 246 |
| 264 | 3300025273 | Ga0209673_1043491 | Ga0209673_10434912 | 246 |
| 265 | 3300025303 | Ga0209051_1000569 | Ga0209051_10005692 | 246 |
| 266 | 3300025303 | Ga0209051_1006132 | Ga0209051_10061328 | 246 |
| 267 | 3300025303 | Ga0209051_1009513 | Ga0209051_10095134 | 246 |
| 268 | 3300025303 | Ga0209051_1011492 | Ga0209051_10114922 | 246 |
| 269 | 3300025303 | Ga0209051_1018781 | Ga0209051_10187813 | 246 |
| 270 | 3300025711 | Ga0207696_1036209 | Ga0207696_10362091 | 246 |
| 271 | 3300025898 | Ga0207692_10007185 | Ga0207692_100071858 | 246 |
| 272 | 3300025899 | Ga0207642_10074826 | Ga0207642_100748263 | 246 |
| 273 | 3300025899 | Ga0207642_10232949 | Ga0207642_102329492 | 246 |
| 274 | 3300025900 | Ga0207710_10000263 | Ga0207710_1000026330 | 246 |
| 275 | 3300025900 | Ga0207710_10143351 | Ga0207710_101433512 | 246 |
| 276 | 3300025900 | Ga0207710_10170096 | Ga0207710_101700961 | 246 |
| 277 | 3300025901 | Ga0207688_10001118 | Ga0207688_100011184 | 246 |
| 278 | 3300025901 | Ga0207688_10002079 | Ga0207688_1000207914 | 246 |
| 279 | 3300025904 | Ga0207647_10058688 | Ga0207647_100586882 | 246 |
| 280 | 3300025906 | Ga0207699_10117847 | Ga0207699_101178472 | 246 |
| 281 | 3300025906 | Ga0207699_10143443 | Ga0207699_101434432 | 246 |
| 282 | 3300025906 | Ga0207699_10182004 | Ga0207699_101820042 | 246 |
| 283 | 3300025907 | Ga0207645_10047049 | Ga0207645_100470493 | 246 |
| 284 | 3300025915 | Ga0207693_10000356 | Ga0207693_1000035615 | 246 |
| 285 | 3300025915 | Ga0207693_10002084 | Ga0207693_1000208414 | 246 |
| 286 | 3300025915 | Ga0207693_10160377 | Ga0207693_101603772 | 246 |
| 287 | 3300025916 | Ga0207663_10037154 | Ga0207663_100371542 | 246 |
| 288 | 3300025916 | Ga0207663_10060366 | Ga0207663_100603663 | 246 |
| 289 | 3300025917 | Ga0207660_10283338 | Ga0207660_102833382 | 246 |
| 290 | 3300025918 | Ga0207662_10082901 | Ga0207662_100829012 | 246 |
| 291 | 3300025923 | Ga0207681_10072281 | Ga0207681_100722813 | 246 |
| 292 | 3300025923 | Ga0207681_10075326 | Ga0207681_100753262 | 246 |
| 293 | 3300025925 | Ga0207650_10000003 | Ga0207650_1000000350 | 246 |
| 294 | 3300025927 | Ga0207687_10002709 | Ga0207687_100027099 | 246 |
| 295 | 3300025927 | Ga0207687_10056680 | Ga0207687_100566803 | 246 |
| 296 | 3300025929 | Ga0207664_10036724 | Ga0207664_100367244 | 246 |
| 297 | 3300025929 | Ga0207664_10114519 | Ga0207664_101145192 | 246 |
| 298 | 3300025931 | Ga0207644_10000057 | Ga0207644_1000005713 | 246 |
| 299 | 3300025931 | Ga0207644_10017532 | Ga0207644_100175322 | 246 |
| 300 | 3300025932 | Ga0207690_10068559 | Ga0207690_100685592 | 246 |
| 301 | 3300025933 | Ga0207706_10059222 | Ga0207706_100592223 | 246 |
| 302 | 3300025933 | Ga0207706_10089356 | Ga0207706_100893563 | 246 |
| 303 | 3300025934 | Ga0207686_10347776 | Ga0207686_103477762 | 246 |
| 304 | 3300025935 | Ga0207709_10002697 | Ga0207709_100026972 | 246 |
| 305 | 3300025936 | Ga0207670_10030495 | Ga0207670_100304953 | 246 |
| 306 | 3300025937 | Ga0207669_10001194 | Ga0207669_100011945 | 246 |
| 307 | 3300025937 | Ga0207669_10033173 | Ga0207669_100331733 | 246 |
| 308 | 3300025937 | Ga0207669_10068882 | Ga0207669_100688823 | 246 |
| 309 | 3300025938 | Ga0207704_10000278 | Ga0207704_1000027828 | 246 |
| 310 | 3300025938 | Ga0207704_10041624 | Ga0207704_100416242 | 246 |
| 311 | 3300025939 | Ga0207665_10004039 | Ga0207665_1000403910 | 246 |
| 312 | 3300025939 | Ga0207665_10059921 | Ga0207665_100599212 | 246 |
| 313 | 3300025940 | Ga0207691_10066489 | Ga0207691_100664893 | 246 |
| 314 | 3300025940 | Ga0207691_10171417 | Ga0207691_101714172 | 246 |
| 315 | 3300025941 | Ga0207711_10018990 | Ga0207711_100189906 | 246 |
| 316 | 3300025941 | Ga0207711_10100343 | Ga0207711_101003432 | 246 |
| 317 | 3300025944 | Ga0207661_10404055 | Ga0207661_104040551 | 246 |
| 318 | 3300025960 | Ga0207651_10386070 | Ga0207651_103860702 | 246 |
| 319 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011326 | 246 |
| 320 | 3300025961 | Ga0207712_10006873 | Ga0207712_100068737 | 246 |
| 321 | 3300025961 | Ga0207712_10127585 | Ga0207712_101275852 | 246 |
| 322 | 3300025961 | Ga0207712_10382346 | Ga0207712_103823462 | 246 |
| 323 | 3300025972 | Ga0207668_10004370 | Ga0207668_100043707 | 246 |
| 324 | 3300025972 | Ga0207668_10049188 | Ga0207668_100491882 | 246 |
| 325 | 3300025981 | Ga0207640_10002672 | Ga0207640_100026724 | 246 |
| 326 | 3300025981 | Ga0207640_10738039 | Ga0207640_107380391 | 246 |
| 327 | 3300025986 | Ga0207658_10000012 | Ga0207658_1000001250 | 246 |
| 328 | 3300025986 | Ga0207658_10004621 | Ga0207658_100046216 | 246 |
| 329 | 3300025986 | Ga0207658_10143183 | Ga0207658_101431832 | 246 |
| 330 | 3300025986 | Ga0207658_10220708 | Ga0207658_102207082 | 246 |
| 331 | 3300026023 | Ga0207677_10047312 | Ga0207677_100473122 | 246 |
| 332 | 3300026023 | Ga0207677_10170296 | Ga0207677_101702962 | 246 |
| 333 | 3300026035 | Ga0207703_10006423 | Ga0207703_100064233 | 246 |
| 334 | 3300026035 | Ga0207703_10052060 | Ga0207703_100520602 | 246 |
| 335 | 3300026041 | Ga0207639_10007999 | Ga0207639_100079992 | 246 |
| 336 | 3300026041 | Ga0207639_10038315 | Ga0207639_100383152 | 246 |
| 337 | 3300026067 | Ga0207678_10021353 | Ga0207678_100213533 | 246 |
| 338 | 3300026067 | Ga0207678_10063197 | Ga0207678_100631973 | 246 |
| 339 | 3300026067 | Ga0207678_10071676 | Ga0207678_100716762 | 246 |
| 340 | 3300026075 | Ga0207708_10006811 | Ga0207708_100068113 | 246 |
| 341 | 3300026075 | Ga0207708_10056912 | Ga0207708_100569122 | 246 |
| 342 | 3300026088 | Ga0207641_10000437 | Ga0207641_1000043728 | 246 |
| 343 | 3300026088 | Ga0207641_10046029 | Ga0207641_100460292 | 246 |
| 344 | 3300026089 | Ga0207648_10002398 | Ga0207648_100023982 | 246 |
| 345 | 3300026089 | Ga0207648_10087560 | Ga0207648_100875602 | 246 |
| 346 | 3300026095 | Ga0207676_10000003 | Ga0207676_100000031045 | 246 |
| 347 | 3300026095 | Ga0207676_10519029 | Ga0207676_105190291 | 246 |
| 348 | 3300026118 | Ga0207675_100000056 | Ga0207675_10000005657 | 246 |
| 349 | 3300026121 | Ga0207683_10000129 | Ga0207683_1000012947 | 246 |
| 350 | 3300026121 | Ga0207683_10062106 | Ga0207683_100621062 | 246 |
| 351 | 3300026142 | Ga0207698_10085929 | Ga0207698_100859292 | 246 |
| 352 | 3300026142 | Ga0207698_10130814 | Ga0207698_101308142 | 246 |
| 353 | 3300027866 | Ga0209813_10020789 | Ga0209813_100207892 | 246 |
| 354 | 3300028379 | Ga0268266_10002129 | Ga0268266_100021292 | 246 |
| 355 | 3300028379 | Ga0268266_10027584 | Ga0268266_100275842 | 246 |
| 356 | 3300028379 | Ga0268266_10242975 | Ga0268266_102429752 | 246 |
| 357 | 3300028380 | Ga0268265_10000007 | Ga0268265_10000007310 | 246 |
| 358 | 3300028380 | Ga0268265_10001254 | Ga0268265_100012543 | 246 |
| 359 | 3300028380 | Ga0268265_10038009 | Ga0268265_100380094 | 246 |
| 360 | 3300028380 | Ga0268265_10155319 | Ga0268265_101553191 | 246 |
| 361 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007441 | 246 |
| 362 | 3300028381 | Ga0268264_10000009 | Ga0268264_10000009588 | 246 |
| 363 | 3300028381 | Ga0268264_10012661 | Ga0268264_1001266110 | 246 |
| 364 | 3300028794 | Ga0307515_10042265 | Ga0307515_100422653 | 246 |
| 365 | 3300031251 | Ga0265327_10000096 | Ga0265327_10000096132 | 246 |
| 366 | 3300031507 | Ga0307509_10210238 | Ga0307509_102102382 | 246 |
| 367 | 3300031824 | Ga0307413_10099262 | Ga0307413_100992622 | 246 |
| 368 | 3300031824 | Ga0307413_10545307 | Ga0307413_105453071 | 246 |
| 369 | 3300031852 | Ga0307410_10062385 | Ga0307410_100623852 | 246 |
| 370 | 3300031901 | Ga0307406_10215058 | Ga0307406_102150582 | 246 |
| 371 | 3300031901 | Ga0307406_10233557 | Ga0307406_102335572 | 246 |
| 372 | 3300031901 | Ga0307406_10381700 | Ga0307406_103817002 | 246 |
| 373 | 3300031995 | Ga0307409_100090124 | Ga0307409_1000901242 | 246 |
| 374 | 3300031995 | Ga0307409_100719856 | Ga0307409_1007198561 | 246 |
| 375 | 3300032002 | Ga0307416_100162348 | Ga0307416_1001623482 | 246 |
| 376 | 3300035121 | Ga0373960_0035804 | Ga0373960_0035804_474_1214 | 246 |
| 377 | 3300039437 | Ga0436365_0954943 | Ga0436365_0954943_663_1403 | 246 |
| 378 | 3300041410 | Ga0439461_0029022 | Ga0439461_0029022_170_910 | 246 |
| 379 | 3300041411 | Ga0439466_0002371 | Ga0439466_0002371_141_881 | 246 |
| 380 | 3300041411 | Ga0439466_0072809 | Ga0439466_0072809_16_756 | 246 |
| 381 | 3300041413 | Ga0439465_0003768 | Ga0439465_0003768_611_1351 | 246 |
| 382 | 3300041413 | Ga0439465_0024150 | Ga0439465_0024150_928_1668 | 246 |
| 383 | 3300041413 | Ga0439465_0040827 | Ga0439465_0040827_208_948 | 246 |
| 384 | 3300041997 | Ga0439431_0005261 | Ga0439431_0005261_393_1133 | 246 |
| 385 | 3300042002 | Ga0439442_002853 | Ga0439442_002853_485_1225 | 246 |
| 386 | 3300042004 | Ga0439445_0000932 | Ga0439445_0000932_3212_3952 | 246 |
| 387 | 3300042004 | Ga0439445_0013049 | Ga0439445_0013049_719_1459 | 246 |
| 388 | 3300042435 | Ga0439434_0018676 | Ga0439434_0018676_820_1560 | 246 |
| 389 | 3300044658 | Ga0466972_0042893 | Ga0466972_0042893_253_993 | 246 |
| 390 | 3300044658 | Ga0466972_0057636 | Ga0466972_0057636_76_816 | 246 |
| 391 | 3300044658 | Ga0466972_0109485 | Ga0466972_0109485_98_838 | 246 |
| 392 | 3300044658 | Ga0466972_0160989 | Ga0466972_0160989_161_901 | 246 |
| 393 | 3300044683 | Ga0466965_0000815 | Ga0466965_0000815_6888_7628 | 246 |
| 394 | 3300044684 | Ga0466966_0015836 | Ga0466966_0015836_3727_4467 | 246 |
| 395 | 3300044684 | Ga0466966_0058415 | Ga0466966_0058415_937_1677 | 246 |
| 396 | 3300044684 | Ga0466966_0106289 | Ga0466966_0106289_648_1388 | 246 |
| 397 | 3300044693 | Ga0466961_0073423 | Ga0466961_0073423_875_1615 | 246 |
| 398 | 3300044694 | Ga0466963_0043118 | Ga0466963_0043118_189_929 | 246 |
| 399 | 3300044694 | Ga0466963_0097588 | Ga0466963_0097588_179_919 | 246 |
| 400 | 3300044694 | Ga0466963_0187608 | Ga0466963_0187608_285_1025 | 246 |
| 401 | 3300044694 | Ga0466963_0282439 | Ga0466963_0282439_381_1121 | 246 |
| 402 | 3300044735 | Ga0466968_0007837 | Ga0466968_0007837_842_1582 | 246 |
| 403 | 3300044735 | Ga0466968_0010904 | Ga0466968_0010904_1592_2332 | 246 |
| 404 | 3300044735 | Ga0466968_0027134 | Ga0466968_0027134_607_1347 | 246 |
| 405 | 3300044735 | Ga0466968_0029062 | Ga0466968_0029062_439_1179 | 246 |
| 406 | 3300044765 | Ga0466970_0007848 | Ga0466970_0007848_3467_4207 | 246 |
| 407 | 3300044765 | Ga0466970_0021458 | Ga0466970_0021458_969_1709 | 246 |
| 408 | 3300044842 | Ga0466957_0011255 | Ga0466957_0011255_1287_2027 | 246 |
| 409 | 3300044842 | Ga0466957_0012008 | Ga0466957_0012008_3619_4359 | 246 |
| 410 | 3300044842 | Ga0466957_0059405 | Ga0466957_0059405_329_1069 | 246 |
| 411 | 3300044842 | Ga0466957_0129488 | Ga0466957_0129488_333_1073 | 246 |
| 412 | 3300044901 | Ga0466960_0000085 | Ga0466960_0000085_12589_13329 | 246 |
| 413 | 3300044901 | Ga0466960_0001165 | Ga0466960_0001165_4766_5506 | 246 |
| 414 | 3300044901 | Ga0466960_0009668 | Ga0466960_0009668_187_927 | 246 |
| 415 | 3300044901 | Ga0466960_0039951 | Ga0466960_0039951_514_1254 | 246 |
| 416 | 3300045049 | Ga0466959_0013228 | Ga0466959_0013228_3652_4392 | 246 |
| 417 | 3300045049 | Ga0466959_0018177 | Ga0466959_0018177_298_1038 | 246 |
| 418 | 3300045049 | Ga0466959_0044887 | Ga0466959_0044887_2014_2754 | 246 |
| 419 | 3300045049 | Ga0466959_0132573 | Ga0466959_0132573_841_1581 | 246 |
| 420 | 3300045836 | Ga0466958_0019581 | Ga0466958_0019581_2970_3710 | 246 |
| 421 | 3300045836 | Ga0466958_0040203 | Ga0466958_0040203_732_1472 | 246 |
| 422 | 3300045836 | Ga0466958_0044770 | Ga0466958_0044770_961_1701 | 246 |
| 423 | 3300045836 | Ga0466958_0077103 | Ga0466958_0077103_1022_1762 | 246 |
| 424 | 3300045836 | Ga0466958_0089843 | Ga0466958_0089843_671_1411 | 246 |
| 425 | 3300045836 | Ga0466958_0251819 | Ga0466958_0251819_30_770 | 246 |
| 426 | 3300045976 | Ga0466967_0008554 | Ga0466967_0008554_4521_5261 | 246 |
| 427 | 3300045976 | Ga0466967_0010813 | Ga0466967_0010813_5012_5752 | 246 |
| 428 | 3300045976 | Ga0466967_0027720 | Ga0466967_0027720_2128_2868 | 246 |
| 429 | 3300045976 | Ga0466967_0047150 | Ga0466967_0047150_130_870 | 246 |
| 430 | 3300045976 | Ga0466967_0085250 | Ga0466967_0085250_1874_2614 | 246 |
| 431 | 3300045976 | Ga0466967_0173184 | Ga0466967_0173184_160_900 | 246 |
| 432 | 3300045976 | Ga0466967_0176570 | Ga0466967_0176570_182_922 | 246 |
| 433 | 3300045976 | Ga0466967_0275603 | Ga0466967_0275603_80_820 | 246 |
| 434 | 3300045976 | Ga0466967_0355057 | Ga0466967_0355057_82_834 | 246 |
| 435 | 3300046460 | Ga0495638_0001104 | Ga0495638_0001104_10876_11616 | 246 |
| 436 | 3300046460 | Ga0495638_0043710 | Ga0495638_0043710_1580_2338 | 246 |
| 437 | 3300046499 | Ga0495594_0134141 | Ga0495594_0134141_514_1254 | 246 |
| 438 | 3300046507 | Ga0495606_0023558 | Ga0495606_0023558_1588_2328 | 246 |
| 439 | 3300046524 | Ga0495648_0007572 | Ga0495648_0007572_2603_3343 | 246 |
| 440 | 3300046530 | Ga0495654_0027603 | Ga0495654_0027603_778_1518 | 246 |
| 441 | 3300046558 | Ga0495633_0024532 | Ga0495633_0024532_540_1301 | 246 |
| 442 | 3300046660 | Ga0495625_0000172 | Ga0495625_0000172_17088_17849 | 246 |
| 443 | 3300046660 | Ga0495625_0000758 | Ga0495625_0000758_4109_4864 | 246 |
| 444 | 3300046663 | Ga0495635_0180217 | Ga0495635_0180217_330_1070 | 246 |
| 445 | 3300046692 | Ga0495671_0013669 | Ga0495671_0013669_3219_3980 | 246 |
| 446 | 3300047320 | Ga0495672_0000976 | Ga0495672_0000976_2465_3205 | 246 |
| 447 | 3300047469 | Ga0495673_0002357 | Ga0495673_0002357_9621_10361 | 246 |
| 448 | 3300047472 | Ga0495686_0009872 | Ga0495686_0009872_3438_4178 | 246 |
| 449 | 3300048903 | Ga0496100_0000053 | Ga0496100_0000053_3338_4090 | 246 |
| 450 | 3300048903 | Ga0496100_0000836 | Ga0496100_0000836_12740_13531 | 246 |
| 451 | 3300048903 | Ga0496100_0027267 | Ga0496100_0027267_2418_3158 | 246 |
| 452 | 3300048903 | Ga0496100_0099470 | Ga0496100_0099470_1023_1853 | 246 |
| 453 | 3300048903 | Ga0496100_0124111 | Ga0496100_0124111_530_1270 | 246 |
| 454 | 3300048903 | Ga0496100_0155269 | Ga0496100_0155269_314_1054 | 246 |
| 455 | 3300048903 | Ga0496100_0305815 | Ga0496100_0305815_78_818 | 246 |
| 456 | 3300048904 | Ga0496101_0000056 | Ga0496101_0000056_29108_29899 | 246 |
| 457 | 3300048904 | Ga0496101_0000057 | Ga0496101_0000057_12307_13059 | 246 |
| 458 | 3300048904 | Ga0496101_0000252 | Ga0496101_0000252_4174_5004 | 246 |
| 459 | 3300048904 | Ga0496101_0004058 | Ga0496101_0004058_704_1444 | 246 |
| 460 | 3300048904 | Ga0496101_0026271 | Ga0496101_0026271_1446_2186 | 246 |
| 461 | 3300048904 | Ga0496101_0054395 | Ga0496101_0054395_1757_2497 | 246 |
| 462 | 3300048905 | Ga0496102_0000177 | Ga0496102_0000177_29333_30073 | 246 |
| 463 | 3300048905 | Ga0496102_0000249 | Ga0496102_0000249_62897_63637 | 246 |
| 464 | 3300048905 | Ga0496102_0017929 | Ga0496102_0017929_556_1296 | 246 |
| 465 | 3300048905 | Ga0496102_0025557 | Ga0496102_0025557_214_954 | 246 |
| 466 | 3300048905 | Ga0496102_0077856 | Ga0496102_0077856_1647_2387 | 246 |
| 467 | 3300048905 | Ga0496102_0090875 | Ga0496102_0090875_1356_2108 | 246 |
| 468 | 3300048905 | Ga0496102_0154064 | Ga0496102_0154064_1106_1846 | 246 |
| 469 | 3300048905 | Ga0496102_0216089 | Ga0496102_0216089_930_1760 | 246 |
| 470 | 3300048905 | Ga0496102_0255977 | Ga0496102_0255977_737_1477 | 246 |
| 471 | 3300048906 | Ga0496103_0000003 | Ga0496103_0000003_56652_57392 | 246 |
| 472 | 3300048906 | Ga0496103_0001078 | Ga0496103_0001078_16936_17676 | 246 |
| 473 | 3300048906 | Ga0496103_0001470 | Ga0496103_0001470_4837_5577 | 246 |
| 474 | 3300048906 | Ga0496103_0004296 | Ga0496103_0004296_5471_6223 | 246 |
| 475 | 3300048907 | Ga0496104_0015656 | Ga0496104_0015656_439_1269 | 246 |
| 476 | 3300048907 | Ga0496104_0026125 | Ga0496104_0026125_3520_4260 | 246 |
| 477 | 3300048908 | Ga0496105_0100068 | Ga0496105_0100068_1312_2052 | 246 |
| 478 | 3300048908 | Ga0496105_0151971 | Ga0496105_0151971_94_834 | 246 |
| 479 | 3300048908 | Ga0496105_0211328 | Ga0496105_0211328_21_884 | 246 |
| 480 | 3300048909 | Ga0496106_0000310 | Ga0496106_0000310_14679_15419 | 246 |
| 481 | 3300048909 | Ga0496106_0005090 | Ga0496106_0005090_5337_6167 | 246 |
| 482 | 3300048909 | Ga0496106_0005594 | Ga0496106_0005594_5243_5995 | 246 |
| 483 | 3300048909 | Ga0496106_0009890 | Ga0496106_0009890_770_1510 | 246 |
| 484 | 3300048909 | Ga0496106_0025658 | Ga0496106_0025658_2562_3353 | 246 |
| 485 | 3300048910 | Ga0496107_0000167 | Ga0496107_0000167_29820_30572 | 246 |
| 486 | 3300048910 | Ga0496107_0037370 | Ga0496107_0037370_2729_3469 | 246 |
| 487 | 3300048910 | Ga0496107_0041784 | Ga0496107_0041784_832_1572 | 246 |
| 488 | 3300048910 | Ga0496107_0042606 | Ga0496107_0042606_1113_1853 | 246 |
| 489 | 3300048910 | Ga0496107_0069617 | Ga0496107_0069617_1152_1982 | 246 |
| 490 | 3300048911 | Ga0496108_0000789 | Ga0496108_0000789_5706_6458 | 246 |
| 491 | 3300048911 | Ga0496108_0006969 | Ga0496108_0006969_1536_2276 | 246 |
| 492 | 3300048911 | Ga0496108_0081590 | Ga0496108_0081590_1670_2410 | 246 |
| 493 | 3300048912 | Ga0496109_0000144 | Ga0496109_0000144_3192_3944 | 246 |
| 494 | 3300048912 | Ga0496109_0008927 | Ga0496109_0008927_7085_7825 | 246 |
| 495 | 3300048913 | Ga0496110_0054868 | Ga0496110_0054868_1999_2739 | 246 |
| 496 | 3300048913 | Ga0496110_0603733 | Ga0496110_0603733_228_968 | 246 |
| 497 | 3300048913 | Ga0496110_0678054 | Ga0496110_0678054_150_890 | 246 |
| 498 | 3300048914 | Ga0496111_0057959 | Ga0496111_0057959_1154_1894 | 246 |
| 499 | 3300048915 | Ga0496112_0023396 | Ga0496112_0023396_3359_4099 | 246 |
| 500 | 3300048915 | Ga0496112_0035628 | Ga0496112_0035628_2879_3619 | 246 |
| 501 | 3300048915 | Ga0496112_0736463 | Ga0496112_0736463_141_881 | 246 |
| 502 | 3300048915 | Ga0496112_0805692 | Ga0496112_0805692_98_838 | 246 |
| 503 | 3300048916 | Ga0496113_0042423 | Ga0496113_0042423_2107_2847 | 246 |
| 504 | 3300048916 | Ga0496113_0043067 | Ga0496113_0043067_375_1115 | 246 |
| 505 | 3300048916 | Ga0496113_0088031 | Ga0496113_0088031_1601_2341 | 246 |
| 506 | 3300048916 | Ga0496113_0408277 | Ga0496113_0408277_104_844 | 246 |
| 507 | 3300048917 | Ga0496114_0003438 | Ga0496114_0003438_596_1348 | 246 |
| 508 | 3300048917 | Ga0496114_0004025 | Ga0496114_0004025_8356_9096 | 246 |
| 509 | 3300048917 | Ga0496114_0246275 | Ga0496114_0246275_513_1343 | 246 |
| 510 | 3300048918 | Ga0496115_0009423 | Ga0496115_0009423_2861_3613 | 246 |
| 511 | 3300048918 | Ga0496115_0093676 | Ga0496115_0093676_1549_2289 | 246 |
| 512 | 3300048918 | Ga0496115_0235002 | Ga0496115_0235002_445_1185 | 246 |
| 513 | 3300048919 | Ga0496116_0000013 | Ga0496116_0000013_546602_547342 | 246 |
| 514 | 3300048919 | Ga0496116_0002742 | Ga0496116_0002742_3338_4090 | 246 |
| 515 | 3300048919 | Ga0496116_0015310 | Ga0496116_0015310_4529_5269 | 246 |
| 516 | 3300048920 | Ga0496117_0000013 | Ga0496117_0000013_56652_57392 | 246 |
| 517 | 3300048920 | Ga0496117_0002764 | Ga0496117_0002764_6749_7489 | 246 |
| 518 | 3300048920 | Ga0496117_0026656 | Ga0496117_0026656_2967_3719 | 246 |
| 519 | 3300048920 | Ga0496117_0091746 | Ga0496117_0091746_320_1060 | 246 |
| 520 | 3300048921 | Ga0496118_0000011 | Ga0496118_0000011_546604_547344 | 246 |
| 521 | 3300048921 | Ga0496118_0001041 | Ga0496118_0001041_25541_26281 | 246 |
| 522 | 3300048921 | Ga0496118_0005770 | Ga0496118_0005770_12670_13410 | 246 |
| 523 | 3300048921 | Ga0496118_0014837 | Ga0496118_0014837_2967_3719 | 246 |
| 524 | 3300048922 | Ga0496119_0051911 | Ga0496119_0051911_1124_1864 | 246 |
| 525 | 3300048922 | Ga0496119_0059043 | Ga0496119_0059043_1064_1939 | 246 |
| 526 | 3300048922 | Ga0496119_0089330 | Ga0496119_0089330_987_1727 | 246 |
| 527 | 3300048922 | Ga0496119_0099397 | Ga0496119_0099397_755_1507 | 246 |
| 528 | 3300048923 | Ga0496120_0036818 | Ga0496120_0036818_352_1092 | 246 |
| 529 | 3300048923 | Ga0496120_0043410 | Ga0496120_0043410_633_1373 | 246 |
| 530 | 3300048923 | Ga0496120_0153927 | Ga0496120_0153927_172_912 | 246 |
| 531 | 3300048923 | Ga0496120_0210352 | Ga0496120_0210352_168_908 | 246 |
| 532 | 3300048924 | Ga0496121_0000060 | Ga0496121_0000060_170210_171001 | 246 |
| 533 | 3300048924 | Ga0496121_0000068 | Ga0496121_0000068_219531_220283 | 246 |
| 534 | 3300048924 | Ga0496121_0002455 | Ga0496121_0002455_759_1499 | 246 |
| 535 | 3300048925 | Ga0496122_0000085 | Ga0496122_0000085_94537_95289 | 246 |
| 536 | 3300048925 | Ga0496122_0033527 | Ga0496122_0033527_3324_4064 | 246 |
| 537 | 3300048925 | Ga0496122_0135592 | Ga0496122_0135592_595_1335 | 246 |
| 538 | 3300048926 | Ga0496123_0007823 | Ga0496123_0007823_6057_6809 | 246 |
| 539 | 3300048926 | Ga0496123_0084935 | Ga0496123_0084935_888_1628 | 246 |
| 540 | 3300048926 | Ga0496123_0089276 | Ga0496123_0089276_746_1486 | 246 |
| 541 | 3300048927 | Ga0496124_0000065 | Ga0496124_0000065_3312_4064 | 246 |
| 542 | 3300048927 | Ga0496124_0201665 | Ga0496124_0201665_325_1077 | 246 |
| 543 | 3300048928 | Ga0496125_0000008 | Ga0496125_0000008_484395_485147 | 246 |
| 544 | 3300048928 | Ga0496125_0014788 | Ga0496125_0014788_5503_6243 | 246 |
| 545 | 3300048928 | Ga0496125_0060587 | Ga0496125_0060587_2102_2854 | 246 |
| 546 | 3300048929 | Ga0496126_0000062 | Ga0496126_0000062_219531_220283 | 246 |
| 547 | 3300048929 | Ga0496126_0002515 | Ga0496126_0002515_12419_13159 | 246 |
| 548 | 3300048929 | Ga0496126_0005424 | Ga0496126_0005424_12694_13434 | 246 |
| 549 | 3300048929 | Ga0496126_0007649 | Ga0496126_0007649_9925_10665 | 246 |
| 550 | 3300048929 | Ga0496126_0020492 | Ga0496126_0020492_1905_2645 | 246 |
| 551 | 3300048929 | Ga0496126_0044950 | Ga0496126_0044950_3235_3975 | 246 |
| 552 | 3300048929 | Ga0496126_0296527 | Ga0496126_0296527_513_1253 | 246 |
| 553 | 3300049569 | Ga0501032_0002531 | Ga0501032_0002531_548_1288 | 246 |
| 554 | 3300049570 | Ga0501033_0019487 | Ga0501033_0019487_39_779 | 246 |
| 555 | 3300049571 | Ga0501034_0004496 | Ga0501034_0004496_4561_5301 | 246 |
| 556 | 3300049571 | Ga0501034_0027087 | Ga0501034_0027087_523_1263 | 246 |
| 557 | 3300049571 | Ga0501034_0345480 | Ga0501034_0345480_405_1145 | 246 |
| 558 | 3300049572 | Ga0501036_0109399 | Ga0501036_0109399_530_1270 | 246 |
| 559 | 3300049573 | Ga0501037_0016870 | Ga0501037_0016870_548_1288 | 246 |
| 560 | 3300049573 | Ga0501037_0036155 | Ga0501037_0036155_2255_2995 | 246 |
| 561 | 3300049574 | Ga0501038_0003328 | Ga0501038_0003328_13704_14444 | 246 |
| 562 | 3300049575 | Ga0501039_0016396 | Ga0501039_0016396_4510_5250 | 246 |
| 563 | 3300049579 | Ga0501043_0015144 | Ga0501043_0015144_548_1288 | 246 |
| 564 | 3300049579 | Ga0501043_0167365 | Ga0501043_0167365_641_1381 | 246 |
| 565 | 3300049580 | Ga0501046_0004510 | Ga0501046_0004510_4582_5322 | 246 |
| 566 | 3300049581 | Ga0501047_0003281 | Ga0501047_0003281_8322_9062 | 246 |
| 567 | 3300049581 | Ga0501047_0003545 | Ga0501047_0003545_13230_13970 | 246 |
| 568 | 3300049581 | Ga0501047_0549681 | Ga0501047_0549681_95_835 | 246 |
| 569 | 3300049583 | Ga0501067_0052394 | Ga0501067_0052394_48_788 | 246 |
| 570 | 3300049586 | Ga0501070_0000482 | Ga0501070_0000482_548_1288 | 246 |
| 571 | 3300049586 | Ga0501070_0000727 | Ga0501070_0000727_22644_23384 | 246 |
| 572 | 3300049589 | Ga0501073_0069478 | Ga0501073_0069478_451_1191 | 246 |
| 573 | 3300049766 | Ga0501269_005691 | Ga0501269_005691_205_1002 | 246 |
| 574 | 3300049822 | Ga0501035_0001028 | Ga0501035_0001028_8903_9643 | 246 |
| 575 | 3300049823 | Ga0501044_0005626 | Ga0501044_0005626_1546_2286 | 246 |
| 576 | 3300049823 | Ga0501044_0022865 | Ga0501044_0022865_381_1142 | 246 |
| 577 | 3300049823 | Ga0501044_0057575 | Ga0501044_0057575_2841_3581 | 246 |
| 578 | 3300049823 | Ga0501044_0119936 | Ga0501044_0119936_377_1117 | 246 |
| 579 | 3300050489 | nmdc:mga03683_82844_c1 | nmdc:mga03683_82844_c1_297_1037 | 246 |
| 580 | 3300050490 | nmdc:mga03n38_195307_c1 | nmdc:mga03n38_195307_c1_242_982 | 246 |
| 581 | 3300050490 | nmdc:mga03n38_21170_c1 | nmdc:mga03n38_21170_c1_500_1240 | 246 |
| 582 | 3300050490 | nmdc:mga03n38_239606_c1 | nmdc:mga03n38_239606_c1_194_934 | 246 |
| 583 | 3300050490 | nmdc:mga03n38_340061_c1 | nmdc:mga03n38_340061_c1_12_758 | 246 |
| 584 | 3300050490 | nmdc:mga03n38_52259_c1 | nmdc:mga03n38_52259_c1_806_1546 | 246 |
| 585 | 3300050491 | nmdc:mga00v17_181211_c1 | nmdc:mga00v17_181211_c1_185_925 | 246 |
| 586 | 3300050491 | nmdc:mga00v17_1894_c1 | nmdc:mga00v17_1894_c1_589_1329 | 246 |
| 587 | 3300050491 | nmdc:mga00v17_195664_c1 | nmdc:mga00v17_195664_c1_441_1181 | 246 |
| 588 | 3300050491 | nmdc:mga00v17_7928_c1 | nmdc:mga00v17_7928_c1_3490_4230 | 246 |
| 589 | 3300050492 | nmdc:mga0yw44_11320_c1 | nmdc:mga0yw44_11320_c1_302_1042 | 246 |
| 590 | 3300050492 | nmdc:mga0yw44_248671_c1 | nmdc:mga0yw44_248671_c1_230_970 | 246 |
| 591 | 3300050492 | nmdc:mga0yw44_3155_c1 | nmdc:mga0yw44_3155_c1_2351_3091 | 246 |
| 592 | 3300050492 | nmdc:mga0yw44_3189_c1 | nmdc:mga0yw44_3189_c1_4041_4781 | 246 |
| 593 | 3300050492 | nmdc:mga0yw44_44846_c1 | nmdc:mga0yw44_44846_c1_1267_2007 | 246 |
| 594 | 3300050492 | nmdc:mga0yw44_8456_c1 | nmdc:mga0yw44_8456_c1_2156_2896 | 246 |
| 595 | 3300050492 | nmdc:mga0yw44_90875_c1 | nmdc:mga0yw44_90875_c1_853_1593 | 246 |
| 596 | 3300050493 | nmdc:mga0k408_131690_c1 | nmdc:mga0k408_131690_c1_417_1157 | 246 |
| 597 | 3300050494 | nmdc:mga06z11_12813_c1 | nmdc:mga06z11_12813_c1_2567_3307 | 246 |
| 598 | 3300050495 | nmdc:mga04h51_24837_c1 | nmdc:mga04h51_24837_c1_589_1329 | 246 |
| 599 | 3300050496 | nmdc:mga07m45_112328_c1 | nmdc:mga07m45_112328_c1_313_1053 | 246 |
| 600 | 3300050496 | nmdc:mga07m45_11600_c1 | nmdc:mga07m45_11600_c1_50_790 | 246 |
| 601 | 3300050496 | nmdc:mga07m45_200698_c1 | nmdc:mga07m45_200698_c1_110_850 | 246 |
| 602 | 3300050496 | nmdc:mga07m45_24877_c1 | nmdc:mga07m45_24877_c1_1114_1854 | 246 |
| 603 | 3300050496 | nmdc:mga07m45_2918_c2 | nmdc:mga07m45_2918_c2_5909_6649 | 246 |
| 604 | 3300050509 | nmdc:mga0qj67_41182_c1 | nmdc:mga0qj67_41182_c1_2014_2754 | 246 |
| 605 | 3300050510 | nmdc:mga06r32_131751_c1 | nmdc:mga06r32_131751_c1_1390_2130 | 246 |
| 606 | 3300050516 | nmdc:mga0sz30_102619_c1 | nmdc:mga0sz30_102619_c1_306_1097 | 246 |
| 607 | 3300050516 | nmdc:mga0sz30_155251_c1 | nmdc:mga0sz30_155251_c1_81_821 | 246 |
| 608 | 3300050516 | nmdc:mga0sz30_22039_c1 | nmdc:mga0sz30_22039_c1_922_1662 | 246 |
| 609 | 3300050516 | nmdc:mga0sz30_3132_c1 | nmdc:mga0sz30_3132_c1_4143_4883 | 246 |
| 610 | 3300050516 | nmdc:mga0sz30_41466_c1 | nmdc:mga0sz30_41466_c1_859_1599 | 246 |
| 611 | 3300050516 | nmdc:mga0sz30_4588_c1 | nmdc:mga0sz30_4588_c1_98_838 | 246 |
| 612 | 3300050516 | nmdc:mga0sz30_55656_c1 | nmdc:mga0sz30_55656_c1_822_1562 | 246 |
| 613 | 3300053079 | Ga0500610_0022572 | Ga0500610_0022572_2182_2922 | 246 |
| 614 | 3300053087 | Ga0500643_000188 | Ga0500643_000188_32240_32995 | 246 |
| 615 | 3300053087 | Ga0500643_022210 | Ga0500643_022210_1005_1796 | 246 |
| 616 | 3300053096 | Ga0500641_0033329 | Ga0500641_0033329_195_935 | 246 |
| 617 | 3300053104 | Ga0500556_0020040 | Ga0500556_0020040_173_913 | 246 |
| 618 | 3300053108 | Ga0500562_010314 | Ga0500562_010314_1065_1805 | 246 |
| 619 | 3300053119 | Ga0500595_007848 | Ga0500595_007848_1120_1866 | 246 |
| 620 | 3300053153 | Ga0500616_0011256 | Ga0500616_0011256_1578_2318 | 246 |
| 621 | 3300053154 | Ga0500619_059017 | Ga0500619_059017_122_874 | 246 |
| 622 | 3300053157 | Ga0500624_000036 | Ga0500624_000036_91373_92134 | 246 |
| 623 | 3300053177 | Ga0500636_0253619 | Ga0500636_0253619_131_883 | 246 |
| 624 | 3300053730 | Ga0500645_000093 | Ga0500645_000093_55680_56420 | 246 |
| 625 | 3300055283 | Ga0500661_007944 | Ga0500661_007944_172_924 | 246 |
| 626 | 3300061719 | Ga0466962_0001495 | Ga0466962_0001495_4521_5261 | 246 |
| 627 | 3300061719 | Ga0466962_0038218 | Ga0466962_0038218_911_1651 | 246 |
| 628 | 3300061719 | Ga0466962_0057859 | Ga0466962_0057859_933_1673 | 246 |
| 629 | 3300061719 | Ga0466962_0253898 | Ga0466962_0253898_27_767 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4bmn-assembly1.cif.gz_B | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9498 | 4 | 243 |
| 4bmn-assembly1.cif.gz_D | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9478 | 1 | 243 |
| 7djs-assembly1.cif.gz_C | crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad | 0.9456 | 4 | 245 |
| 5itv-assembly3.cif.gz_D | crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh | 0.9438 | 1 | 246 |
| 4bmn-assembly1.cif.gz_A | apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 | 0.9435 | 1 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9669 | 4 | 190 | 3.40.50.720 |
| af_Q20012_42_307_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9589 | 7 | 187 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9566 | 4 | 181 | 3.40.50.720 |
| af_A0A0P0X9U1_21_128_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9553 | 2 | 89 | 3.40.50.720 |
| af_O16881_32_305_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9502 | 6 | 187 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A828TDA4-F1-model_v4 | deleted | 0.9971 | 1 | 246 |
|
| AF-V7KH63-F1-model_v4 | deleted | 0.9952 | 1 | 221 |
|
| AF-A0A1A6BFB4-F1-model_v4 | Oxidoreductase | 0.995 | 63 | 246 |
GO:0016491
|
| AF-A0A1A3MSA2-F1-model_v4 | deleted | 0.9918 | 87 | 246 |
|
| AF-A0A1A6BFB4-F1-model_v4 | Oxidoreductase | 0.9897 | 63 | 246 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar