F470780

General Info

Members Datasets Scaffolds Average Seq Length
629 301 608 246

Family's Representative Sequence

Representative Sequence 3300049766|Ga0501269_005691|Ga0501269_005691_205_1002
Length 265
Sequence VRSITKNFFENGGNNMGRFSGKVALVTGASSGLGAATALRLAAEGAQVFGIARNAEGLRAVQEQAQQSGGIIATASIDVGQPQQCAQAVRDCVAKFGRLDALINVAGRHDFRHTPSVTEQQWLQDLAVNLNGPFFLSQAAIPHLLEAHGNIVNVASIAGLQGQPYSAAYCSAKHGLLGLTKALAMEYMKAPLRVNAIVPGGMDTPQVQNIQIPPDVDFDLVMRSAAPRGFMHVDDVAALIAFLASDEAKAVHGSIQVIDNGKTVG

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
8 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
9 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
10 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
11 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
12 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
13 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
14 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
15 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
16 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
17 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
18 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
19 2922554459 Rhodococcus sp. 66b Isolate Unclassified
20 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
21 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
22 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
93 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
275 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
286 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
296 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
297 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.66
Metatranscriptomes 0
Isolates 3.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.94
Nodule 0.16
Rhizoplane 10.65
Rhizosphere 64.07
Stem 0
Stem Tuber 0
Unclassified 10.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1008134 3300000546 Bacteria 1129
2 JGI24737J22298_10072145 3300001990 Bacteria 1030
3 JGI24743J22301_10031981 3300001991 Bacteria 1038
4 JGI24738J21930_10033576 3300002075 Bacteria 1046
5 JGI24749J21850_1014986 3300002076 Bacteria 1087
6 JGI24744J21845_10002400 3300002077 Bacteria 3821
7 JGI24744J21845_10013718 3300002077 Bacteria 1633
8 JGI24034J26672_10001885 3300002239 Bacteria 2832
9 JGI24742J22300_10015242 3300002244 Bacteria 1293
10 JGI25165J46597_1000526 3300003214 Bacteria 35868
11 rootH2_10127436 3300003320 Bacteria 3729
12 Ga0055540_1002937 3300003792 Bacteria 8582
13 Ga0055540_1004066 3300003792 Bacteria 6783
14 Ga0065707_10090393 3300005295 Unclassified 4138
15 Ga0070676_10091353 3300005328 Bacteria 1865
16 Ga0070683_100436637 3300005329 Bacteria 1249
17 Ga0070690_100007865 3300005330 Bacteria 6115
18 Ga0070690_100117761 3300005330 Bacteria 1780
19 Ga0070670_100000017 3300005331 Bacteria 224429
20 Ga0070670_100686103 3300005331 Bacteria 920
21 Ga0070677_10020264 3300005333 Bacteria 2420
22 Ga0068869_100053124 3300005334 Bacteria 2944
23 Ga0070666_10237220 3300005335 Bacteria 1289
24 Ga0070680_100319953 3300005336 Bacteria 1317
25 Ga0070682_100045732 3300005337 Bacteria 2715
26 Ga0070682_100094360 3300005337 Bacteria 1963
27 Ga0068868_100090357 3300005338 Bacteria 2466
28 Ga0068868_100123106 3300005338 Bacteria 2116
29 Ga0070689_100017204 3300005340 Bacteria 5306
30 Ga0070692_10056348 3300005345 Bacteria 2058
31 Ga0070668_100000348 3300005347 Bacteria 30448
32 Ga0070668_100007133 3300005347 Bacteria 8281
33 Ga0070668_100395599 3300005347 Bacteria 1179
34 Ga0070669_100000420 3300005353 Bacteria 32410
35 Ga0070669_100002285 3300005353 Bacteria 13896
36 Ga0070669_100263965 3300005353 Bacteria 1375
37 Ga0070675_100134685 3300005354 Bacteria 2108
38 Ga0070671_100000173 3300005355 Bacteria 42660
39 Ga0070671_100011926 3300005355 Bacteria 6991
40 Ga0070674_100068165 3300005356 Bacteria 2505
41 Ga0070674_100074076 3300005356 Bacteria 2415
42 Ga0070673_100237947 3300005364 Bacteria 1582
43 Ga0070688_100001099 3300005365 Bacteria 13504
44 Ga0070688_100016522 3300005365 Bacteria 4221
45 Ga0070688_100070898 3300005365 Bacteria 2230
46 Ga0070659_100052685 3300005366 Bacteria 3201
47 Ga0070667_100000033 3300005367 Bacteria 175463
48 Ga0070667_100000203 3300005367 Bacteria 70031
49 Ga0070667_100002627 3300005367 Bacteria 15564
50 Ga0070667_100059843 3300005367 Bacteria 3223
51 Ga0070667_100345141 3300005367 Bacteria 1347
52 Ga0070709_10025899 3300005434 Bacteria 3469
53 Ga0070714_100081655 3300005435 Bacteria 2815
54 Ga0070714_100088977 3300005435 Bacteria 2702
55 Ga0070714_100200572 3300005435 Bacteria 1825
56 Ga0070714_100239670 3300005435 Bacteria 1674
57 Ga0070714_100406900 3300005435 Bacteria 1287
58 Ga0070710_10007428 3300005437 Bacteria 5307
59 Ga0070710_10021899 3300005437 Bacteria 3336
60 Ga0070701_10047826 3300005438 Bacteria 2204
61 Ga0070711_100002238 3300005439 Bacteria 10973
62 Ga0070711_100004016 3300005439 Bacteria 8650
63 Ga0070705_100049195 3300005440 Bacteria 2446
64 Ga0070705_100118242 3300005440 Bacteria 1707
65 Ga0070705_100712886 3300005440 Unclassified 789
66 Ga0070700_100272454 3300005441 Bacteria 1224
67 Ga0070694_100076135 3300005444 Bacteria 2323
68 Ga0070708_100390236 3300005445 Bacteria 1313
69 Ga0070708_100564515 3300005445 Bacteria 1073
70 Ga0070663_100054078 3300005455 Bacteria 2868
71 Ga0070663_100159134 3300005455 Bacteria 1737
72 Ga0070678_100046926 3300005456 Bacteria 3101
73 Ga0070662_100062999 3300005457 Bacteria 2711
74 Ga0070662_100090947 3300005457 Bacteria 2291
75 Ga0068867_100192197 3300005459 Bacteria 1629
76 Ga0070685_10000026 3300005466 Bacteria 98490
77 Ga0070707_100517552 3300005468 Bacteria 1155
78 Ga0068853_100000449 3300005539 Bacteria 28008
79 Ga0068853_100066470 3300005539 Bacteria 3131
80 Ga0070672_100040375 3300005543 Bacteria 3580
81 Ga0070672_100082638 3300005543 Bacteria 2577
82 Ga0070686_100081292 3300005544 Bacteria 2146
83 Ga0070695_100010836 3300005545 Bacteria 5446
84 Ga0070696_100004414 3300005546 Bacteria 9388
85 Ga0070696_100068171 3300005546 Bacteria 2497
86 Ga0070665_100001836 3300005548 Bacteria 24110
87 Ga0070665_100005426 3300005548 Bacteria 13151
88 Ga0070665_100038520 3300005548 Bacteria 4806
89 Ga0070665_100106305 3300005548 Bacteria 2808
90 Ga0070665_100667937 3300005548 Bacteria 1052
91 Ga0070704_100001044 3300005549 Bacteria 14300
92 Ga0070704_100618410 3300005549 Bacteria 953
93 Ga0068855_100242569 3300005563 Bacteria 2013
94 Ga0068854_100000321 3300005578 Bacteria 31597
95 Ga0068854_100534239 3300005578 Bacteria 992
96 Ga0068856_100094734 3300005614 Bacteria 2973
97 Ga0068856_100821137 3300005614 Bacteria 949
98 Ga0070702_100173446 3300005615 Bacteria 1405
99 Ga0068852_100096733 3300005616 Bacteria 2654
100 Ga0068859_100016348 3300005617 Bacteria 7454
101 Ga0068859_100092049 3300005617 Bacteria 3083
102 Ga0068859_100413498 3300005617 Bacteria 1445
103 Ga0068864_100000029 3300005618 Bacteria 224429
104 Ga0068866_10009653 3300005718 Bacteria 4106
105 Ga0068866_10018060 3300005718 Bacteria 3184
106 Ga0068861_100051568 3300005719 Bacteria 3123
107 Ga0068870_10057947 3300005840 Bacteria 2073
108 Ga0068863_100000193 3300005841 Bacteria 64832
109 Ga0068863_100001954 3300005841 Bacteria 20472
110 Ga0068863_100030472 3300005841 Bacteria 5151
111 Ga0068858_100043939 3300005842 Bacteria 4143
112 Ga0068858_100074999 3300005842 Bacteria 3141
113 Ga0068858_100129475 3300005842 Unclassified 2365
114 Ga0068860_100000010 3300005843 Bacteria 359114
115 Ga0068860_100010618 3300005843 Bacteria 9094
116 Ga0068860_100039508 3300005843 Unclassified 4513
117 Ga0068860_100049331 3300005843 Bacteria 4009
118 Ga0068862_100000205 3300005844 Bacteria 65575
119 Ga0068862_100018287 3300005844 Bacteria 5837
120 Ga0068862_100145357 3300005844 Bacteria 2107
121 Ga0081455_10164274 3300005937 Bacteria 1698
122 Ga0075365_10013585 3300006038 Bacteria 4878
123 Ga0075365_10018705 3300006038 Bacteria 4266
124 Ga0075365_10031171 3300006038 Bacteria 3419
125 Ga0075365_10039796 3300006038 Bacteria 3063
126 Ga0075365_10055298 3300006038 Bacteria 2634
127 Ga0075365_10066709 3300006038 Bacteria 2415
128 Ga0075365_10071417 3300006038 Bacteria 2337
129 Ga0075365_10126683 3300006038 Bacteria 1765
130 Ga0075368_10024160 3300006042 Bacteria 2326
131 Ga0075363_100000554 3300006048 Bacteria 12187
132 Ga0075363_100003560 3300006048 Bacteria 6655
133 Ga0075363_100011065 3300006048 Bacteria 4309
134 Ga0075363_100022370 3300006048 Bacteria 3195
135 Ga0075363_100104347 3300006048 Bacteria 1571
136 Ga0075364_10001678 3300006051 Bacteria 12156
137 Ga0075364_10004508 3300006051 Bacteria 8022
138 Ga0075364_10019518 3300006051 Bacteria 4256
139 Ga0075364_10024634 3300006051 Bacteria 3823
140 Ga0075364_10051813 3300006051 Bacteria 2681
141 Ga0075432_10014978 3300006058 Bacteria 2643
142 Ga0070715_10012635 3300006163 Bacteria 3080
143 Ga0070716_100024724 3300006173 Bacteria 3199
144 Ga0070716_100086409 3300006173 Bacteria 1886
145 Ga0070712_100000234 3300006175 Bacteria 31041
146 Ga0070712_100018426 3300006175 Bacteria 4535
147 Ga0070712_100218577 3300006175 Bacteria 1507
148 Ga0075362_10008677 3300006177 Bacteria 3902
149 Ga0075362_10046645 3300006177 Bacteria 1928
150 Ga0075367_10000654 3300006178 Bacteria 13274
151 Ga0075367_10059805 3300006178 Bacteria 2270
152 Ga0075367_10254894 3300006178 Bacteria 1101
153 Ga0075369_10005335 3300006186 Bacteria 4792
154 Ga0075369_10008693 3300006186 Bacteria 3919
155 Ga0075369_10054688 3300006186 Bacteria 1733
156 Ga0075369_10068485 3300006186 Bacteria 1560
157 Ga0075369_10095053 3300006186 Bacteria 1332
158 Ga0097621_100049630 3300006237 Bacteria 3410
159 Ga0075370_10002494 3300006353 Bacteria 8543
160 Ga0075370_10009607 3300006353 Bacteria 5031
161 Ga0075370_10023151 3300006353 Bacteria 3419
162 Ga0068871_100077502 3300006358 Bacteria 2747
163 Ga0075430_100050818 3300006846 Bacteria 3494
164 Ga0068865_100000092 3300006881 Bacteria 47619
165 Ga0097620_100016348 3300006931 Bacteria 7454
166 Ga0097620_100092043 3300006931 Bacteria 3083
167 Ga0097620_100413433 3300006931 Bacteria 1445
168 Ga0105240_10376953 3300009093 Bacteria 1603
169 Ga0105245_10000740 3300009098 Bacteria 29493
170 Ga0105247_10000082 3300009101 Bacteria 106460
171 Ga0105247_10000501 3300009101 Bacteria 32252
172 Ga0105247_10023229 3300009101 Unclassified 3736
173 Ga0105247_10089294 3300009101 Bacteria 1954
174 Ga0114129_10307259 3300009147 Bacteria 2112
175 Ga0105243_10000869 3300009148 Bacteria 28571
176 Ga0105243_10064558 3300009148 Bacteria 2938
177 Ga0105241_10512481 3300009174 Bacteria 1071
178 Ga0105242_10014536 3300009176 Bacteria 6099
179 Ga0105242_10034802 3300009176 Bacteria 4038
180 Ga0105248_10000084 3300009177 Bacteria 110380
181 Ga0105248_10010522 3300009177 Bacteria 10190
182 Ga0105248_10126492 3300009177 Bacteria 2882
183 Ga0105237_10054571 3300009545 Bacteria 4004
184 Ga0105237_10073970 3300009545 Bacteria 3399
185 Ga0105237_10226491 3300009545 Bacteria 1870
186 Ga0105237_10541311 3300009545 Bacteria 1171
187 Ga0105249_10000285 3300009553 Bacteria 52372
188 Ga0105249_10000664 3300009553 Bacteria 31235
189 Ga0105249_10038581 3300009553 Unclassified 4335
190 Ga0105239_10010411 3300010375 Bacteria 10404
191 Ga0105239_10169471 3300010375 Bacteria 2441
192 Ga0157371_10427291 3300013102 Bacteria 972
193 Ga0157369_10180450 3300013105 Bacteria 2221
194 Ga0157378_10007450 3300013297 Bacteria 9563
195 Ga0157378_10049650 3300013297 Bacteria 3733
196 Ga0163162_10070587 3300013306 Bacteria 3544
197 Ga0163162_10080920 3300013306 Bacteria 3317
198 Ga0163162_10210245 3300013306 Bacteria 2075
199 Ga0157372_10007741 3300013307 Bacteria 11413
200 Ga0163163_10001823 3300014325 Bacteria 17986
201 Ga0163163_10007947 3300014325 Bacteria 9381
202 Ga0157380_10007088 3300014326 Bacteria 7938
203 Ga0157380_10025390 3300014326 Bacteria 4493
204 Ga0157379_10020946 3300014968 Bacteria 5786
205 Ga0157379_10031502 3300014968 Bacteria 4724
206 Ga0157376_10031561 3300014969 Bacteria 4245
207 Ga0163161_10031883 3300017792 Bacteria 3758
208 Ga0163161_10087319 3300017792 Bacteria 2304
209 Ga0163161_10596108 3300017792 Bacteria 910
210 Ga0209233_1000281 3300025261 Bacteria 70619
211 Ga0209673_1043491 3300025273 Bacteria 1253
212 Ga0209051_1000569 3300025303 Bacteria 44797
213 Ga0209051_1006132 3300025303 Bacteria 6835
214 Ga0209051_1009513 3300025303 Bacteria 5001
215 Ga0209051_1011492 3300025303 Bacteria 4365
216 Ga0209051_1018781 3300025303 Bacteria 3044
217 Ga0207696_1036209 3300025711 Bacteria 1465
218 Ga0207692_10007185 3300025898 Bacteria 4551
219 Ga0207642_10074826 3300025899 Bacteria 1624
220 Ga0207642_10232949 3300025899 Bacteria 1036
221 Ga0207710_10000263 3300025900 Bacteria 43581
222 Ga0207710_10143351 3300025900 Bacteria 1155
223 Ga0207710_10170096 3300025900 Bacteria 1065
224 Ga0207688_10001118 3300025901 Bacteria 13776
225 Ga0207688_10002079 3300025901 Bacteria 10764
226 Ga0207647_10058688 3300025904 Bacteria 2356
227 Ga0207699_10117847 3300025906 Bacteria 1712
228 Ga0207699_10143443 3300025906 Bacteria 1572
229 Ga0207699_10182004 3300025906 Bacteria 1413
230 Ga0207645_10047049 3300025907 Bacteria 2755
231 Ga0207693_10000356 3300025915 Bacteria 41988
232 Ga0207693_10002084 3300025915 Bacteria 17484
233 Ga0207693_10160377 3300025915 Bacteria 1769
234 Ga0207663_10037154 3300025916 Bacteria 2934
235 Ga0207663_10060366 3300025916 Bacteria 2403
236 Ga0207660_10283338 3300025917 Bacteria 1316
237 Ga0207662_10082901 3300025918 Bacteria 1959
238 Ga0207681_10072281 3300025923 Bacteria 2409
239 Ga0207681_10075326 3300025923 Bacteria 2366
240 Ga0207650_10000003 3300025925 Bacteria 1123235
241 Ga0207687_10002709 3300025927 Bacteria 11986
242 Ga0207687_10056680 3300025927 Bacteria 2749
243 Ga0207664_10036724 3300025929 Bacteria 3787
244 Ga0207664_10114519 3300025929 Bacteria 2247
245 Ga0207644_10000057 3300025931 Bacteria 83320
246 Ga0207644_10017532 3300025931 Bacteria 4837
247 Ga0207690_10068559 3300025932 Bacteria 2438
248 Ga0207706_10059222 3300025933 Bacteria 3373
249 Ga0207706_10089356 3300025933 Bacteria 2708
250 Ga0207686_10347776 3300025934 Bacteria 1115
251 Ga0207709_10002697 3300025935 Bacteria 10980
252 Ga0207670_10030495 3300025936 Bacteria 3446
253 Ga0207669_10001194 3300025937 Bacteria 11040
254 Ga0207669_10033173 3300025937 Bacteria 2910
255 Ga0207669_10068882 3300025937 Bacteria 2212
256 Ga0207704_10000278 3300025938 Bacteria 24597
257 Ga0207704_10041624 3300025938 Bacteria 2696
258 Ga0207665_10004039 3300025939 Bacteria 9800
259 Ga0207665_10059921 3300025939 Bacteria 2577
260 Ga0207691_10066489 3300025940 Bacteria 3261
261 Ga0207691_10171417 3300025940 Bacteria 1900
262 Ga0207711_10018990 3300025941 Bacteria 5719
263 Ga0207711_10100343 3300025941 Bacteria 2560
264 Ga0207661_10404055 3300025944 Bacteria 1239
265 Ga0207651_10386070 3300025960 Bacteria 1188
266 Ga0207712_10000011 3300025961 Bacteria 412321
267 Ga0207712_10006873 3300025961 Bacteria 7182
268 Ga0207712_10127585 3300025961 Bacteria 1934
269 Ga0207712_10382346 3300025961 Bacteria 1179
270 Ga0207668_10004370 3300025972 Bacteria 8299
271 Ga0207668_10049188 3300025972 Bacteria 2896
272 Ga0207640_10002672 3300025981 Bacteria 9537
273 Ga0207640_10738039 3300025981 Bacteria 848
274 Ga0207658_10000012 3300025986 Bacteria 224402
275 Ga0207658_10004621 3300025986 Bacteria 9544
276 Ga0207658_10143183 3300025986 Bacteria 1938
277 Ga0207658_10220708 3300025986 Bacteria 1594
278 Ga0207677_10047312 3300026023 Bacteria 2887
279 Ga0207677_10170296 3300026023 Bacteria 1702
280 Ga0207703_10006423 3300026035 Bacteria 9396
281 Ga0207703_10052060 3300026035 Bacteria 3322
282 Ga0207639_10007999 3300026041 Bacteria 7223
283 Ga0207639_10038315 3300026041 Bacteria 3565
284 Ga0207678_10021353 3300026067 Bacteria 5677
285 Ga0207678_10063197 3300026067 Bacteria 3181
286 Ga0207678_10071676 3300026067 Bacteria 2971
287 Ga0207708_10006811 3300026075 Bacteria 8451
288 Ga0207708_10056912 3300026075 Bacteria 2983
289 Ga0207641_10000437 3300026088 Bacteria 47860
290 Ga0207641_10046029 3300026088 Bacteria 3677
291 Ga0207648_10002398 3300026089 Bacteria 20182
292 Ga0207648_10087560 3300026089 Bacteria 2718
293 Ga0207676_10000003 3300026095 Bacteria 1123235
294 Ga0207676_10519029 3300026095 Bacteria 1134
295 Ga0207675_100000056 3300026118 Bacteria 82104
296 Ga0207683_10000129 3300026121 Bacteria 61989
297 Ga0207683_10062106 3300026121 Bacteria 3290
298 Ga0207698_10085929 3300026142 Bacteria 2556
299 Ga0207698_10130814 3300026142 Bacteria 2144
300 Ga0209813_10020789 3300027866 Bacteria 1840
301 Ga0268266_10002129 3300028379 Bacteria 21849
302 Ga0268266_10027584 3300028379 Bacteria 4828
303 Ga0268266_10242975 3300028379 Bacteria 1662
304 Ga0268265_10000007 3300028380 Bacteria 431817
305 Ga0268265_10001254 3300028380 Bacteria 21916
306 Ga0268265_10038009 3300028380 Bacteria 3537
307 Ga0268265_10155319 3300028380 Bacteria 1935
308 Ga0268264_10000007 3300028381 Bacteria 815790
309 Ga0268264_10000009 3300028381 Bacteria 724972
310 Ga0268264_10012661 3300028381 Bacteria 6944
311 Ga0307515_10042265 3300028794 Bacteria 7138
312 Ga0307511_10006269 3300030521 Bacteria 11992
313 Ga0265327_10000096 3300031251 Bacteria 193827
314 Ga0265327_10009796 3300031251 Bacteria 6850
315 Ga0307509_10210238 3300031507 Bacteria 1771
316 Ga0307508_10019359 3300031616 Bacteria 6186
317 Ga0307413_10099262 3300031824 Bacteria 1919
318 Ga0307413_10545307 3300031824 Bacteria 940
319 Ga0307410_10062385 3300031852 Bacteria 2554
320 Ga0307406_10215058 3300031901 Bacteria 1425
321 Ga0307406_10233557 3300031901 Bacteria 1375
322 Ga0307406_10343322 3300031901 Bacteria 1164
323 Ga0307406_10381700 3300031901 Bacteria 1111
324 Ga0307409_100090124 3300031995 Bacteria 2509
325 Ga0307409_100719856 3300031995 Bacteria 999
326 Ga0307416_100162348 3300032002 Bacteria 2067
327 Ga0307411_10217531 3300032005 Bacteria 1480
328 Ga0373936_0003434 3300035113 Bacteria 5941
329 Ga0373936_0011941 3300035113 Bacteria 3297
330 Ga0373960_0035804 3300035121 Bacteria 1411
331 Ga0436365_0954943 3300039437 Bacteria 17007
332 Ga0439461_0029022 3300041410 Bacteria 1142
333 Ga0439466_0002371 3300041411 Bacteria 7381
334 Ga0439466_0072809 3300041411 Bacteria 1092
335 Ga0439465_0003768 3300041413 Bacteria 4947
336 Ga0439465_0024150 3300041413 Bacteria 1915
337 Ga0439465_0040827 3300041413 Bacteria 1500
338 Ga0439431_0005261 3300041997 Bacteria 2854
339 Ga0439442_002853 3300042002 Bacteria 3400
340 Ga0439445_0000932 3300042004 Bacteria 6212
341 Ga0439445_0013049 3300042004 Bacteria 2006
342 Ga0439434_0018676 3300042435 Bacteria 2077
343 Ga0466972_0042893 3300044658 Bacteria 2198
344 Ga0466972_0057636 3300044658 Bacteria 1865
345 Ga0466972_0109485 3300044658 Bacteria 1305
346 Ga0466972_0160989 3300044658 Bacteria 1054
347 Ga0466965_0000815 3300044683 Bacteria 11764
348 Ga0466965_0163961 3300044683 Bacteria 1166
349 Ga0466966_0015836 3300044684 Bacteria 4982
350 Ga0466966_0058415 3300044684 Bacteria 2438
351 Ga0466966_0106289 3300044684 Bacteria 1732
352 Ga0466961_0073423 3300044693 Bacteria 2169
353 Ga0466963_0043118 3300044694 Bacteria 2965
354 Ga0466963_0097588 3300044694 Bacteria 2008
355 Ga0466963_0187608 3300044694 Bacteria 1444
356 Ga0466963_0282439 3300044694 Bacteria 1167
357 Ga0466964_0149297 3300044706 Bacteria 1082
358 Ga0466968_0007837 3300044735 Bacteria 4074
359 Ga0466968_0010904 3300044735 Bacteria 3532
360 Ga0466968_0027134 3300044735 Bacteria 2355
361 Ga0466968_0029062 3300044735 Bacteria 2284
362 Ga0466970_0007848 3300044765 Bacteria 5357
363 Ga0466970_0021458 3300044765 Bacteria 3363
364 Ga0466957_0011255 3300044842 Bacteria 5153
365 Ga0466957_0012008 3300044842 Bacteria 5007
366 Ga0466957_0059405 3300044842 Bacteria 2343
367 Ga0466957_0129488 3300044842 Bacteria 1615
368 Ga0466960_0000085 3300044901 Bacteria 31262
369 Ga0466960_0001165 3300044901 Bacteria 9449
370 Ga0466960_0009668 3300044901 Bacteria 3983
371 Ga0466960_0039951 3300044901 Bacteria 2216
372 Ga0466959_0013228 3300045049 Bacteria 5977
373 Ga0466959_0018177 3300045049 Bacteria 5160
374 Ga0466959_0044887 3300045049 Bacteria 3255
375 Ga0466959_0132573 3300045049 Bacteria 1765
376 Ga0466958_0019581 3300045836 Bacteria 3941
377 Ga0466958_0040203 3300045836 Bacteria 2810
378 Ga0466958_0044770 3300045836 Bacteria 2668
379 Ga0466958_0077103 3300045836 Bacteria 2047
380 Ga0466958_0089843 3300045836 Bacteria 1900
381 Ga0466958_0251819 3300045836 Bacteria 1130
382 Ga0466967_0008554 3300045976 Bacteria 7516
383 Ga0466967_0010813 3300045976 Bacteria 6869
384 Ga0466967_0027720 3300045976 Bacteria 4716
385 Ga0466967_0047150 3300045976 Bacteria 3755
386 Ga0466967_0085250 3300045976 Bacteria 2860
387 Ga0466967_0173184 3300045976 Bacteria 2032
388 Ga0466967_0176570 3300045976 Bacteria 2012
389 Ga0466967_0275603 3300045976 Bacteria 1613
390 Ga0466967_0355057 3300045976 Bacteria 1419
391 Ga0495617_008628 3300046452 Bacteria 3510
392 Ga0495638_0000012 3300046460 Bacteria 435577
393 Ga0495638_0001104 3300046460 Bacteria 26279
394 Ga0495638_0043710 3300046460 Bacteria 2825
395 Ga0495594_0134141 3300046499 Bacteria 1403
396 Ga0495583_0001401 3300046506 Bacteria 24579
397 Ga0495606_0023558 3300046507 Bacteria 4456
398 Ga0495632_0001899 3300046519 Bacteria 16723
399 Ga0495648_0000038 3300046524 Bacteria 191612
400 Ga0495648_0007572 3300046524 Bacteria 8675
401 Ga0495648_0118988 3300046524 Bacteria 1423
402 Ga0495654_0027603 3300046530 Bacteria 2909
403 Ga0495633_0024532 3300046558 Bacteria 2979
404 Ga0495668_0019985 3300046616 Bacteria 3852
405 Ga0495668_0054394 3300046616 Bacteria 2212
406 Ga0495625_0000172 3300046660 Bacteria 101622
407 Ga0495625_0000758 3300046660 Bacteria 45114
408 Ga0495635_0180217 3300046663 Bacteria 1436
409 Ga0495671_0000034 3300046692 Bacteria 195385
410 Ga0495671_0013669 3300046692 Bacteria 4388
411 Ga0495672_0000976 3300047320 Bacteria 29616
412 Ga0495673_0000013 3300047469 Bacteria 612902
413 Ga0495673_0002357 3300047469 Bacteria 13410
414 Ga0495686_0009872 3300047472 Bacteria 6840
415 Ga0496100_0000053 3300048903 Bacteria 70913
416 Ga0496100_0000836 3300048903 Bacteria 14772
417 Ga0496100_0027267 3300048903 Bacteria 3511
418 Ga0496100_0099470 3300048903 Bacteria 2001
419 Ga0496100_0124111 3300048903 Bacteria 1810
420 Ga0496100_0155269 3300048903 Bacteria 1636
421 Ga0496100_0305815 3300048903 Bacteria 1191
422 Ga0496101_0000056 3300048904 Bacteria 135446
423 Ga0496101_0000057 3300048904 Bacteria 134204
424 Ga0496101_0000252 3300048904 Bacteria 38425
425 Ga0496101_0004058 3300048904 Bacteria 9151
426 Ga0496101_0026271 3300048904 Bacteria 4048
427 Ga0496101_0054395 3300048904 Bacteria 2890
428 Ga0496101_0169027 3300048904 Bacteria 1680
429 Ga0496102_0000177 3300048905 Bacteria 86724
430 Ga0496102_0000249 3300048905 Bacteria 70385
431 Ga0496102_0017929 3300048905 Bacteria 6210
432 Ga0496102_0025557 3300048905 Bacteria 5258
433 Ga0496102_0077856 3300048905 Bacteria 3052
434 Ga0496102_0090875 3300048905 Bacteria 2825
435 Ga0496102_0154064 3300048905 Bacteria 2160
436 Ga0496102_0216089 3300048905 Bacteria 1807
437 Ga0496102_0255977 3300048905 Bacteria 1650
438 Ga0496103_0000003 3300048906 Bacteria 603967
439 Ga0496103_0001078 3300048906 Bacteria 19063
440 Ga0496103_0001470 3300048906 Bacteria 15762
441 Ga0496103_0004296 3300048906 Bacteria 8661
442 Ga0496104_0015656 3300048907 Bacteria 6877
443 Ga0496104_0026125 3300048907 Bacteria 5387
444 Ga0496105_0100068 3300048908 Bacteria 2394
445 Ga0496105_0151971 3300048908 Bacteria 1903
446 Ga0496105_0211328 3300048908 Bacteria 1581
447 Ga0496106_0000310 3300048909 Bacteria 34363
448 Ga0496106_0005090 3300048909 Bacteria 9730
449 Ga0496106_0005594 3300048909 Bacteria 9304
450 Ga0496106_0009890 3300048909 Bacteria 7040
451 Ga0496106_0025658 3300048909 Bacteria 4387
452 Ga0496107_0000167 3300048910 Bacteria 33889
453 Ga0496107_0037370 3300048910 Bacteria 3484
454 Ga0496107_0041784 3300048910 Bacteria 3293
455 Ga0496107_0042606 3300048910 Bacteria 3260
456 Ga0496107_0069617 3300048910 Bacteria 2554
457 Ga0496108_0000789 3300048911 Bacteria 24747
458 Ga0496108_0006969 3300048911 Bacteria 9148
459 Ga0496108_0076004 3300048911 Bacteria 2838
460 Ga0496108_0081590 3300048911 Bacteria 2741
461 Ga0496109_0000144 3300048912 Bacteria 71522
462 Ga0496109_0008927 3300048912 Bacteria 8541
463 Ga0496110_0054868 3300048913 Bacteria 3505
464 Ga0496110_0603733 3300048913 Bacteria 995
465 Ga0496110_0678054 3300048913 Bacteria 931
466 Ga0496111_0057959 3300048914 Bacteria 2804
467 Ga0496112_0023396 3300048915 Bacteria 5903
468 Ga0496112_0035628 3300048915 Bacteria 4850
469 Ga0496112_0736463 3300048915 Bacteria 913
470 Ga0496112_0805692 3300048915 Bacteria 864
471 Ga0496113_0042423 3300048916 Bacteria 3362
472 Ga0496113_0043067 3300048916 Bacteria 3338
473 Ga0496113_0088031 3300048916 Bacteria 2389
474 Ga0496113_0408277 3300048916 Bacteria 1091
475 Ga0496114_0003438 3300048917 Bacteria 12146
476 Ga0496114_0004025 3300048917 Bacteria 11355
477 Ga0496114_0246275 3300048917 Bacteria 1572
478 Ga0496114_0892115 3300048917 Bacteria 770
479 Ga0496115_0009423 3300048918 Bacteria 7255
480 Ga0496115_0093676 3300048918 Bacteria 2456
481 Ga0496115_0235002 3300048918 Bacteria 1511
482 Ga0496116_0000013 3300048919 Bacteria 603993
483 Ga0496116_0002742 3300048919 Bacteria 18096
484 Ga0496116_0015310 3300048919 Bacteria 6067
485 Ga0496117_0000013 3300048920 Bacteria 603995
486 Ga0496117_0002764 3300048920 Bacteria 21490
487 Ga0496117_0026656 3300048920 Bacteria 4518
488 Ga0496117_0091746 3300048920 Bacteria 1953
489 Ga0496118_0000011 3300048921 Bacteria 603995
490 Ga0496118_0001041 3300048921 Bacteria 43205
491 Ga0496118_0005770 3300048921 Bacteria 13909
492 Ga0496118_0014837 3300048921 Bacteria 7262
493 Ga0496119_0051911 3300048922 Bacteria 2515
494 Ga0496119_0059043 3300048922 Bacteria 2307
495 Ga0496119_0089330 3300048922 Bacteria 1754
496 Ga0496119_0099397 3300048922 Bacteria 1636
497 Ga0496120_0036818 3300048923 Bacteria 2908
498 Ga0496120_0043410 3300048923 Bacteria 2619
499 Ga0496120_0153927 3300048923 Bacteria 1153
500 Ga0496120_0210352 3300048923 Bacteria 935
501 Ga0496121_0000060 3300048924 Bacteria 276682
502 Ga0496121_0000068 3300048924 Bacteria 259210
503 Ga0496121_0002455 3300048924 Bacteria 28318
504 Ga0496122_0000085 3300048925 Bacteria 208310
505 Ga0496122_0033527 3300048925 Bacteria 4221
506 Ga0496122_0135592 3300048925 Bacteria 1552
507 Ga0496123_0007823 3300048926 Bacteria 9950
508 Ga0496123_0084935 3300048926 Bacteria 1906
509 Ga0496123_0089276 3300048926 Bacteria 1836
510 Ga0496124_0000065 3300048927 Bacteria 223594
511 Ga0496124_0201665 3300048927 Unclassified 1512
512 Ga0496125_0000008 3300048928 Bacteria 704677
513 Ga0496125_0014788 3300048928 Bacteria 7580
514 Ga0496125_0023518 3300048928 Bacteria 5685
515 Ga0496125_0060587 3300048928 Unclassified 3040
516 Ga0496126_0000062 3300048929 Bacteria 259210
517 Ga0496126_0002515 3300048929 Bacteria 24558
518 Ga0496126_0005424 3300048929 Bacteria 14548
519 Ga0496126_0007649 3300048929 Bacteria 11792
520 Ga0496126_0020492 3300048929 Bacteria 6478
521 Ga0496126_0044950 3300048929 Bacteria 4062
522 Ga0496126_0296527 3300048929 Bacteria 1335
523 Ga0501032_0002531 3300049569 Bacteria 14307
524 Ga0501033_0019487 3300049570 Bacteria 5129
525 Ga0501034_0004496 3300049571 Bacteria 15498
526 Ga0501034_0027087 3300049571 Bacteria 5831
527 Ga0501034_0345480 3300049571 Bacteria 1417
528 Ga0501036_0109399 3300049572 Bacteria 2335
529 Ga0501037_0016870 3300049573 Bacteria 5372
530 Ga0501037_0036155 3300049573 Bacteria 3640
531 Ga0501038_0003328 3300049574 Bacteria 14991
532 Ga0501038_0288158 3300049574 Bacteria 1291
533 Ga0501039_0016396 3300049575 Bacteria 5675
534 Ga0501043_0015144 3300049579 Bacteria 6035
535 Ga0501043_0167365 3300049579 Bacteria 1716
536 Ga0501046_0004510 3300049580 Bacteria 12619
537 Ga0501047_0003281 3300049581 Bacteria 15320
538 Ga0501047_0003545 3300049581 Bacteria 14739
539 Ga0501047_0549681 3300049581 Bacteria 979
540 Ga0501067_0052394 3300049583 Bacteria 2261
541 Ga0501070_0000482 3300049586 Bacteria 36204
542 Ga0501070_0000727 3300049586 Bacteria 30087
543 Ga0501073_0069478 3300049589 Bacteria 2454
544 Ga0501073_0496065 3300049589 Bacteria 844
545 Ga0501269_005691 3300049766 Bacteria 1498
546 Ga0501035_0001028 3300049822 Bacteria 29311
547 Ga0501044_0005626 3300049823 Bacteria 13922
548 Ga0501044_0022865 3300049823 Bacteria 6658
549 Ga0501044_0057575 3300049823 Bacteria 3988
550 Ga0501044_0119936 3300049823 Bacteria 2632
551 nmdc:mga03683_82844_c1 3300050489 Bacteria 1388
552 nmdc:mga03n38_195307_c1 3300050490 Bacteria 1045
553 nmdc:mga03n38_21170_c1 3300050490 Bacteria 2613
554 nmdc:mga03n38_239606_c1 3300050490 Bacteria 954
555 nmdc:mga03n38_340061_c1 3300050490 Bacteria 814
556 nmdc:mga03n38_52259_c1 3300050490 Bacteria 1828
557 nmdc:mga00v17_181211_c1 3300050491 Bacteria 1359
558 nmdc:mga00v17_1894_c1 3300050491 Bacteria 10830
559 nmdc:mga00v17_195664_c1 3300050491 Bacteria 1306
560 nmdc:mga00v17_7928_c1 3300050491 Bacteria 5692
561 nmdc:mga0yw44_11320_c1 3300050492 Bacteria 4598
562 nmdc:mga0yw44_248671_c1 3300050492 Bacteria 1183
563 nmdc:mga0yw44_3155_c1 3300050492 Bacteria 7235
564 nmdc:mga0yw44_3189_c1 3300050492 Bacteria 7214
565 nmdc:mga0yw44_44846_c1 3300050492 Bacteria 2647
566 nmdc:mga0yw44_8456_c1 3300050492 Bacteria 5131
567 nmdc:mga0yw44_90875_c1 3300050492 Bacteria 1929
568 nmdc:mga0k408_131690_c1 3300050493 Bacteria 1484
569 nmdc:mga06z11_12813_c1 3300050494 Bacteria 3658
570 nmdc:mga04h51_24837_c1 3300050495 Bacteria 1839
571 nmdc:mga07m45_112328_c1 3300050496 Bacteria 1570
572 nmdc:mga07m45_11600_c1 3300050496 Bacteria 4634
573 nmdc:mga07m45_200698_c1 3300050496 Bacteria 1160
574 nmdc:mga07m45_24877_c1 3300050496 Bacteria 3283
575 nmdc:mga07m45_2918_c2 3300050496 Bacteria 7019
576 nmdc:mga07m45_414007_c1 3300050496 Bacteria 782
577 nmdc:mga0qj67_10116_c2 3300050509 Bacteria 3497
578 nmdc:mga0qj67_41182_c1 3300050509 Bacteria 3632
579 nmdc:mga06r32_131751_c1 3300050510 Bacteria 2472
580 nmdc:mga0sz30_102619_c1 3300050516 Bacteria 1250
581 nmdc:mga0sz30_155251_c1 3300050516 Bacteria 1013
582 nmdc:mga0sz30_22039_c1 3300050516 Bacteria 2582
583 nmdc:mga0sz30_3132_c1 3300050516 Bacteria 5922
584 nmdc:mga0sz30_41466_c1 3300050516 Bacteria 1935
585 nmdc:mga0sz30_4588_c1 3300050516 Bacteria 5005
586 nmdc:mga0sz30_55656_c1 3300050516 Bacteria 1684
587 Ga0500610_0022572 3300053079 Bacteria 3104
588 Ga0500635_0005847 3300053080 Bacteria 3256
589 Ga0500643_000188 3300053087 Bacteria 59049
590 Ga0500643_022210 3300053087 Bacteria 2046
591 Ga0500641_0033329 3300053096 Bacteria 2044
592 Ga0500556_0020040 3300053104 Bacteria 2135
593 Ga0500562_010314 3300053108 Bacteria 2367
594 Ga0500595_007848 3300053119 Unclassified 4396
595 Ga0500652_000245 3300053131 Bacteria 20504
596 Ga0500559_0017140 3300053136 Bacteria 3058
597 Ga0500559_0134306 3300053136 Bacteria 1156
598 Ga0500616_0011256 3300053153 Bacteria 5298
599 Ga0500619_059017 3300053154 Bacteria 1259
600 Ga0500624_000036 3300053157 Bacteria 94678
601 Ga0500639_074720 3300053163 Bacteria 1718
602 Ga0500636_0253619 3300053177 Bacteria 895
603 Ga0500645_000093 3300053730 Bacteria 69740
604 Ga0500661_007944 3300055283 Unclassified 1955
605 Ga0466962_0001495 3300061719 Bacteria 10904
606 Ga0466962_0038218 3300061719 Bacteria 2298
607 Ga0466962_0057859 3300061719 Bacteria 1851
608 Ga0466962_0253898 3300061719 Bacteria 864

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_414007_c1 nmdc:mga07m45_414007_c1_115_720 201
2 3300048917 Ga0496114_0892115 Ga0496114_0892115_52_666 204
3 3300049589 Ga0501073_0496065 Ga0501073_0496065_216_830 204
4 3300048904 Ga0496101_0169027 Ga0496101_0169027_28_684 214
5 3300049574 Ga0501038_0288158 Ga0501038_0288158_400_1143 222
6 3300046452 Ga0495617_008628 Ga0495617_008628_2639_3421 223
7 3300046460 Ga0495638_0000012 Ga0495638_0000012_59234_60016 223
8 3300046519 Ga0495632_0001899 Ga0495632_0001899_6418_7200 223
9 3300046524 Ga0495648_0000038 Ga0495648_0000038_131597_132379 223
10 3300044706 Ga0466964_0149297 Ga0466964_0149297_380_1069 229
11 3300046506 Ga0495583_0001401 Ga0495583_0001401_5969_6751 229
12 3300046692 Ga0495671_0000034 Ga0495671_0000034_119410_120192 229
13 3300047469 Ga0495673_0000013 Ga0495673_0000013_192111_192893 229
14 3300053080 Ga0500635_0005847 Ga0500635_0005847_2060_2749 229
15 3300053131 Ga0500652_000245 Ga0500652_000245_495_1184 229
16 3300035113 Ga0373936_0003434 Ga0373936_0003434_1002_1763 233
17 3300046524 Ga0495648_0118988 Ga0495648_0118988_83_844 233
18 iso_pu_bacteria 2738541264 2738669417 233
19 iso_pu_bacteria 2738541356 2739148541 233
20 3300031616 Ga0307508_10019359 Ga0307508_100193595 234
21 3300053136 Ga0500559_0134306 Ga0500559_0134306_61_804 234
22 3300030521 Ga0307511_10006269 Ga0307511_1000626912 235
23 3300053163 Ga0500639_074720 Ga0500639_074720_762_1517 235
24 3300044683 Ga0466965_0163961 Ga0466965_0163961_74_826 236
25 3300003792 Ga0055540_1004066 Ga0055540_10040668 237
26 3300005367 Ga0070667_100002627 Ga0070667_10000262713 237
27 3300031251 Ga0265327_10009796 Ga0265327_100097968 237
28 3300005468 Ga0070707_100517552 Ga0070707_1005175522 238
29 3300005548 Ga0070665_100667937 Ga0070665_1006679371 238
30 3300009545 Ga0105237_10073970 Ga0105237_100739704 239
31 3300035113 Ga0373936_0011941 Ga0373936_0011941_1153_1914 239
32 iso_pu_bacteria 2547132424 2548696281 242
33 iso_pu_bacteria 2565956761 2566995958 242
34 iso_pu_bacteria 2643221687 2644488960 242
35 iso_pu_bacteria 2643221715 2644638542 242
36 iso_pu_bacteria 2738541274 2738703751 242
37 iso_pu_bacteria 2738541308 2738891599 242
38 iso_pu_bacteria 2738543028 2739330640 242
39 iso_pu_bacteria 2744054611 2744955712 242
40 iso_pu_bacteria 2842134933 2842137378 242
41 iso_pu_bacteria 2902792274 2902796929 242
42 iso_pu_bacteria 2902799365 2902799645 242
43 iso_pu_bacteria 2902810491 2902812531 242
44 iso_pu_bacteria 2902837492 2902838731 242
45 iso_pu_bacteria 2904535858 2904540594 242
46 iso_pu_bacteria 2922554459 2922554678 242
47 iso_pu_bacteria 2929212328 2929216389 242
48 iso_pu_bacteria 2939582691 2939588468 242
49 3300009147 Ga0114129_10307259 Ga0114129_103072593 243
50 3300050509 nmdc:mga0qj67_10116_c2 nmdc:mga0qj67_10116_c2_1466_2209 243
51 3300053136 Ga0500559_0017140 Ga0500559_0017140_407_1150 243
52 iso_pu_bacteria 2751185725 2753035658 243
53 iso_pu_bacteria 2751185792 2753326316 243
54 3300006058 Ga0075432_10014978 Ga0075432_100149783 245
55 3300031901 Ga0307406_10343322 Ga0307406_103433222 245
56 3300032005 Ga0307411_10217531 Ga0307411_102175312 245
57 3300046616 Ga0495668_0019985 Ga0495668_0019985_3082_3834 245
58 3300046616 Ga0495668_0054394 Ga0495668_0054394_1402_2154 245
59 3300048911 Ga0496108_0076004 Ga0496108_0076004_2017_2769 245
60 3300048928 Ga0496125_0023518 Ga0496125_0023518_1925_2677 245
61 3300000546 LJNas_1008134 LJNas_10081342 246
62 3300001990 JGI24737J22298_10072145 JGI24737J22298_100721452 246
63 3300001991 JGI24743J22301_10031981 JGI24743J22301_100319812 246
64 3300002075 JGI24738J21930_10033576 JGI24738J21930_100335762 246
65 3300002076 JGI24749J21850_1014986 JGI24749J21850_10149862 246
66 3300002077 JGI24744J21845_10002400 JGI24744J21845_100024002 246
67 3300002077 JGI24744J21845_10013718 JGI24744J21845_100137182 246
68 3300002239 JGI24034J26672_10001885 JGI24034J26672_100018853 246
69 3300002244 JGI24742J22300_10015242 JGI24742J22300_100152422 246
70 3300003214 JGI25165J46597_1000526 JGI25165J46597_100052625 246
71 3300003320 rootH2_10127436 rootH2_101274362 246
72 3300003792 Ga0055540_1002937 Ga0055540_10029375 246
73 3300005295 Ga0065707_10090393 Ga0065707_100903932 246
74 3300005328 Ga0070676_10091353 Ga0070676_100913532 246
75 3300005329 Ga0070683_100436637 Ga0070683_1004366371 246
76 3300005330 Ga0070690_100007865 Ga0070690_1000078652 246
77 3300005330 Ga0070690_100117761 Ga0070690_1001177612 246
78 3300005331 Ga0070670_100000017 Ga0070670_100000017164 246
79 3300005331 Ga0070670_100686103 Ga0070670_1006861031 246
80 3300005333 Ga0070677_10020264 Ga0070677_100202642 246
81 3300005334 Ga0068869_100053124 Ga0068869_1000531242 246
82 3300005335 Ga0070666_10237220 Ga0070666_102372201 246
83 3300005336 Ga0070680_100319953 Ga0070680_1003199532 246
84 3300005337 Ga0070682_100045732 Ga0070682_1000457323 246
85 3300005337 Ga0070682_100094360 Ga0070682_1000943602 246
86 3300005338 Ga0068868_100090357 Ga0068868_1000903573 246
87 3300005338 Ga0068868_100123106 Ga0068868_1001231062 246
88 3300005340 Ga0070689_100017204 Ga0070689_1000172047 246
89 3300005345 Ga0070692_10056348 Ga0070692_100563482 246
90 3300005347 Ga0070668_100000348 Ga0070668_1000003482 246
91 3300005347 Ga0070668_100007133 Ga0070668_1000071335 246
92 3300005347 Ga0070668_100395599 Ga0070668_1003955992 246
93 3300005353 Ga0070669_100000420 Ga0070669_1000004209 246
94 3300005353 Ga0070669_100002285 Ga0070669_10000228514 246
95 3300005353 Ga0070669_100263965 Ga0070669_1002639652 246
96 3300005354 Ga0070675_100134685 Ga0070675_1001346853 246
97 3300005355 Ga0070671_100000173 Ga0070671_10000017314 246
98 3300005355 Ga0070671_100011926 Ga0070671_1000119268 246
99 3300005356 Ga0070674_100068165 Ga0070674_1000681654 246
100 3300005356 Ga0070674_100074076 Ga0070674_1000740762 246
101 3300005364 Ga0070673_100237947 Ga0070673_1002379472 246
102 3300005365 Ga0070688_100001099 Ga0070688_1000010996 246
103 3300005365 Ga0070688_100016522 Ga0070688_1000165222 246
104 3300005365 Ga0070688_100070898 Ga0070688_1000708982 246
105 3300005366 Ga0070659_100052685 Ga0070659_1000526852 246
106 3300005367 Ga0070667_100000033 Ga0070667_1000000338 246
107 3300005367 Ga0070667_100000203 Ga0070667_10000020312 246
108 3300005367 Ga0070667_100059843 Ga0070667_1000598433 246
109 3300005367 Ga0070667_100345141 Ga0070667_1003451411 246
110 3300005434 Ga0070709_10025899 Ga0070709_100258993 246
111 3300005435 Ga0070714_100081655 Ga0070714_1000816553 246
112 3300005435 Ga0070714_100088977 Ga0070714_1000889773 246
113 3300005435 Ga0070714_100200572 Ga0070714_1002005723 246
114 3300005435 Ga0070714_100239670 Ga0070714_1002396702 246
115 3300005435 Ga0070714_100406900 Ga0070714_1004069001 246
116 3300005437 Ga0070710_10007428 Ga0070710_100074283 246
117 3300005437 Ga0070710_10021899 Ga0070710_100218993 246
118 3300005438 Ga0070701_10047826 Ga0070701_100478263 246
119 3300005439 Ga0070711_100002238 Ga0070711_1000022382 246
120 3300005439 Ga0070711_100004016 Ga0070711_1000040162 246
121 3300005440 Ga0070705_100049195 Ga0070705_1000491952 246
122 3300005440 Ga0070705_100118242 Ga0070705_1001182422 246
123 3300005440 Ga0070705_100712886 Ga0070705_1007128861 246
124 3300005441 Ga0070700_100272454 Ga0070700_1002724542 246
125 3300005444 Ga0070694_100076135 Ga0070694_1000761353 246
126 3300005445 Ga0070708_100390236 Ga0070708_1003902361 246
127 3300005445 Ga0070708_100564515 Ga0070708_1005645151 246
128 3300005455 Ga0070663_100054078 Ga0070663_1000540782 246
129 3300005455 Ga0070663_100159134 Ga0070663_1001591342 246
130 3300005456 Ga0070678_100046926 Ga0070678_1000469262 246
131 3300005457 Ga0070662_100062999 Ga0070662_1000629993 246
132 3300005457 Ga0070662_100090947 Ga0070662_1000909472 246
133 3300005459 Ga0068867_100192197 Ga0068867_1001921972 246
134 3300005466 Ga0070685_10000026 Ga0070685_1000002613 246
135 3300005539 Ga0068853_100000449 Ga0068853_10000044933 246
136 3300005539 Ga0068853_100066470 Ga0068853_1000664703 246
137 3300005543 Ga0070672_100040375 Ga0070672_1000403753 246
138 3300005543 Ga0070672_100082638 Ga0070672_1000826383 246
139 3300005544 Ga0070686_100081292 Ga0070686_1000812923 246
140 3300005545 Ga0070695_100010836 Ga0070695_1000108361 246
141 3300005546 Ga0070696_100004414 Ga0070696_1000044142 246
142 3300005546 Ga0070696_100068171 Ga0070696_1000681712 246
143 3300005548 Ga0070665_100001836 Ga0070665_10000183627 246
144 3300005548 Ga0070665_100005426 Ga0070665_1000054263 246
145 3300005548 Ga0070665_100038520 Ga0070665_1000385202 246
146 3300005548 Ga0070665_100106305 Ga0070665_1001063053 246
147 3300005549 Ga0070704_100001044 Ga0070704_1000010441 246
148 3300005549 Ga0070704_100618410 Ga0070704_1006184101 246
149 3300005563 Ga0068855_100242569 Ga0068855_1002425692 246
150 3300005578 Ga0068854_100000321 Ga0068854_10000032113 246
151 3300005578 Ga0068854_100534239 Ga0068854_1005342392 246
152 3300005614 Ga0068856_100094734 Ga0068856_1000947342 246
153 3300005614 Ga0068856_100821137 Ga0068856_1008211372 246
154 3300005615 Ga0070702_100173446 Ga0070702_1001734462 246
155 3300005616 Ga0068852_100096733 Ga0068852_1000967333 246
156 3300005617 Ga0068859_100016348 Ga0068859_1000163482 246
157 3300005617 Ga0068859_100092049 Ga0068859_1000920492 246
158 3300005617 Ga0068859_100413498 Ga0068859_1004134982 246
159 3300005618 Ga0068864_100000029 Ga0068864_10000002950 246
160 3300005718 Ga0068866_10009653 Ga0068866_100096535 246
161 3300005718 Ga0068866_10018060 Ga0068866_100180602 246
162 3300005719 Ga0068861_100051568 Ga0068861_1000515682 246
163 3300005840 Ga0068870_10057947 Ga0068870_100579472 246
164 3300005841 Ga0068863_100000193 Ga0068863_10000019342 246
165 3300005841 Ga0068863_100001954 Ga0068863_10000195411 246
166 3300005841 Ga0068863_100030472 Ga0068863_1000304723 246
167 3300005842 Ga0068858_100043939 Ga0068858_1000439395 246
168 3300005842 Ga0068858_100074999 Ga0068858_1000749993 246
169 3300005842 Ga0068858_100129475 Ga0068858_1001294752 246
170 3300005843 Ga0068860_100000010 Ga0068860_1000000109 246
171 3300005843 Ga0068860_100010618 Ga0068860_10001061814 246
172 3300005843 Ga0068860_100039508 Ga0068860_1000395082 246
173 3300005843 Ga0068860_100049331 Ga0068860_1000493311 246
174 3300005844 Ga0068862_100000205 Ga0068862_10000020540 246
175 3300005844 Ga0068862_100018287 Ga0068862_1000182872 246
176 3300005844 Ga0068862_100145357 Ga0068862_1001453573 246
177 3300005937 Ga0081455_10164274 Ga0081455_101642742 246
178 3300006038 Ga0075365_10013585 Ga0075365_100135852 246
179 3300006038 Ga0075365_10018705 Ga0075365_100187053 246
180 3300006038 Ga0075365_10031171 Ga0075365_100311713 246
181 3300006038 Ga0075365_10039796 Ga0075365_100397961 246
182 3300006038 Ga0075365_10055298 Ga0075365_100552982 246
183 3300006038 Ga0075365_10066709 Ga0075365_100667092 246
184 3300006038 Ga0075365_10071417 Ga0075365_100714171 246
185 3300006038 Ga0075365_10126683 Ga0075365_101266832 246
186 3300006042 Ga0075368_10024160 Ga0075368_100241602 246
187 3300006048 Ga0075363_100000554 Ga0075363_1000005542 246
188 3300006048 Ga0075363_100003560 Ga0075363_1000035603 246
189 3300006048 Ga0075363_100011065 Ga0075363_1000110652 246
190 3300006048 Ga0075363_100022370 Ga0075363_1000223702 246
191 3300006048 Ga0075363_100104347 Ga0075363_1001043471 246
192 3300006051 Ga0075364_10001678 Ga0075364_100016784 246
193 3300006051 Ga0075364_10004508 Ga0075364_100045088 246
194 3300006051 Ga0075364_10019518 Ga0075364_100195187 246
195 3300006051 Ga0075364_10024634 Ga0075364_100246343 246
196 3300006051 Ga0075364_10051813 Ga0075364_100518133 246
197 3300006163 Ga0070715_10012635 Ga0070715_100126353 246
198 3300006173 Ga0070716_100024724 Ga0070716_1000247242 246
199 3300006173 Ga0070716_100086409 Ga0070716_1000864092 246
200 3300006175 Ga0070712_100000234 Ga0070712_10000023421 246
201 3300006175 Ga0070712_100018426 Ga0070712_1000184262 246
202 3300006175 Ga0070712_100218577 Ga0070712_1002185772 246
203 3300006177 Ga0075362_10008677 Ga0075362_100086774 246
204 3300006177 Ga0075362_10046645 Ga0075362_100466452 246
205 3300006178 Ga0075367_10000654 Ga0075367_100006547 246
206 3300006178 Ga0075367_10059805 Ga0075367_100598052 246
207 3300006178 Ga0075367_10254894 Ga0075367_102548942 246
208 3300006186 Ga0075369_10005335 Ga0075369_100053351 246
209 3300006186 Ga0075369_10008693 Ga0075369_100086934 246
210 3300006186 Ga0075369_10054688 Ga0075369_100546882 246
211 3300006186 Ga0075369_10068485 Ga0075369_100684852 246
212 3300006186 Ga0075369_10095053 Ga0075369_100950532 246
213 3300006237 Ga0097621_100049630 Ga0097621_1000496304 246
214 3300006353 Ga0075370_10002494 Ga0075370_1000249410 246
215 3300006353 Ga0075370_10009607 Ga0075370_100096072 246
216 3300006353 Ga0075370_10023151 Ga0075370_100231514 246
217 3300006358 Ga0068871_100077502 Ga0068871_1000775023 246
218 3300006846 Ga0075430_100050818 Ga0075430_1000508183 246
219 3300006881 Ga0068865_100000092 Ga0068865_10000009224 246
220 3300006931 Ga0097620_100016348 Ga0097620_1000163488 246
221 3300006931 Ga0097620_100092043 Ga0097620_1000920432 246
222 3300006931 Ga0097620_100413433 Ga0097620_1004134332 246
223 3300009093 Ga0105240_10376953 Ga0105240_103769532 246
224 3300009098 Ga0105245_10000740 Ga0105245_1000074026 246
225 3300009101 Ga0105247_10000082 Ga0105247_1000008234 246
226 3300009101 Ga0105247_10000501 Ga0105247_100005013 246
227 3300009101 Ga0105247_10023229 Ga0105247_100232292 246
228 3300009101 Ga0105247_10089294 Ga0105247_100892942 246
229 3300009148 Ga0105243_10000869 Ga0105243_1000086912 246
230 3300009148 Ga0105243_10064558 Ga0105243_100645583 246
231 3300009174 Ga0105241_10512481 Ga0105241_105124811 246
232 3300009176 Ga0105242_10014536 Ga0105242_100145366 246
233 3300009176 Ga0105242_10034802 Ga0105242_100348023 246
234 3300009177 Ga0105248_10000084 Ga0105248_10000084101 246
235 3300009177 Ga0105248_10010522 Ga0105248_100105223 246
236 3300009177 Ga0105248_10126492 Ga0105248_101264923 246
237 3300009545 Ga0105237_10054571 Ga0105237_100545714 246
238 3300009545 Ga0105237_10226491 Ga0105237_102264912 246
239 3300009545 Ga0105237_10541311 Ga0105237_105413112 246
240 3300009553 Ga0105249_10000285 Ga0105249_100002859 246
241 3300009553 Ga0105249_10000664 Ga0105249_100006644 246
242 3300009553 Ga0105249_10038581 Ga0105249_100385813 246
243 3300010375 Ga0105239_10010411 Ga0105239_100104112 246
244 3300010375 Ga0105239_10169471 Ga0105239_101694712 246
245 3300013102 Ga0157371_10427291 Ga0157371_104272912 246
246 3300013105 Ga0157369_10180450 Ga0157369_101804502 246
247 3300013297 Ga0157378_10007450 Ga0157378_100074502 246
248 3300013297 Ga0157378_10049650 Ga0157378_100496503 246
249 3300013306 Ga0163162_10070587 Ga0163162_100705873 246
250 3300013306 Ga0163162_10080920 Ga0163162_100809204 246
251 3300013306 Ga0163162_10210245 Ga0163162_102102452 246
252 3300013307 Ga0157372_10007741 Ga0157372_1000774112 246
253 3300014325 Ga0163163_10001823 Ga0163163_100018235 246
254 3300014325 Ga0163163_10007947 Ga0163163_100079478 246
255 3300014326 Ga0157380_10007088 Ga0157380_1000708812 246
256 3300014326 Ga0157380_10025390 Ga0157380_100253903 246
257 3300014968 Ga0157379_10020946 Ga0157379_100209463 246
258 3300014968 Ga0157379_10031502 Ga0157379_100315029 246
259 3300014969 Ga0157376_10031561 Ga0157376_100315613 246
260 3300017792 Ga0163161_10031883 Ga0163161_100318832 246
261 3300017792 Ga0163161_10087319 Ga0163161_100873193 246
262 3300017792 Ga0163161_10596108 Ga0163161_105961081 246
263 3300025261 Ga0209233_1000281 Ga0209233_100028110 246
264 3300025273 Ga0209673_1043491 Ga0209673_10434912 246
265 3300025303 Ga0209051_1000569 Ga0209051_10005692 246
266 3300025303 Ga0209051_1006132 Ga0209051_10061328 246
267 3300025303 Ga0209051_1009513 Ga0209051_10095134 246
268 3300025303 Ga0209051_1011492 Ga0209051_10114922 246
269 3300025303 Ga0209051_1018781 Ga0209051_10187813 246
270 3300025711 Ga0207696_1036209 Ga0207696_10362091 246
271 3300025898 Ga0207692_10007185 Ga0207692_100071858 246
272 3300025899 Ga0207642_10074826 Ga0207642_100748263 246
273 3300025899 Ga0207642_10232949 Ga0207642_102329492 246
274 3300025900 Ga0207710_10000263 Ga0207710_1000026330 246
275 3300025900 Ga0207710_10143351 Ga0207710_101433512 246
276 3300025900 Ga0207710_10170096 Ga0207710_101700961 246
277 3300025901 Ga0207688_10001118 Ga0207688_100011184 246
278 3300025901 Ga0207688_10002079 Ga0207688_1000207914 246
279 3300025904 Ga0207647_10058688 Ga0207647_100586882 246
280 3300025906 Ga0207699_10117847 Ga0207699_101178472 246
281 3300025906 Ga0207699_10143443 Ga0207699_101434432 246
282 3300025906 Ga0207699_10182004 Ga0207699_101820042 246
283 3300025907 Ga0207645_10047049 Ga0207645_100470493 246
284 3300025915 Ga0207693_10000356 Ga0207693_1000035615 246
285 3300025915 Ga0207693_10002084 Ga0207693_1000208414 246
286 3300025915 Ga0207693_10160377 Ga0207693_101603772 246
287 3300025916 Ga0207663_10037154 Ga0207663_100371542 246
288 3300025916 Ga0207663_10060366 Ga0207663_100603663 246
289 3300025917 Ga0207660_10283338 Ga0207660_102833382 246
290 3300025918 Ga0207662_10082901 Ga0207662_100829012 246
291 3300025923 Ga0207681_10072281 Ga0207681_100722813 246
292 3300025923 Ga0207681_10075326 Ga0207681_100753262 246
293 3300025925 Ga0207650_10000003 Ga0207650_1000000350 246
294 3300025927 Ga0207687_10002709 Ga0207687_100027099 246
295 3300025927 Ga0207687_10056680 Ga0207687_100566803 246
296 3300025929 Ga0207664_10036724 Ga0207664_100367244 246
297 3300025929 Ga0207664_10114519 Ga0207664_101145192 246
298 3300025931 Ga0207644_10000057 Ga0207644_1000005713 246
299 3300025931 Ga0207644_10017532 Ga0207644_100175322 246
300 3300025932 Ga0207690_10068559 Ga0207690_100685592 246
301 3300025933 Ga0207706_10059222 Ga0207706_100592223 246
302 3300025933 Ga0207706_10089356 Ga0207706_100893563 246
303 3300025934 Ga0207686_10347776 Ga0207686_103477762 246
304 3300025935 Ga0207709_10002697 Ga0207709_100026972 246
305 3300025936 Ga0207670_10030495 Ga0207670_100304953 246
306 3300025937 Ga0207669_10001194 Ga0207669_100011945 246
307 3300025937 Ga0207669_10033173 Ga0207669_100331733 246
308 3300025937 Ga0207669_10068882 Ga0207669_100688823 246
309 3300025938 Ga0207704_10000278 Ga0207704_1000027828 246
310 3300025938 Ga0207704_10041624 Ga0207704_100416242 246
311 3300025939 Ga0207665_10004039 Ga0207665_1000403910 246
312 3300025939 Ga0207665_10059921 Ga0207665_100599212 246
313 3300025940 Ga0207691_10066489 Ga0207691_100664893 246
314 3300025940 Ga0207691_10171417 Ga0207691_101714172 246
315 3300025941 Ga0207711_10018990 Ga0207711_100189906 246
316 3300025941 Ga0207711_10100343 Ga0207711_101003432 246
317 3300025944 Ga0207661_10404055 Ga0207661_104040551 246
318 3300025960 Ga0207651_10386070 Ga0207651_103860702 246
319 3300025961 Ga0207712_10000011 Ga0207712_10000011326 246
320 3300025961 Ga0207712_10006873 Ga0207712_100068737 246
321 3300025961 Ga0207712_10127585 Ga0207712_101275852 246
322 3300025961 Ga0207712_10382346 Ga0207712_103823462 246
323 3300025972 Ga0207668_10004370 Ga0207668_100043707 246
324 3300025972 Ga0207668_10049188 Ga0207668_100491882 246
325 3300025981 Ga0207640_10002672 Ga0207640_100026724 246
326 3300025981 Ga0207640_10738039 Ga0207640_107380391 246
327 3300025986 Ga0207658_10000012 Ga0207658_1000001250 246
328 3300025986 Ga0207658_10004621 Ga0207658_100046216 246
329 3300025986 Ga0207658_10143183 Ga0207658_101431832 246
330 3300025986 Ga0207658_10220708 Ga0207658_102207082 246
331 3300026023 Ga0207677_10047312 Ga0207677_100473122 246
332 3300026023 Ga0207677_10170296 Ga0207677_101702962 246
333 3300026035 Ga0207703_10006423 Ga0207703_100064233 246
334 3300026035 Ga0207703_10052060 Ga0207703_100520602 246
335 3300026041 Ga0207639_10007999 Ga0207639_100079992 246
336 3300026041 Ga0207639_10038315 Ga0207639_100383152 246
337 3300026067 Ga0207678_10021353 Ga0207678_100213533 246
338 3300026067 Ga0207678_10063197 Ga0207678_100631973 246
339 3300026067 Ga0207678_10071676 Ga0207678_100716762 246
340 3300026075 Ga0207708_10006811 Ga0207708_100068113 246
341 3300026075 Ga0207708_10056912 Ga0207708_100569122 246
342 3300026088 Ga0207641_10000437 Ga0207641_1000043728 246
343 3300026088 Ga0207641_10046029 Ga0207641_100460292 246
344 3300026089 Ga0207648_10002398 Ga0207648_100023982 246
345 3300026089 Ga0207648_10087560 Ga0207648_100875602 246
346 3300026095 Ga0207676_10000003 Ga0207676_100000031045 246
347 3300026095 Ga0207676_10519029 Ga0207676_105190291 246
348 3300026118 Ga0207675_100000056 Ga0207675_10000005657 246
349 3300026121 Ga0207683_10000129 Ga0207683_1000012947 246
350 3300026121 Ga0207683_10062106 Ga0207683_100621062 246
351 3300026142 Ga0207698_10085929 Ga0207698_100859292 246
352 3300026142 Ga0207698_10130814 Ga0207698_101308142 246
353 3300027866 Ga0209813_10020789 Ga0209813_100207892 246
354 3300028379 Ga0268266_10002129 Ga0268266_100021292 246
355 3300028379 Ga0268266_10027584 Ga0268266_100275842 246
356 3300028379 Ga0268266_10242975 Ga0268266_102429752 246
357 3300028380 Ga0268265_10000007 Ga0268265_10000007310 246
358 3300028380 Ga0268265_10001254 Ga0268265_100012543 246
359 3300028380 Ga0268265_10038009 Ga0268265_100380094 246
360 3300028380 Ga0268265_10155319 Ga0268265_101553191 246
361 3300028381 Ga0268264_10000007 Ga0268264_10000007441 246
362 3300028381 Ga0268264_10000009 Ga0268264_10000009588 246
363 3300028381 Ga0268264_10012661 Ga0268264_1001266110 246
364 3300028794 Ga0307515_10042265 Ga0307515_100422653 246
365 3300031251 Ga0265327_10000096 Ga0265327_10000096132 246
366 3300031507 Ga0307509_10210238 Ga0307509_102102382 246
367 3300031824 Ga0307413_10099262 Ga0307413_100992622 246
368 3300031824 Ga0307413_10545307 Ga0307413_105453071 246
369 3300031852 Ga0307410_10062385 Ga0307410_100623852 246
370 3300031901 Ga0307406_10215058 Ga0307406_102150582 246
371 3300031901 Ga0307406_10233557 Ga0307406_102335572 246
372 3300031901 Ga0307406_10381700 Ga0307406_103817002 246
373 3300031995 Ga0307409_100090124 Ga0307409_1000901242 246
374 3300031995 Ga0307409_100719856 Ga0307409_1007198561 246
375 3300032002 Ga0307416_100162348 Ga0307416_1001623482 246
376 3300035121 Ga0373960_0035804 Ga0373960_0035804_474_1214 246
377 3300039437 Ga0436365_0954943 Ga0436365_0954943_663_1403 246
378 3300041410 Ga0439461_0029022 Ga0439461_0029022_170_910 246
379 3300041411 Ga0439466_0002371 Ga0439466_0002371_141_881 246
380 3300041411 Ga0439466_0072809 Ga0439466_0072809_16_756 246
381 3300041413 Ga0439465_0003768 Ga0439465_0003768_611_1351 246
382 3300041413 Ga0439465_0024150 Ga0439465_0024150_928_1668 246
383 3300041413 Ga0439465_0040827 Ga0439465_0040827_208_948 246
384 3300041997 Ga0439431_0005261 Ga0439431_0005261_393_1133 246
385 3300042002 Ga0439442_002853 Ga0439442_002853_485_1225 246
386 3300042004 Ga0439445_0000932 Ga0439445_0000932_3212_3952 246
387 3300042004 Ga0439445_0013049 Ga0439445_0013049_719_1459 246
388 3300042435 Ga0439434_0018676 Ga0439434_0018676_820_1560 246
389 3300044658 Ga0466972_0042893 Ga0466972_0042893_253_993 246
390 3300044658 Ga0466972_0057636 Ga0466972_0057636_76_816 246
391 3300044658 Ga0466972_0109485 Ga0466972_0109485_98_838 246
392 3300044658 Ga0466972_0160989 Ga0466972_0160989_161_901 246
393 3300044683 Ga0466965_0000815 Ga0466965_0000815_6888_7628 246
394 3300044684 Ga0466966_0015836 Ga0466966_0015836_3727_4467 246
395 3300044684 Ga0466966_0058415 Ga0466966_0058415_937_1677 246
396 3300044684 Ga0466966_0106289 Ga0466966_0106289_648_1388 246
397 3300044693 Ga0466961_0073423 Ga0466961_0073423_875_1615 246
398 3300044694 Ga0466963_0043118 Ga0466963_0043118_189_929 246
399 3300044694 Ga0466963_0097588 Ga0466963_0097588_179_919 246
400 3300044694 Ga0466963_0187608 Ga0466963_0187608_285_1025 246
401 3300044694 Ga0466963_0282439 Ga0466963_0282439_381_1121 246
402 3300044735 Ga0466968_0007837 Ga0466968_0007837_842_1582 246
403 3300044735 Ga0466968_0010904 Ga0466968_0010904_1592_2332 246
404 3300044735 Ga0466968_0027134 Ga0466968_0027134_607_1347 246
405 3300044735 Ga0466968_0029062 Ga0466968_0029062_439_1179 246
406 3300044765 Ga0466970_0007848 Ga0466970_0007848_3467_4207 246
407 3300044765 Ga0466970_0021458 Ga0466970_0021458_969_1709 246
408 3300044842 Ga0466957_0011255 Ga0466957_0011255_1287_2027 246
409 3300044842 Ga0466957_0012008 Ga0466957_0012008_3619_4359 246
410 3300044842 Ga0466957_0059405 Ga0466957_0059405_329_1069 246
411 3300044842 Ga0466957_0129488 Ga0466957_0129488_333_1073 246
412 3300044901 Ga0466960_0000085 Ga0466960_0000085_12589_13329 246
413 3300044901 Ga0466960_0001165 Ga0466960_0001165_4766_5506 246
414 3300044901 Ga0466960_0009668 Ga0466960_0009668_187_927 246
415 3300044901 Ga0466960_0039951 Ga0466960_0039951_514_1254 246
416 3300045049 Ga0466959_0013228 Ga0466959_0013228_3652_4392 246
417 3300045049 Ga0466959_0018177 Ga0466959_0018177_298_1038 246
418 3300045049 Ga0466959_0044887 Ga0466959_0044887_2014_2754 246
419 3300045049 Ga0466959_0132573 Ga0466959_0132573_841_1581 246
420 3300045836 Ga0466958_0019581 Ga0466958_0019581_2970_3710 246
421 3300045836 Ga0466958_0040203 Ga0466958_0040203_732_1472 246
422 3300045836 Ga0466958_0044770 Ga0466958_0044770_961_1701 246
423 3300045836 Ga0466958_0077103 Ga0466958_0077103_1022_1762 246
424 3300045836 Ga0466958_0089843 Ga0466958_0089843_671_1411 246
425 3300045836 Ga0466958_0251819 Ga0466958_0251819_30_770 246
426 3300045976 Ga0466967_0008554 Ga0466967_0008554_4521_5261 246
427 3300045976 Ga0466967_0010813 Ga0466967_0010813_5012_5752 246
428 3300045976 Ga0466967_0027720 Ga0466967_0027720_2128_2868 246
429 3300045976 Ga0466967_0047150 Ga0466967_0047150_130_870 246
430 3300045976 Ga0466967_0085250 Ga0466967_0085250_1874_2614 246
431 3300045976 Ga0466967_0173184 Ga0466967_0173184_160_900 246
432 3300045976 Ga0466967_0176570 Ga0466967_0176570_182_922 246
433 3300045976 Ga0466967_0275603 Ga0466967_0275603_80_820 246
434 3300045976 Ga0466967_0355057 Ga0466967_0355057_82_834 246
435 3300046460 Ga0495638_0001104 Ga0495638_0001104_10876_11616 246
436 3300046460 Ga0495638_0043710 Ga0495638_0043710_1580_2338 246
437 3300046499 Ga0495594_0134141 Ga0495594_0134141_514_1254 246
438 3300046507 Ga0495606_0023558 Ga0495606_0023558_1588_2328 246
439 3300046524 Ga0495648_0007572 Ga0495648_0007572_2603_3343 246
440 3300046530 Ga0495654_0027603 Ga0495654_0027603_778_1518 246
441 3300046558 Ga0495633_0024532 Ga0495633_0024532_540_1301 246
442 3300046660 Ga0495625_0000172 Ga0495625_0000172_17088_17849 246
443 3300046660 Ga0495625_0000758 Ga0495625_0000758_4109_4864 246
444 3300046663 Ga0495635_0180217 Ga0495635_0180217_330_1070 246
445 3300046692 Ga0495671_0013669 Ga0495671_0013669_3219_3980 246
446 3300047320 Ga0495672_0000976 Ga0495672_0000976_2465_3205 246
447 3300047469 Ga0495673_0002357 Ga0495673_0002357_9621_10361 246
448 3300047472 Ga0495686_0009872 Ga0495686_0009872_3438_4178 246
449 3300048903 Ga0496100_0000053 Ga0496100_0000053_3338_4090 246
450 3300048903 Ga0496100_0000836 Ga0496100_0000836_12740_13531 246
451 3300048903 Ga0496100_0027267 Ga0496100_0027267_2418_3158 246
452 3300048903 Ga0496100_0099470 Ga0496100_0099470_1023_1853 246
453 3300048903 Ga0496100_0124111 Ga0496100_0124111_530_1270 246
454 3300048903 Ga0496100_0155269 Ga0496100_0155269_314_1054 246
455 3300048903 Ga0496100_0305815 Ga0496100_0305815_78_818 246
456 3300048904 Ga0496101_0000056 Ga0496101_0000056_29108_29899 246
457 3300048904 Ga0496101_0000057 Ga0496101_0000057_12307_13059 246
458 3300048904 Ga0496101_0000252 Ga0496101_0000252_4174_5004 246
459 3300048904 Ga0496101_0004058 Ga0496101_0004058_704_1444 246
460 3300048904 Ga0496101_0026271 Ga0496101_0026271_1446_2186 246
461 3300048904 Ga0496101_0054395 Ga0496101_0054395_1757_2497 246
462 3300048905 Ga0496102_0000177 Ga0496102_0000177_29333_30073 246
463 3300048905 Ga0496102_0000249 Ga0496102_0000249_62897_63637 246
464 3300048905 Ga0496102_0017929 Ga0496102_0017929_556_1296 246
465 3300048905 Ga0496102_0025557 Ga0496102_0025557_214_954 246
466 3300048905 Ga0496102_0077856 Ga0496102_0077856_1647_2387 246
467 3300048905 Ga0496102_0090875 Ga0496102_0090875_1356_2108 246
468 3300048905 Ga0496102_0154064 Ga0496102_0154064_1106_1846 246
469 3300048905 Ga0496102_0216089 Ga0496102_0216089_930_1760 246
470 3300048905 Ga0496102_0255977 Ga0496102_0255977_737_1477 246
471 3300048906 Ga0496103_0000003 Ga0496103_0000003_56652_57392 246
472 3300048906 Ga0496103_0001078 Ga0496103_0001078_16936_17676 246
473 3300048906 Ga0496103_0001470 Ga0496103_0001470_4837_5577 246
474 3300048906 Ga0496103_0004296 Ga0496103_0004296_5471_6223 246
475 3300048907 Ga0496104_0015656 Ga0496104_0015656_439_1269 246
476 3300048907 Ga0496104_0026125 Ga0496104_0026125_3520_4260 246
477 3300048908 Ga0496105_0100068 Ga0496105_0100068_1312_2052 246
478 3300048908 Ga0496105_0151971 Ga0496105_0151971_94_834 246
479 3300048908 Ga0496105_0211328 Ga0496105_0211328_21_884 246
480 3300048909 Ga0496106_0000310 Ga0496106_0000310_14679_15419 246
481 3300048909 Ga0496106_0005090 Ga0496106_0005090_5337_6167 246
482 3300048909 Ga0496106_0005594 Ga0496106_0005594_5243_5995 246
483 3300048909 Ga0496106_0009890 Ga0496106_0009890_770_1510 246
484 3300048909 Ga0496106_0025658 Ga0496106_0025658_2562_3353 246
485 3300048910 Ga0496107_0000167 Ga0496107_0000167_29820_30572 246
486 3300048910 Ga0496107_0037370 Ga0496107_0037370_2729_3469 246
487 3300048910 Ga0496107_0041784 Ga0496107_0041784_832_1572 246
488 3300048910 Ga0496107_0042606 Ga0496107_0042606_1113_1853 246
489 3300048910 Ga0496107_0069617 Ga0496107_0069617_1152_1982 246
490 3300048911 Ga0496108_0000789 Ga0496108_0000789_5706_6458 246
491 3300048911 Ga0496108_0006969 Ga0496108_0006969_1536_2276 246
492 3300048911 Ga0496108_0081590 Ga0496108_0081590_1670_2410 246
493 3300048912 Ga0496109_0000144 Ga0496109_0000144_3192_3944 246
494 3300048912 Ga0496109_0008927 Ga0496109_0008927_7085_7825 246
495 3300048913 Ga0496110_0054868 Ga0496110_0054868_1999_2739 246
496 3300048913 Ga0496110_0603733 Ga0496110_0603733_228_968 246
497 3300048913 Ga0496110_0678054 Ga0496110_0678054_150_890 246
498 3300048914 Ga0496111_0057959 Ga0496111_0057959_1154_1894 246
499 3300048915 Ga0496112_0023396 Ga0496112_0023396_3359_4099 246
500 3300048915 Ga0496112_0035628 Ga0496112_0035628_2879_3619 246
501 3300048915 Ga0496112_0736463 Ga0496112_0736463_141_881 246
502 3300048915 Ga0496112_0805692 Ga0496112_0805692_98_838 246
503 3300048916 Ga0496113_0042423 Ga0496113_0042423_2107_2847 246
504 3300048916 Ga0496113_0043067 Ga0496113_0043067_375_1115 246
505 3300048916 Ga0496113_0088031 Ga0496113_0088031_1601_2341 246
506 3300048916 Ga0496113_0408277 Ga0496113_0408277_104_844 246
507 3300048917 Ga0496114_0003438 Ga0496114_0003438_596_1348 246
508 3300048917 Ga0496114_0004025 Ga0496114_0004025_8356_9096 246
509 3300048917 Ga0496114_0246275 Ga0496114_0246275_513_1343 246
510 3300048918 Ga0496115_0009423 Ga0496115_0009423_2861_3613 246
511 3300048918 Ga0496115_0093676 Ga0496115_0093676_1549_2289 246
512 3300048918 Ga0496115_0235002 Ga0496115_0235002_445_1185 246
513 3300048919 Ga0496116_0000013 Ga0496116_0000013_546602_547342 246
514 3300048919 Ga0496116_0002742 Ga0496116_0002742_3338_4090 246
515 3300048919 Ga0496116_0015310 Ga0496116_0015310_4529_5269 246
516 3300048920 Ga0496117_0000013 Ga0496117_0000013_56652_57392 246
517 3300048920 Ga0496117_0002764 Ga0496117_0002764_6749_7489 246
518 3300048920 Ga0496117_0026656 Ga0496117_0026656_2967_3719 246
519 3300048920 Ga0496117_0091746 Ga0496117_0091746_320_1060 246
520 3300048921 Ga0496118_0000011 Ga0496118_0000011_546604_547344 246
521 3300048921 Ga0496118_0001041 Ga0496118_0001041_25541_26281 246
522 3300048921 Ga0496118_0005770 Ga0496118_0005770_12670_13410 246
523 3300048921 Ga0496118_0014837 Ga0496118_0014837_2967_3719 246
524 3300048922 Ga0496119_0051911 Ga0496119_0051911_1124_1864 246
525 3300048922 Ga0496119_0059043 Ga0496119_0059043_1064_1939 246
526 3300048922 Ga0496119_0089330 Ga0496119_0089330_987_1727 246
527 3300048922 Ga0496119_0099397 Ga0496119_0099397_755_1507 246
528 3300048923 Ga0496120_0036818 Ga0496120_0036818_352_1092 246
529 3300048923 Ga0496120_0043410 Ga0496120_0043410_633_1373 246
530 3300048923 Ga0496120_0153927 Ga0496120_0153927_172_912 246
531 3300048923 Ga0496120_0210352 Ga0496120_0210352_168_908 246
532 3300048924 Ga0496121_0000060 Ga0496121_0000060_170210_171001 246
533 3300048924 Ga0496121_0000068 Ga0496121_0000068_219531_220283 246
534 3300048924 Ga0496121_0002455 Ga0496121_0002455_759_1499 246
535 3300048925 Ga0496122_0000085 Ga0496122_0000085_94537_95289 246
536 3300048925 Ga0496122_0033527 Ga0496122_0033527_3324_4064 246
537 3300048925 Ga0496122_0135592 Ga0496122_0135592_595_1335 246
538 3300048926 Ga0496123_0007823 Ga0496123_0007823_6057_6809 246
539 3300048926 Ga0496123_0084935 Ga0496123_0084935_888_1628 246
540 3300048926 Ga0496123_0089276 Ga0496123_0089276_746_1486 246
541 3300048927 Ga0496124_0000065 Ga0496124_0000065_3312_4064 246
542 3300048927 Ga0496124_0201665 Ga0496124_0201665_325_1077 246
543 3300048928 Ga0496125_0000008 Ga0496125_0000008_484395_485147 246
544 3300048928 Ga0496125_0014788 Ga0496125_0014788_5503_6243 246
545 3300048928 Ga0496125_0060587 Ga0496125_0060587_2102_2854 246
546 3300048929 Ga0496126_0000062 Ga0496126_0000062_219531_220283 246
547 3300048929 Ga0496126_0002515 Ga0496126_0002515_12419_13159 246
548 3300048929 Ga0496126_0005424 Ga0496126_0005424_12694_13434 246
549 3300048929 Ga0496126_0007649 Ga0496126_0007649_9925_10665 246
550 3300048929 Ga0496126_0020492 Ga0496126_0020492_1905_2645 246
551 3300048929 Ga0496126_0044950 Ga0496126_0044950_3235_3975 246
552 3300048929 Ga0496126_0296527 Ga0496126_0296527_513_1253 246
553 3300049569 Ga0501032_0002531 Ga0501032_0002531_548_1288 246
554 3300049570 Ga0501033_0019487 Ga0501033_0019487_39_779 246
555 3300049571 Ga0501034_0004496 Ga0501034_0004496_4561_5301 246
556 3300049571 Ga0501034_0027087 Ga0501034_0027087_523_1263 246
557 3300049571 Ga0501034_0345480 Ga0501034_0345480_405_1145 246
558 3300049572 Ga0501036_0109399 Ga0501036_0109399_530_1270 246
559 3300049573 Ga0501037_0016870 Ga0501037_0016870_548_1288 246
560 3300049573 Ga0501037_0036155 Ga0501037_0036155_2255_2995 246
561 3300049574 Ga0501038_0003328 Ga0501038_0003328_13704_14444 246
562 3300049575 Ga0501039_0016396 Ga0501039_0016396_4510_5250 246
563 3300049579 Ga0501043_0015144 Ga0501043_0015144_548_1288 246
564 3300049579 Ga0501043_0167365 Ga0501043_0167365_641_1381 246
565 3300049580 Ga0501046_0004510 Ga0501046_0004510_4582_5322 246
566 3300049581 Ga0501047_0003281 Ga0501047_0003281_8322_9062 246
567 3300049581 Ga0501047_0003545 Ga0501047_0003545_13230_13970 246
568 3300049581 Ga0501047_0549681 Ga0501047_0549681_95_835 246
569 3300049583 Ga0501067_0052394 Ga0501067_0052394_48_788 246
570 3300049586 Ga0501070_0000482 Ga0501070_0000482_548_1288 246
571 3300049586 Ga0501070_0000727 Ga0501070_0000727_22644_23384 246
572 3300049589 Ga0501073_0069478 Ga0501073_0069478_451_1191 246
573 3300049766 Ga0501269_005691 Ga0501269_005691_205_1002 246
574 3300049822 Ga0501035_0001028 Ga0501035_0001028_8903_9643 246
575 3300049823 Ga0501044_0005626 Ga0501044_0005626_1546_2286 246
576 3300049823 Ga0501044_0022865 Ga0501044_0022865_381_1142 246
577 3300049823 Ga0501044_0057575 Ga0501044_0057575_2841_3581 246
578 3300049823 Ga0501044_0119936 Ga0501044_0119936_377_1117 246
579 3300050489 nmdc:mga03683_82844_c1 nmdc:mga03683_82844_c1_297_1037 246
580 3300050490 nmdc:mga03n38_195307_c1 nmdc:mga03n38_195307_c1_242_982 246
581 3300050490 nmdc:mga03n38_21170_c1 nmdc:mga03n38_21170_c1_500_1240 246
582 3300050490 nmdc:mga03n38_239606_c1 nmdc:mga03n38_239606_c1_194_934 246
583 3300050490 nmdc:mga03n38_340061_c1 nmdc:mga03n38_340061_c1_12_758 246
584 3300050490 nmdc:mga03n38_52259_c1 nmdc:mga03n38_52259_c1_806_1546 246
585 3300050491 nmdc:mga00v17_181211_c1 nmdc:mga00v17_181211_c1_185_925 246
586 3300050491 nmdc:mga00v17_1894_c1 nmdc:mga00v17_1894_c1_589_1329 246
587 3300050491 nmdc:mga00v17_195664_c1 nmdc:mga00v17_195664_c1_441_1181 246
588 3300050491 nmdc:mga00v17_7928_c1 nmdc:mga00v17_7928_c1_3490_4230 246
589 3300050492 nmdc:mga0yw44_11320_c1 nmdc:mga0yw44_11320_c1_302_1042 246
590 3300050492 nmdc:mga0yw44_248671_c1 nmdc:mga0yw44_248671_c1_230_970 246
591 3300050492 nmdc:mga0yw44_3155_c1 nmdc:mga0yw44_3155_c1_2351_3091 246
592 3300050492 nmdc:mga0yw44_3189_c1 nmdc:mga0yw44_3189_c1_4041_4781 246
593 3300050492 nmdc:mga0yw44_44846_c1 nmdc:mga0yw44_44846_c1_1267_2007 246
594 3300050492 nmdc:mga0yw44_8456_c1 nmdc:mga0yw44_8456_c1_2156_2896 246
595 3300050492 nmdc:mga0yw44_90875_c1 nmdc:mga0yw44_90875_c1_853_1593 246
596 3300050493 nmdc:mga0k408_131690_c1 nmdc:mga0k408_131690_c1_417_1157 246
597 3300050494 nmdc:mga06z11_12813_c1 nmdc:mga06z11_12813_c1_2567_3307 246
598 3300050495 nmdc:mga04h51_24837_c1 nmdc:mga04h51_24837_c1_589_1329 246
599 3300050496 nmdc:mga07m45_112328_c1 nmdc:mga07m45_112328_c1_313_1053 246
600 3300050496 nmdc:mga07m45_11600_c1 nmdc:mga07m45_11600_c1_50_790 246
601 3300050496 nmdc:mga07m45_200698_c1 nmdc:mga07m45_200698_c1_110_850 246
602 3300050496 nmdc:mga07m45_24877_c1 nmdc:mga07m45_24877_c1_1114_1854 246
603 3300050496 nmdc:mga07m45_2918_c2 nmdc:mga07m45_2918_c2_5909_6649 246
604 3300050509 nmdc:mga0qj67_41182_c1 nmdc:mga0qj67_41182_c1_2014_2754 246
605 3300050510 nmdc:mga06r32_131751_c1 nmdc:mga06r32_131751_c1_1390_2130 246
606 3300050516 nmdc:mga0sz30_102619_c1 nmdc:mga0sz30_102619_c1_306_1097 246
607 3300050516 nmdc:mga0sz30_155251_c1 nmdc:mga0sz30_155251_c1_81_821 246
608 3300050516 nmdc:mga0sz30_22039_c1 nmdc:mga0sz30_22039_c1_922_1662 246
609 3300050516 nmdc:mga0sz30_3132_c1 nmdc:mga0sz30_3132_c1_4143_4883 246
610 3300050516 nmdc:mga0sz30_41466_c1 nmdc:mga0sz30_41466_c1_859_1599 246
611 3300050516 nmdc:mga0sz30_4588_c1 nmdc:mga0sz30_4588_c1_98_838 246
612 3300050516 nmdc:mga0sz30_55656_c1 nmdc:mga0sz30_55656_c1_822_1562 246
613 3300053079 Ga0500610_0022572 Ga0500610_0022572_2182_2922 246
614 3300053087 Ga0500643_000188 Ga0500643_000188_32240_32995 246
615 3300053087 Ga0500643_022210 Ga0500643_022210_1005_1796 246
616 3300053096 Ga0500641_0033329 Ga0500641_0033329_195_935 246
617 3300053104 Ga0500556_0020040 Ga0500556_0020040_173_913 246
618 3300053108 Ga0500562_010314 Ga0500562_010314_1065_1805 246
619 3300053119 Ga0500595_007848 Ga0500595_007848_1120_1866 246
620 3300053153 Ga0500616_0011256 Ga0500616_0011256_1578_2318 246
621 3300053154 Ga0500619_059017 Ga0500619_059017_122_874 246
622 3300053157 Ga0500624_000036 Ga0500624_000036_91373_92134 246
623 3300053177 Ga0500636_0253619 Ga0500636_0253619_131_883 246
624 3300053730 Ga0500645_000093 Ga0500645_000093_55680_56420 246
625 3300055283 Ga0500661_007944 Ga0500661_007944_172_924 246
626 3300061719 Ga0466962_0001495 Ga0466962_0001495_4521_5261 246
627 3300061719 Ga0466962_0038218 Ga0466962_0038218_911_1651 246
628 3300061719 Ga0466962_0057859 Ga0466962_0057859_933_1673 246
629 3300061719 Ga0466962_0253898 Ga0466962_0253898_27_767 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

22

214

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

28

263

0.95

PF08659

KR

KR domain

22

191

0.88

PF23441

17

261

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9498 4 243
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9478 1 243
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9456 4 245
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9438 1 246
4bmn-assembly1.cif.gz_A apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9435 1 242
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9669 4 190 3.40.50.720
af_Q20012_42_307_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9589 7 187 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9566 4 181 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9553 2 89 3.40.50.720
af_O16881_32_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9502 6 187 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A828TDA4-F1-model_v4 deleted 0.9971 1 246
AF-V7KH63-F1-model_v4 deleted 0.9952 1 221
AF-A0A1A6BFB4-F1-model_v4 Oxidoreductase 0.995 63 246 GO:0016491
AF-A0A1A3MSA2-F1-model_v4 deleted 0.9918 87 246
AF-A0A1A6BFB4-F1-model_v4 Oxidoreductase 0.9897 63 246 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.38 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map