F470810

General Info

Members Datasets Scaffolds Average Seq Length
630 359 1260 260

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100018930|Ga0070697_1000189306
Length 291
Sequence MAGLVPAIHVLTSHQRKTNDDNNTRPKSVESHLMDSLNPAAPPITLIPTQRSPRIWKFWGTALWGLFIFAAMFVGQIAVVAWFVLWREGPIDIAAAIHVVGGGLTISLSVIMGLPAVLAALWIAIRFSRTPFADYLALRWPSWTNLLIGVLALFVLVMGWDVLSRAAGREVAPGFMGEVLKSARADGALWLLVIAFTVAAPITEEFFARGFLYRGWSESFLGPVGAIILSSLVWTALHLQYDWFFFGEVFSIGLLLGYLRYRSNSTWLTVVVHGLNNLAAVVQTILLAGST

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
306 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
312 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
316 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
320 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
321 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
322 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
333 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
334 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
335 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
336 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
337 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
338 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
339 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
340 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
341 2643221651 Afipia sp. Root123D2 Isolate Unclassified
342 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
343 2791355199
344 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
345 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
346 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
347 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
348 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
349 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
350 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
351 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
352 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
353 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
354 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
355 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
356 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
357 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
358 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
359 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 2.06
Rhizoplane 4.92
Rhizosphere 72.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100018930 3300005536 Bacteria 5434
2 JGI25406J46586_10000853 3300003203 Bacteria 14355
3 JGI25153J46596_10000691 3300003215 Bacteria 20594
4 rootH1_10266576 3300003323 Bacteria 1399
5 JGI25404J52841_10005203 3300003659 Bacteria 2682
6 JGI25404J52841_10013261 3300003659 Bacteria 1787
7 Ga0070658_10109923 3300005327 Bacteria 2283
8 Ga0070683_100003061 3300005329 Bacteria 13452
9 Ga0070670_100123979 3300005331 Bacteria 2230
10 Ga0068869_100052116 3300005334 Bacteria 2970
11 Ga0068869_100060565 3300005334 Bacteria 2774
12 Ga0070680_100148597 3300005336 Bacteria 1967
13 Ga0070682_100199466 3300005337 Bacteria 1410
14 Ga0070689_100312718 3300005340 Bacteria 1310
15 Ga0070691_10029773 3300005341 Bacteria 2556
16 Ga0070661_100233549 3300005344 Bacteria 1414
17 Ga0070692_10194924 3300005345 Bacteria 1183
18 Ga0070668_100172559 3300005347 Bacteria 1761
19 Ga0070668_100276841 3300005347 Bacteria 1400
20 Ga0070671_100490271 3300005355 Bacteria 1056
21 Ga0070674_100004144 3300005356 Bacteria 8232
22 Ga0070659_100086928 3300005366 Bacteria 2502
23 Ga0070709_10002233 3300005434 Bacteria 10499
24 Ga0070709_10021654 3300005434 Bacteria 3747
25 Ga0070709_10050453 3300005434 Bacteria 2607
26 Ga0070709_10230242 3300005434 Bacteria 1326
27 Ga0070714_100008237 3300005435 Bacteria 8125
28 Ga0070714_100022740 3300005435 Bacteria 5144
29 Ga0070714_100165361 3300005435 Bacteria 2005
30 Ga0070714_100479050 3300005435 Bacteria 1185
31 Ga0070713_100001790 3300005436 Bacteria 13842
32 Ga0070713_100009929 3300005436 Bacteria 6853
33 Ga0070713_100077740 3300005436 Bacteria 2823
34 Ga0070713_100146135 3300005436 Bacteria 2099
35 Ga0070713_100226263 3300005436 Bacteria 1699
36 Ga0070710_10002542 3300005437 Bacteria 8659
37 Ga0070710_10246362 3300005437 Bacteria 1147
38 Ga0070711_100414607 3300005439 Bacteria 1096
39 Ga0070663_100024377 3300005455 Bacteria 4071
40 Ga0070663_100030738 3300005455 Bacteria 3685
41 Ga0070663_100033369 3300005455 Bacteria 3556
42 Ga0070663_100058380 3300005455 Bacteria 2771
43 Ga0070663_100235031 3300005455 Bacteria 1445
44 Ga0070678_100367255 3300005456 Bacteria 1242
45 Ga0070662_100394145 3300005457 Bacteria 1142
46 Ga0070681_10136865 3300005458 Bacteria 2380
47 Ga0070681_10234838 3300005458 Bacteria 1748
48 Ga0068867_100344603 3300005459 Bacteria 1242
49 Ga0070706_100373428 3300005467 Bacteria 1328
50 Ga0070706_100561204 3300005467 Bacteria 1062
51 Ga0070698_100377167 3300005471 Bacteria 1351
52 Ga0070699_100060567 3300005518 Bacteria 3280
53 Ga0070679_100242574 3300005530 Bacteria 1759
54 Ga0070679_100625705 3300005530 Bacteria 1019
55 Ga0070684_100199198 3300005535 Bacteria 1823
56 Ga0070697_100537122 3300005536 Bacteria 1025
57 Ga0068853_100036396 3300005539 Bacteria 4185
58 Ga0068853_100228228 3300005539 Bacteria 1702
59 Ga0068853_100507689 3300005539 Bacteria 1139
60 Ga0068853_100593507 3300005539 Bacteria 1051
61 Ga0070693_100116921 3300005547 Bacteria 1649
62 Ga0070665_100064873 3300005548 Bacteria 3663
63 Ga0070665_100104462 3300005548 Bacteria 2835
64 Ga0070665_100207151 3300005548 Bacteria 1962
65 Ga0068855_100093598 3300005563 Bacteria 3465
66 Ga0068855_100110749 3300005563 Bacteria 3151
67 Ga0068855_100169449 3300005563 Bacteria 2473
68 Ga0068855_100260114 3300005563 Bacteria 1933
69 Ga0068857_100078539 3300005577 Bacteria 2946
70 Ga0068856_100188455 3300005614 Bacteria 2076
71 Ga0068852_100066059 3300005616 Bacteria 3158
72 Ga0068852_100085700 3300005616 Bacteria 2807
73 Ga0068852_100149890 3300005616 Bacteria 2168
74 Ga0068859_100096291 3300005617 Bacteria 3012
75 Ga0068861_100083970 3300005719 Bacteria 2499
76 Ga0068861_100114747 3300005719 Bacteria 2163
77 Ga0068861_100516443 3300005719 Bacteria 1083
78 Ga0068870_10254690 3300005840 Bacteria 1090
79 Ga0068863_100195680 3300005841 Bacteria 1943
80 Ga0068858_100260996 3300005842 Bacteria 1646
81 Ga0068860_100175408 3300005843 Bacteria 2071
82 Ga0068862_100112782 3300005844 Bacteria 2388
83 Ga0068862_100150171 3300005844 Bacteria 2073
84 Ga0081455_10004176 3300005937 Bacteria 16283
85 Ga0081455_10010174 3300005937 Bacteria 9576
86 Ga0081455_10082583 3300005937 Bacteria 2628
87 Ga0081540_1000916 3300005983 Bacteria 26580
88 Ga0081540_1002076 3300005983 Bacteria 16707
89 Ga0081540_1007867 3300005983 Bacteria 7535
90 Ga0081540_1009948 3300005983 Bacteria 6485
91 Ga0081540_1010080 3300005983 Bacteria 6432
92 Ga0081540_1013183 3300005983 Bacteria 5392
93 Ga0081540_1023779 3300005983 Bacteria 3572
94 Ga0081540_1033556 3300005983 Bacteria 2785
95 Ga0081540_1038342 3300005983 Bacteria 2526
96 Ga0081540_1091421 3300005983 Bacteria 1338
97 Ga0081539_10000231 3300005985 Bacteria 131197
98 Ga0081539_10020813 3300005985 Bacteria 4411
99 Ga0070717_10011110 3300006028 Bacteria 6823
100 Ga0070717_10011832 3300006028 Bacteria 6639
101 Ga0070717_10155077 3300006028 Bacteria 1983
102 Ga0075365_10008505 3300006038 Bacteria 5836
103 Ga0075365_10009018 3300006038 Bacteria 5704
104 Ga0075368_10038622 3300006042 Bacteria 1869
105 Ga0075363_100004318 3300006048 Bacteria 6190
106 Ga0075364_10096502 3300006051 Bacteria 1966
107 Ga0075364_10106705 3300006051 Bacteria 1866
108 Ga0075364_10191583 3300006051 Bacteria 1385
109 Ga0070715_10001251 3300006163 Bacteria 7276
110 Ga0070716_100001709 3300006173 Bacteria 9895
111 Ga0070712_100001161 3300006175 Bacteria 15933
112 Ga0070712_100121902 3300006175 Bacteria 1963
113 Ga0075362_10031729 3300006177 Bacteria 2288
114 Ga0075367_10004932 3300006178 Bacteria 6577
115 Ga0075367_10086371 3300006178 Bacteria 1904
116 Ga0097621_100179502 3300006237 Bacteria 1829
117 Ga0075370_10005485 3300006353 Bacteria 6313
118 Ga0068871_100227010 3300006358 Bacteria 1619
119 Ga0075434_100058499 3300006871 Bacteria 3831
120 Ga0075434_100255361 3300006871 Bacteria 1772
121 Ga0097620_100096286 3300006931 Bacteria 3012
122 Ga0099794_10037474 3300007265 Bacteria 2295
123 Ga0099794_10093914 3300007265 Bacteria 1491
124 Ga0099795_10043655 3300007788 Bacteria 1605
125 Ga0099795_10044626 3300007788 Bacteria 1591
126 Ga0105240_10010935 3300009093 Bacteria 12718
127 Ga0105240_10086695 3300009093 Bacteria 3835
128 Ga0105240_10380741 3300009093 Bacteria 1594
129 Ga0105240_10393842 3300009093 Bacteria 1562
130 Ga0111539_10107307 3300009094 Bacteria 3276
131 Ga0105247_10080814 3300009101 Bacteria 2048
132 Ga0114129_10089261 3300009147 Bacteria 4273
133 Ga0105243_10021839 3300009148 Bacteria 4860
134 Ga0105243_10122579 3300009148 Bacteria 2194
135 Ga0105241_10004891 3300009174 Bacteria 9881
136 Ga0105248_10126043 3300009177 Bacteria 2889
137 Ga0105248_10234871 3300009177 Bacteria 2064
138 Ga0105237_10055128 3300009545 Bacteria 3982
139 Ga0105237_10081307 3300009545 Bacteria 3230
140 Ga0105237_10103828 3300009545 Bacteria 2834
141 Ga0105237_10301210 3300009545 Bacteria 1606
142 Ga0105237_10552242 3300009545 Bacteria 1158
143 Ga0105238_10029225 3300009551 Bacteria 5617
144 Ga0105238_10215461 3300009551 Bacteria 1896
145 Ga0105249_10177450 3300009553 Bacteria 2070
146 Ga0099796_10006618 3300010159 Bacteria 2980
147 Ga0105239_10051701 3300010375 Bacteria 4504
148 Ga0105239_10152234 3300010375 Bacteria 2582
149 Ga0105239_10176562 3300010375 Bacteria 2389
150 Ga0105239_10333746 3300010375 Bacteria 1711
151 Ga0105239_10562033 3300010375 Bacteria 1300
152 Ga0105239_10909895 3300010375 Bacteria 1010
153 Ga0105246_10326456 3300011119 Bacteria 1249
154 Ga0157370_10033888 3300013104 Bacteria 4977
155 Ga0157370_10226401 3300013104 Bacteria 1731
156 Ga0157370_10227914 3300013104 Bacteria 1725
157 Ga0157369_10020068 3300013105 Bacteria 7474
158 Ga0157369_10059704 3300013105 Bacteria 4113
159 Ga0157369_10084240 3300013105 Bacteria 3398
160 Ga0157369_10299154 3300013105 Bacteria 1674
161 Ga0157374_10305588 3300013296 Bacteria 1574
162 Ga0157374_10433744 3300013296 Bacteria 1314
163 Ga0157378_10312619 3300013297 Bacteria 1524
164 Ga0163162_10174038 3300013306 Bacteria 2277
165 Ga0163162_10697794 3300013306 Bacteria 1137
166 Ga0157372_10141856 3300013307 Bacteria 2769
167 Ga0157375_10104163 3300013308 Bacteria 2926
168 Ga0157375_10307999 3300013308 Bacteria 1748
169 Ga0163163_10368519 3300014325 Bacteria 1493
170 Ga0157380_10086780 3300014326 Bacteria 2572
171 Ga0157380_10236593 3300014326 Bacteria 1644
172 Ga0157377_10094537 3300014745 Bacteria 1771
173 Ga0157376_10222800 3300014969 Bacteria 1748
174 Ga0157376_10276499 3300014969 Bacteria 1580
175 Ga0157376_10680951 3300014969 Bacteria 1032
176 Ga0163161_10041961 3300017792 Bacteria 3289
177 Ga0213872_10038795 3300021361 Bacteria 2174
178 Ga0213876_10075853 3300021384 Bacteria 1776
179 Ga0207653_10013839 3300025885 Bacteria 2528
180 Ga0207692_10006314 3300025898 Bacteria 4803
181 Ga0207692_10059541 3300025898 Bacteria 1972
182 Ga0207692_10334133 3300025898 Bacteria 930
183 Ga0207642_10066243 3300025899 Bacteria 1700
184 Ga0207710_10017955 3300025900 Bacteria 3005
185 Ga0207710_10058250 3300025900 Bacteria 1746
186 Ga0207688_10072741 3300025901 Bacteria 1953
187 Ga0207647_10142011 3300025904 Bacteria 1407
188 Ga0207699_10032420 3300025906 Bacteria 2944
189 Ga0207699_10109690 3300025906 Bacteria 1767
190 Ga0207645_10076652 3300025907 Bacteria 2142
191 Ga0207643_10070736 3300025908 Bacteria 2007
192 Ga0207643_10207891 3300025908 Bacteria 1194
193 Ga0207707_10032881 3300025912 Bacteria 4540
194 Ga0207707_10223247 3300025912 Bacteria 1640
195 Ga0207695_10080329 3300025913 Bacteria 3302
196 Ga0207695_10119813 3300025913 Bacteria 2601
197 Ga0207695_10282252 3300025913 Bacteria 1554
198 Ga0207671_10220117 3300025914 Bacteria 1487
199 Ga0207671_10232885 3300025914 Bacteria 1445
200 Ga0207693_10002224 3300025915 Bacteria 16891
201 Ga0207693_10010627 3300025915 Bacteria 7469
202 Ga0207693_10098488 3300025915 Bacteria 2293
203 Ga0207663_10004497 3300025916 Bacteria 6939
204 Ga0207663_10076274 3300025916 Bacteria 2178
205 Ga0207660_10247507 3300025917 Bacteria 1406
206 Ga0207660_10255958 3300025917 Bacteria 1383
207 Ga0207657_10128699 3300025919 Bacteria 2077
208 Ga0207657_10238841 3300025919 Bacteria 1451
209 Ga0207649_10154426 3300025920 Bacteria 1584
210 Ga0207652_10059534 3300025921 Bacteria 3293
211 Ga0207694_10151031 3300025924 Bacteria 1871
212 Ga0207694_10208588 3300025924 Bacteria 1591
213 Ga0207650_10163541 3300025925 Bacteria 1765
214 Ga0207687_10515325 3300025927 Bacteria 1000
215 Ga0207700_10001654 3300025928 Bacteria 12677
216 Ga0207700_10043237 3300025928 Bacteria 3308
217 Ga0207700_10057360 3300025928 Bacteria 2936
218 Ga0207664_10023714 3300025929 Bacteria 4602
219 Ga0207664_10185348 3300025929 Bacteria 1789
220 Ga0207664_10695904 3300025929 Bacteria 914
221 Ga0207644_10148517 3300025931 Bacteria 1812
222 Ga0207644_10362503 3300025931 Bacteria 1179
223 Ga0207690_10195817 3300025932 Bacteria 1531
224 Ga0207690_10398114 3300025932 Bacteria 1098
225 Ga0207706_10206067 3300025933 Bacteria 1724
226 Ga0207709_10080150 3300025935 Bacteria 2102
227 Ga0207669_10002996 3300025937 Bacteria 7269
228 Ga0207704_10474287 3300025938 Bacteria 1003
229 Ga0207665_10001251 3300025939 Bacteria 17140
230 Ga0207665_10125910 3300025939 Bacteria 1814
231 Ga0207665_10331897 3300025939 Bacteria 1144
232 Ga0207691_10136105 3300025940 Bacteria 2167
233 Ga0207711_10059809 3300025941 Bacteria 3281
234 Ga0207689_10006687 3300025942 Bacteria 10172
235 Ga0207661_10001651 3300025944 Bacteria 15207
236 Ga0207679_10153634 3300025945 Bacteria 1877
237 Ga0207667_10069936 3300025949 Bacteria 3654
238 Ga0207667_10127208 3300025949 Bacteria 2625
239 Ga0207667_10187767 3300025949 Bacteria 2121
240 Ga0207667_10270002 3300025949 Bacteria 1739
241 Ga0207667_10581632 3300025949 Bacteria 1130
242 Ga0207712_10086004 3300025961 Bacteria 2303
243 Ga0207668_10013209 3300025972 Bacteria 5077
244 Ga0207668_10229939 3300025972 Bacteria 1494
245 Ga0207677_10335451 3300026023 Bacteria 1261
246 Ga0207703_10073383 3300026035 Bacteria 2831
247 Ga0207703_10660064 3300026035 Bacteria 992
248 Ga0207639_10008087 3300026041 Bacteria 7191
249 Ga0207639_10329279 3300026041 Bacteria 1358
250 Ga0207639_10457932 3300026041 Bacteria 1159
251 Ga0207639_10474916 3300026041 Bacteria 1139
252 Ga0207678_10099645 3300026067 Bacteria 2482
253 Ga0207678_10122781 3300026067 Bacteria 2216
254 Ga0207678_10143838 3300026067 Bacteria 2035
255 Ga0207678_10162232 3300026067 Bacteria 1909
256 Ga0207678_10273604 3300026067 Bacteria 1448
257 Ga0207702_10444428 3300026078 Bacteria 1257
258 Ga0207641_10520009 3300026088 Bacteria 1157
259 Ga0207648_10081718 3300026089 Bacteria 2818
260 Ga0207648_10133732 3300026089 Bacteria 2183
261 Ga0207676_10632015 3300026095 Bacteria 1031
262 Ga0207674_10091694 3300026116 Bacteria 3028
263 Ga0207674_10315174 3300026116 Bacteria 1513
264 Ga0207683_10216239 3300026121 Bacteria 1746
265 Ga0209179_1030046 3300027512 Bacteria 1109
266 Ga0209588_1028195 3300027671 Bacteria 1787
267 Ga0209813_10024321 3300027866 Bacteria 1731
268 Ga0268266_10002460 3300028379 Bacteria 19801
269 Ga0268266_10004661 3300028379 Bacteria 13065
270 Ga0268266_10015920 3300028379 Bacteria 6435
271 Ga0268265_10099590 3300028380 Bacteria 2343
272 Ga0268265_10133879 3300028380 Bacteria 2064
273 Ga0268264_10349515 3300028381 Bacteria 1407
274 Ga0307517_10000369 3300028786 Bacteria 77795
275 Ga0307515_10030519 3300028794 Bacteria 9043
276 Ga0307515_10090921 3300028794 Bacteria 3821
277 Ga0265330_10007158 3300031235 Bacteria 5465
278 Ga0265332_10084409 3300031238 Bacteria 1346
279 Ga0265328_10089627 3300031239 Bacteria 1136
280 Ga0265328_10108623 3300031239 Bacteria 1030
281 Ga0265325_10080950 3300031241 Bacteria 1614
282 Ga0265340_10000672 3300031247 Bacteria 19165
283 Ga0265339_10079649 3300031249 Bacteria 1733
284 Ga0265316_10367121 3300031344 Bacteria 1040
285 Ga0307508_10108597 3300031616 Bacteria 2374
286 Ga0265314_10123764 3300031711 Bacteria 1623
287 Ga0265342_10075248 3300031712 Bacteria 1960
288 Ga0307516_10038865 3300031730 Bacteria 4745
289 Ga0307516_10186034 3300031730 Bacteria 1807
290 Ga0307409_100299265 3300031995 Bacteria 1496
291 Ga0307510_10000998 3300033180 Bacteria 30010
292 Ga0307510_10019012 3300033180 Bacteria 8062
293 Ga0373934_0001558 3300035086 Bacteria 8414
294 Ga0373923_0001683 3300035111 Bacteria 6465
295 Ga0373936_0091225 3300035113 Bacteria 1278
296 Ga0373945_0035194 3300035116 Bacteria 1789
297 Ga0373945_0107868 3300035116 Bacteria 1096
298 Ga0373953_0000361 3300035117 Bacteria 12290
299 Ga0373954_0000316 3300035118 Bacteria 17666
300 Ga0373954_0007882 3300035118 Bacteria 4664
301 Ga0373956_0000552 3300035119 Bacteria 15350
302 Ga0373956_0099565 3300035119 Bacteria 1347
303 Ga0373957_0001213 3300035120 Bacteria 6888
304 Ga0373957_0013764 3300035120 Bacteria 2752
305 Ga0373943_0018493 3300035170 Bacteria 3203
306 Ga0373946_0023704 3300035171 Bacteria 2400
307 Ga0373955_0000487 3300035172 Bacteria 16820
308 Ga0373955_0121564 3300035172 Bacteria 1518
309 Ga0373931_0008509 3300035691 Bacteria 4870
310 Ga0373927_0000689 3300035695 Bacteria 25810
311 Ga0373927_0018091 3300035695 Bacteria 4635
312 Ga0373927_0271665 3300035695 Bacteria 1115
313 Ga0373933_0000457 3300035724 Bacteria 25599
314 Ga0373933_0002519 3300035724 Bacteria 10290
315 Ga0373933_0123293 3300035724 Bacteria 1624
316 Ga0373947_0175808 3300035725 Bacteria 1391
317 Ga0373937_0009000 3300036401 Bacteria 8667
318 Ga0373937_0054595 3300036401 Bacteria 3667
319 Ga0373937_0106364 3300036401 Bacteria 2608
320 Ga0373937_0277395 3300036401 Bacteria 1582
321 Ga0373937_0473322 3300036401 Bacteria 1190
322 Ga0373925_0012575 3300037068 Bacteria 6134
323 Ga0373925_0310041 3300037068 Bacteria 1275
324 Ga0395899_0016476 3300037312 Bacteria 5636
325 Ga0395900_0069888 3300037418 Bacteria 3610
326 Ga0395900_0086492 3300037418 Bacteria 3222
327 Ga0395900_0095571 3300037418 Bacteria 3053
328 Ga0395900_0704694 3300037418 Bacteria 943
329 Ga0395898_0069601 3300037466 Bacteria 3404
330 Ga0395905_0247717 3300037471 Bacteria 1665
331 Ga0395901_0025301 3300038443 Bacteria 6093
332 Ga0395901_0170599 3300038443 Bacteria 2283
333 Ga0436365_0093056 3300039437 Bacteria 1193
334 Ga0436365_0481530 3300039437 Bacteria 3606
335 Ga0436361_1013230 3300039447 Bacteria 2454
336 Ga0466966_0136977 3300044684 Bacteria 1497
337 Ga0466963_0025384 3300044694 Bacteria 3779
338 Ga0495592_0003091 3300046454 Bacteria 11883
339 Ga0495592_0023120 3300046454 Bacteria 4728
340 Ga0495603_0000177 3300046455 Bacteria 32632
341 Ga0495603_0009078 3300046455 Bacteria 6010
342 Ga0495603_0034092 3300046455 Bacteria 3063
343 Ga0495629_0000398 3300046459 Bacteria 36605
344 Ga0495629_0035132 3300046459 Bacteria 3543
345 Ga0495629_0076861 3300046459 Bacteria 2330
346 Ga0495638_0029482 3300046460 Bacteria 3538
347 Ga0495638_0095492 3300046460 Bacteria 1785
348 Ga0495638_0237532 3300046460 Bacteria 1011
349 Ga0495651_0118563 3300046462 Bacteria 1947
350 Ga0495651_0236674 3300046462 Bacteria 1254
351 Ga0495653_0000598 3300046463 Bacteria 27691
352 Ga0495580_0000787 3300046472 Bacteria 27379
353 Ga0495582_0000270 3300046473 Bacteria 29034
354 Ga0495639_0000934 3300046475 Bacteria 13202
355 Ga0495639_0046735 3300046475 Bacteria 1960
356 Ga0495639_0132649 3300046475 Bacteria 1193
357 Ga0495662_0000993 3300046476 Bacteria 13882
358 Ga0495662_0072779 3300046476 Bacteria 1667
359 Ga0495664_0010266 3300046477 Bacteria 5254
360 Ga0495594_0020026 3300046499 Bacteria 3561
361 Ga0495596_0051846 3300046500 Bacteria 1607
362 Ga0495608_0003605 3300046511 Bacteria 11110
363 Ga0495608_0048171 3300046511 Bacteria 2832
364 Ga0495618_0031249 3300046514 Bacteria 3330
365 Ga0495628_0020320 3300046516 Bacteria 5480
366 Ga0495628_0059387 3300046516 Bacteria 3002
367 Ga0495628_0173347 3300046516 Bacteria 1635
368 Ga0495632_0023495 3300046519 Bacteria 3292
369 Ga0495643_0051248 3300046522 Bacteria 2221
370 Ga0495644_0036429 3300046523 Bacteria 1856
371 Ga0495644_0063134 3300046523 Bacteria 1392
372 Ga0495648_0000552 3300046524 Bacteria 40192
373 Ga0495648_0121754 3300046524 Bacteria 1401
374 Ga0495652_0009837 3300046529 Bacteria 8667
375 Ga0495652_0053793 3300046529 Bacteria 3430
376 Ga0495665_0003851 3300046531 Bacteria 8124
377 Ga0495640_0018303 3300046533 Bacteria 5200
378 Ga0495640_0180467 3300046533 Bacteria 1345
379 Ga0495587_0001477 3300046536 Bacteria 15649
380 Ga0495587_0018599 3300046536 Bacteria 4309
381 Ga0495587_0240779 3300046536 Bacteria 1018
382 Ga0495598_0016764 3300046537 Bacteria 1876
383 Ga0495645_0013443 3300046543 Bacteria 5787
384 Ga0495645_0026867 3300046543 Bacteria 4180
385 Ga0495645_0048587 3300046543 Bacteria 3089
386 Ga0495622_0187537 3300046557 Bacteria 925
387 Ga0495633_0039699 3300046558 Bacteria 2245
388 Ga0495667_0001371 3300046559 Bacteria 16022
389 Ga0495656_0014338 3300046615 Bacteria 2970
390 Ga0495656_0044632 3300046615 Bacteria 1867
391 Ga0495634_0001270 3300046642 Bacteria 23127
392 Ga0495634_0021114 3300046642 Bacteria 4609
393 Ga0495611_0073044 3300046648 Bacteria 1570
394 Ga0495625_0114741 3300046660 Bacteria 1839
395 Ga0495625_0171506 3300046660 Bacteria 1448
396 Ga0495625_0355898 3300046660 Bacteria 924
397 Ga0495635_0000102 3300046663 Bacteria 50623
398 Ga0495635_0000463 3300046663 Bacteria 25676
399 Ga0495659_0026752 3300046664 Bacteria 1985
400 Ga0495659_0030017 3300046664 Bacteria 1890
401 Ga0495661_0165612 3300046665 Bacteria 1183
402 Ga0495588_0007900 3300046674 Bacteria 4860
403 Ga0495588_0054875 3300046674 Bacteria 2056
404 Ga0495657_0000677 3300046675 Bacteria 30671
405 Ga0495657_0242038 3300046675 Bacteria 1088
406 Ga0495599_0001270 3300046678 Bacteria 14337
407 Ga0495599_0053286 3300046678 Bacteria 2534
408 Ga0495599_0075486 3300046678 Bacteria 2105
409 Ga0495623_0000625 3300046679 Bacteria 23594
410 Ga0495623_0004014 3300046679 Bacteria 9684
411 Ga0495623_0048172 3300046679 Bacteria 2704
412 Ga0495646_0003261 3300046680 Bacteria 10094
413 Ga0495646_0016166 3300046680 Bacteria 4737
414 Ga0495646_0026066 3300046680 Bacteria 3672
415 Ga0495647_0001462 3300046681 Bacteria 7325
416 Ga0495647_0095922 3300046681 Bacteria 1222
417 Ga0495658_0000636 3300046683 Bacteria 19065
418 Ga0495658_0107627 3300046683 Bacteria 1673
419 Ga0495669_0004639 3300046684 Bacteria 5696
420 Ga0495669_0052783 3300046684 Bacteria 1827
421 Ga0495669_0143892 3300046684 Bacteria 1126
422 Ga0495613_0015258 3300046689 Bacteria 5711
423 Ga0495613_0282693 3300046689 Bacteria 1152
424 Ga0495624_0000635 3300046690 Bacteria 27507
425 Ga0495624_0047924 3300046690 Bacteria 2714
426 Ga0495670_0030185 3300046691 Bacteria 2693
427 Ga0495671_0088814 3300046692 Bacteria 1513
428 Ga0495600_0004238 3300046809 Bacteria 8566
429 Ga0495600_0276929 3300046809 Bacteria 1063
430 Ga0495581_0000666 3300047315 Bacteria 18025
431 Ga0495604_0002400 3300047317 Bacteria 15012
432 Ga0495604_0057108 3300047317 Bacteria 3001
433 Ga0495674_0001332 3300047319 Bacteria 24063
434 Ga0495674_0028322 3300047319 Bacteria 5110
435 Ga0495672_0006967 3300047320 Bacteria 8596
436 Ga0495676_0026159 3300047321 Bacteria 5027
437 Ga0495676_0289656 3300047321 Bacteria 1107
438 Ga0495680_0003276 3300047322 Bacteria 16054
439 Ga0495680_0030065 3300047322 Bacteria 4440
440 Ga0495680_0405393 3300047322 Bacteria 941
441 Ga0495675_0000456 3300047444 Bacteria 26992
442 Ga0495685_024527 3300047447 Bacteria 2076
443 Ga0495684_0000088 3300047471 Bacteria 64704
444 Ga0495684_0018537 3300047471 Bacteria 5362
445 Ga0495593_0001738 3300047673 Bacteria 12907
446 Ga0495593_0003108 3300047673 Bacteria 9989
447 Ga0495602_0023364 3300048088 Bacteria 6024
448 Ga0495602_0095292 3300048088 Bacteria 2457
449 Ga0495614_0017326 3300048089 Bacteria 3130
450 Ga0496100_0110818 3300048903 Bacteria 1906
451 Ga0496101_0042282 3300048904 Bacteria 3253
452 Ga0496101_0075487 3300048904 Bacteria 2481
453 Ga0496102_0075575 3300048905 Bacteria 3097
454 Ga0496102_0091895 3300048905 Bacteria 2810
455 Ga0496103_0285117 3300048906 Bacteria 1062
456 Ga0496104_0271820 3300048907 Bacteria 1607
457 Ga0496105_0090242 3300048908 Bacteria 2531
458 Ga0496106_0130805 3300048909 Bacteria 1968
459 Ga0496106_0192418 3300048909 Bacteria 1622
460 Ga0496106_0387529 3300048909 Bacteria 1123
461 Ga0496107_0043664 3300048910 Bacteria 3221
462 Ga0496107_0275090 3300048910 Bacteria 1253
463 Ga0496108_0082776 3300048911 Bacteria 2722
464 Ga0496109_0194808 3300048912 Bacteria 1905
465 Ga0496109_0686808 3300048912 Bacteria 961
466 Ga0496110_0059716 3300048913 Bacteria 3362
467 Ga0496110_0155507 3300048913 Bacteria 2071
468 Ga0496111_0029904 3300048914 Bacteria 3871
469 Ga0496111_0050002 3300048914 Bacteria 3014
470 Ga0496112_0128228 3300048915 Bacteria 2508
471 Ga0496112_0148467 3300048915 Bacteria 2312
472 Ga0496112_0184912 3300048915 Bacteria 2047
473 Ga0496112_0378119 3300048915 Bacteria 1357
474 Ga0496113_0021547 3300048916 Bacteria 4547
475 Ga0496113_0031385 3300048916 Bacteria 3856
476 Ga0496113_0264527 3300048916 Bacteria 1374
477 Ga0496115_0013657 3300048918 Bacteria 6147
478 Ga0496115_0015011 3300048918 Bacteria 5871
479 Ga0496115_0192380 3300048918 Bacteria 1685
480 Ga0496116_0000614 3300048919 Bacteria 47004
481 Ga0496116_0131350 3300048919 Bacteria 1427
482 Ga0496117_0053851 3300048920 Bacteria 2823
483 Ga0496117_0094278 3300048920 Bacteria 1916
484 Ga0496117_0201766 3300048920 Bacteria 1123
485 Ga0496118_0022339 3300048921 Bacteria 5535
486 Ga0496118_0060323 3300048921 Bacteria 2817
487 Ga0496118_0113873 3300048921 Bacteria 1785
488 Ga0496119_0070945 3300048922 Bacteria 2041
489 Ga0496119_0082040 3300048922 Bacteria 1855
490 Ga0496121_0001831 3300048924 Bacteria 34280
491 Ga0496121_0004034 3300048924 Bacteria 20175
492 Ga0496121_0005947 3300048924 Bacteria 15432
493 Ga0496121_0030689 3300048924 Bacteria 4931
494 Ga0496121_0035373 3300048924 Bacteria 4479
495 Ga0496121_0093988 3300048924 Bacteria 2333
496 Ga0496121_0094086 3300048924 Bacteria 2332
497 Ga0496121_0247436 3300048924 Bacteria 1238
498 Ga0496121_0267178 3300048924 Bacteria 1178
499 Ga0496121_0345145 3300048924 Bacteria 993
500 Ga0496123_0026472 3300048926 Bacteria 4342
501 Ga0496124_0084507 3300048927 Bacteria 2602
502 Ga0496124_0165219 3300048927 Bacteria 1721
503 Ga0496124_0450592 3300048927 Bacteria 878
504 Ga0496125_0024640 3300048928 Bacteria 5527
505 Ga0496125_0045551 3300048928 Bacteria 3689
506 Ga0496126_0014520 3300048929 Bacteria 7957
507 Ga0496126_0021086 3300048929 Bacteria 6373
508 Ga0496126_0022214 3300048929 Bacteria 6177
509 Ga0496126_0104296 3300048929 Bacteria 2477
510 Ga0496126_0132457 3300048929 Bacteria 2153
511 Ga0496126_0155357 3300048929 Bacteria 1958
512 Ga0496126_0224218 3300048929 Bacteria 1577
513 Ga0496126_0269117 3300048929 Bacteria 1414
514 Ga0501031_0168821 3300049568 Bacteria 1430
515 Ga0501031_0228355 3300049568 Bacteria 1212
516 Ga0501031_0307165 3300049568 Bacteria 1028
517 Ga0501032_0012575 3300049569 Bacteria 6044
518 Ga0501033_0067426 3300049570 Bacteria 2631
519 Ga0501033_0229516 3300049570 Bacteria 1319
520 Ga0501036_0010711 3300049572 Bacteria 7580
521 Ga0501037_0179541 3300049573 Bacteria 1502
522 Ga0501038_0002212 3300049574 Bacteria 18090
523 Ga0501038_0055463 3300049574 Bacteria 3404
524 Ga0501042_0436386 3300049578 Bacteria 949
525 Ga0501043_0012610 3300049579 Bacteria 6611
526 Ga0501047_0137957 3300049581 Bacteria 2318
527 Ga0501047_0143083 3300049581 Bacteria 2269
528 Ga0501048_0111351 3300049582 Bacteria 1933
529 Ga0501070_0063872 3300049586 Bacteria 3050
530 Ga0501035_0015312 3300049822 Bacteria 7077
531 Ga0501035_0198318 3300049822 Bacteria 1723
532 Ga0501035_0352052 3300049822 Bacteria 1232
533 Ga0501044_0061332 3300049823 Bacteria 3847
534 Ga0501044_0143034 3300049823 Bacteria 2379
535 nmdc:mga03683_29970_c1 3300050489 Bacteria 2174
536 nmdc:mga03n38_4403_c1 3300050490 Bacteria 4662
537 nmdc:mga00v17_217566_c1 3300050491 Bacteria 1236
538 nmdc:mga00v17_40947_c1 3300050491 Bacteria 2780
539 nmdc:mga00v17_5942_c1 3300050491 Bacteria 2477
540 nmdc:mga0yw44_2168_c1 3300050492 Bacteria 8242
541 nmdc:mga0yw44_23552_c1 3300050492 Bacteria 3471
542 nmdc:mga0yw44_84927_c1 3300050492 Bacteria 1991
543 nmdc:mga06z11_28787_c1 3300050494 Bacteria 2669
544 nmdc:mga04h51_111832_c1 3300050495 Bacteria 1008
545 nmdc:mga05p37_450826_c1 3300050507 Bacteria 1489
546 nmdc:mga0n895_13512_c1 3300050512 Bacteria 7370
547 nmdc:mga08x19_347232_c1 3300050514 Bacteria 1035
548 nmdc:mga08x19_73275_c1 3300050514 Bacteria 2235
549 nmdc:mga0sz30_40561_c1 3300050516 Bacteria 1957
550 Ga0495601_0013055 3300053077 Bacteria 4993
551 Ga0495601_0043899 3300053077 Bacteria 2808
552 Ga0495601_0144267 3300053077 Bacteria 1554
553 Ga0495595_0010622 3300053084 Bacteria 3830
554 Ga0495595_0067281 3300053084 Bacteria 1688
555 Ga0495595_0081213 3300053084 Bacteria 1544
556 Ga0495619_0021169 3300053085 Bacteria 4149
557 Ga0495619_0104382 3300053085 Bacteria 1931
558 Ga0495619_0114567 3300053085 Bacteria 1845
559 Ga0500643_065857 3300053087 Bacteria 1010
560 Ga0500644_0048683 3300053088 Bacteria 1443
561 Ga0500646_0027375 3300053090 Bacteria 1551
562 Ga0500583_0055684 3300053092 Bacteria 1850
563 Ga0500583_0136295 3300053092 Bacteria 1219
564 Ga0500641_0000746 3300053096 Bacteria 11801
565 Ga0500641_0084511 3300053096 Bacteria 1350
566 Ga0500650_0003633 3300053098 Bacteria 5420
567 Ga0500554_014121 3300053102 Bacteria 2053
568 Ga0500556_0000030 3300053104 Bacteria 165098
569 Ga0500562_059472 3300053108 Bacteria 1026
570 Ga0500572_001228 3300053111 Bacteria 7232
571 Ga0500595_000159 3300053119 Bacteria 44312
572 Ga0500595_001073 3300053119 Bacteria 15180
573 Ga0500595_001169 3300053119 Bacteria 14529
574 Ga0500595_027758 3300053119 Bacteria 1935
575 Ga0500595_053585 3300053119 Bacteria 1241
576 Ga0500642_0000028 3300053130 Bacteria 117281
577 Ga0500642_0073725 3300053130 Bacteria 1557
578 Ga0500642_0115160 3300053130 Bacteria 1256
579 Ga0500652_000170 3300053131 Bacteria 25102
580 Ga0500655_033405 3300053133 Bacteria 995
581 Ga0500658_0035552 3300053134 Bacteria 1972
582 Ga0500559_0000204 3300053136 Bacteria 47160
583 Ga0500559_0000579 3300053136 Bacteria 25120
584 Ga0500568_0000772 3300053139 Bacteria 22609
585 Ga0500586_005334 3300053145 Bacteria 3243
586 Ga0500590_065914 3300053148 Bacteria 1809
587 Ga0500603_000967 3300053150 Bacteria 6789
588 Ga0500604_0008804 3300053151 Bacteria 2680
589 Ga0500616_0000139 3300053153 Bacteria 123841
590 Ga0500616_0000413 3300053153 Bacteria 57779
591 Ga0500622_0011373 3300053156 Bacteria 4848
592 Ga0500622_0033941 3300053156 Bacteria 2674
593 Ga0500633_0079896 3300053160 Bacteria 1182
594 Ga0500634_0099648 3300053161 Bacteria 1457
595 Ga0500638_016399 3300053162 Bacteria 3418
596 Ga0500639_010198 3300053163 Bacteria 4918
597 Ga0500636_0027080 3300053177 Bacteria 3385
598 Ga0500637_0000349 3300053178 Bacteria 17523
599 Ga0500637_0029118 3300053178 Bacteria 3061
600 Ga0500637_0032667 3300053178 Bacteria 2902
601 Ga0500645_016868 3300053730 Bacteria 2296
602 Ga0500645_025154 3300053730 Bacteria 1817
603 Ga0500609_012676 3300053731 Bacteria 1140
604 Ga0500656_012338 3300053732 Bacteria 964
605 Ga0500596_001122 3300053735 Bacteria 5382
606 Ga0466962_0083658 3300061719 Bacteria 1527
607 2509153269 2508501128 Bacteria 8613869
608 2513691663 2513237101 Bacteria 7952346
609 2513889370 2513237141 Bacteria 8496279
610 2524439722 2524023205 Bacteria 8918781
611 2603859758 2602042107 Bacteria 6226103
612 2644288151 2643221651 Bacteria 4798932
613 2723845918 2721755755 Bacteria 8322773
614 2793082686
615 2824686376 2824679649 Bacteria 8248951
616 2857530638 2857524615 Bacteria 6615449
617 2874609428 2874604998 Bacteria 7834745
618 2876813186 2876808645 Bacteria 8824342
619 2879110350 2879110137 Bacteria 8907982
620 2885373403 2885366525 Bacteria 8326213
621 2889040770 2889033259 Bacteria 9099371
622 2893070283 2893066018 Bacteria 6158120
623 2919076236 2919073203 Bacteria 6531949
624 2922367871 2922361189 Bacteria 7436256
625 2922392239 2922386360 Bacteria 7017218
626 2922395474 2922393267 Bacteria 8285685
627 8006968702 8006964411 Bacteria 8966052
628 8006990556 8006984368 Bacteria 9651211
629 8006996312 8006994254 Bacteria 8309700
630 8056678110 8056673599 Bacteria 7871253
631 Ga0070697_100018930
632 JGI25406J46586_10000853
633 JGI25153J46596_10000691
634 rootH1_10266576
635 JGI25404J52841_10005203
636 JGI25404J52841_10013261
637 Ga0070658_10109923
638 Ga0070683_100003061
639 Ga0070670_100123979
640 Ga0068869_100052116
641 Ga0068869_100060565
642 Ga0070680_100148597
643 Ga0070682_100199466
644 Ga0070689_100312718
645 Ga0070691_10029773
646 Ga0070661_100233549
647 Ga0070692_10194924
648 Ga0070668_100172559
649 Ga0070668_100276841
650 Ga0070671_100490271
651 Ga0070674_100004144
652 Ga0070659_100086928
653 Ga0070709_10002233
654 Ga0070709_10021654
655 Ga0070709_10050453
656 Ga0070709_10230242
657 Ga0070714_100008237
658 Ga0070714_100022740
659 Ga0070714_100165361
660 Ga0070714_100479050
661 Ga0070713_100001790
662 Ga0070713_100009929
663 Ga0070713_100077740
664 Ga0070713_100146135
665 Ga0070713_100226263
666 Ga0070710_10002542
667 Ga0070710_10246362
668 Ga0070711_100414607
669 Ga0070663_100024377
670 Ga0070663_100030738
671 Ga0070663_100033369
672 Ga0070663_100058380
673 Ga0070663_100235031
674 Ga0070678_100367255
675 Ga0070662_100394145
676 Ga0070681_10136865
677 Ga0070681_10234838
678 Ga0068867_100344603
679 Ga0070706_100373428
680 Ga0070706_100561204
681 Ga0070698_100377167
682 Ga0070699_100060567
683 Ga0070679_100242574
684 Ga0070679_100625705
685 Ga0070684_100199198
686 Ga0070697_100537122
687 Ga0068853_100036396
688 Ga0068853_100228228
689 Ga0068853_100507689
690 Ga0068853_100593507
691 Ga0070693_100116921
692 Ga0070665_100064873
693 Ga0070665_100104462
694 Ga0070665_100207151
695 Ga0068855_100093598
696 Ga0068855_100110749
697 Ga0068855_100169449
698 Ga0068855_100260114
699 Ga0068857_100078539
700 Ga0068856_100188455
701 Ga0068852_100066059
702 Ga0068852_100085700
703 Ga0068852_100149890
704 Ga0068859_100096291
705 Ga0068861_100083970
706 Ga0068861_100114747
707 Ga0068861_100516443
708 Ga0068870_10254690
709 Ga0068863_100195680
710 Ga0068858_100260996
711 Ga0068860_100175408
712 Ga0068862_100112782
713 Ga0068862_100150171
714 Ga0081455_10004176
715 Ga0081455_10010174
716 Ga0081455_10082583
717 Ga0081540_1000916
718 Ga0081540_1002076
719 Ga0081540_1007867
720 Ga0081540_1009948
721 Ga0081540_1010080
722 Ga0081540_1013183
723 Ga0081540_1023779
724 Ga0081540_1033556
725 Ga0081540_1038342
726 Ga0081540_1091421
727 Ga0081539_10000231
728 Ga0081539_10020813
729 Ga0070717_10011110
730 Ga0070717_10011832
731 Ga0070717_10155077
732 Ga0075365_10008505
733 Ga0075365_10009018
734 Ga0075368_10038622
735 Ga0075363_100004318
736 Ga0075364_10096502
737 Ga0075364_10106705
738 Ga0075364_10191583
739 Ga0070715_10001251
740 Ga0070716_100001709
741 Ga0070712_100001161
742 Ga0070712_100121902
743 Ga0075362_10031729
744 Ga0075367_10004932
745 Ga0075367_10086371
746 Ga0097621_100179502
747 Ga0075370_10005485
748 Ga0068871_100227010
749 Ga0075434_100058499
750 Ga0075434_100255361
751 Ga0097620_100096286
752 Ga0099794_10037474
753 Ga0099794_10093914
754 Ga0099795_10043655
755 Ga0099795_10044626
756 Ga0105240_10010935
757 Ga0105240_10086695
758 Ga0105240_10380741
759 Ga0105240_10393842
760 Ga0111539_10107307
761 Ga0105247_10080814
762 Ga0114129_10089261
763 Ga0105243_10021839
764 Ga0105243_10122579
765 Ga0105241_10004891
766 Ga0105248_10126043
767 Ga0105248_10234871
768 Ga0105237_10055128
769 Ga0105237_10081307
770 Ga0105237_10103828
771 Ga0105237_10301210
772 Ga0105237_10552242
773 Ga0105238_10029225
774 Ga0105238_10215461
775 Ga0105249_10177450
776 Ga0099796_10006618
777 Ga0105239_10051701
778 Ga0105239_10152234
779 Ga0105239_10176562
780 Ga0105239_10333746
781 Ga0105239_10562033
782 Ga0105239_10909895
783 Ga0105246_10326456
784 Ga0157370_10033888
785 Ga0157370_10226401
786 Ga0157370_10227914
787 Ga0157369_10020068
788 Ga0157369_10059704
789 Ga0157369_10084240
790 Ga0157369_10299154
791 Ga0157374_10305588
792 Ga0157374_10433744
793 Ga0157378_10312619
794 Ga0163162_10174038
795 Ga0163162_10697794
796 Ga0157372_10141856
797 Ga0157375_10104163
798 Ga0157375_10307999
799 Ga0163163_10368519
800 Ga0157380_10086780
801 Ga0157380_10236593
802 Ga0157377_10094537
803 Ga0157376_10222800
804 Ga0157376_10276499
805 Ga0157376_10680951
806 Ga0163161_10041961
807 Ga0213872_10038795
808 Ga0213876_10075853
809 Ga0207653_10013839
810 Ga0207692_10006314
811 Ga0207692_10059541
812 Ga0207692_10334133
813 Ga0207642_10066243
814 Ga0207710_10017955
815 Ga0207710_10058250
816 Ga0207688_10072741
817 Ga0207647_10142011
818 Ga0207699_10032420
819 Ga0207699_10109690
820 Ga0207645_10076652
821 Ga0207643_10070736
822 Ga0207643_10207891
823 Ga0207707_10032881
824 Ga0207707_10223247
825 Ga0207695_10080329
826 Ga0207695_10119813
827 Ga0207695_10282252
828 Ga0207671_10220117
829 Ga0207671_10232885
830 Ga0207693_10002224
831 Ga0207693_10010627
832 Ga0207693_10098488
833 Ga0207663_10004497
834 Ga0207663_10076274
835 Ga0207660_10247507
836 Ga0207660_10255958
837 Ga0207657_10128699
838 Ga0207657_10238841
839 Ga0207649_10154426
840 Ga0207652_10059534
841 Ga0207694_10151031
842 Ga0207694_10208588
843 Ga0207650_10163541
844 Ga0207687_10515325
845 Ga0207700_10001654
846 Ga0207700_10043237
847 Ga0207700_10057360
848 Ga0207664_10023714
849 Ga0207664_10185348
850 Ga0207664_10695904
851 Ga0207644_10148517
852 Ga0207644_10362503
853 Ga0207690_10195817
854 Ga0207690_10398114
855 Ga0207706_10206067
856 Ga0207709_10080150
857 Ga0207669_10002996
858 Ga0207704_10474287
859 Ga0207665_10001251
860 Ga0207665_10125910
861 Ga0207665_10331897
862 Ga0207691_10136105
863 Ga0207711_10059809
864 Ga0207689_10006687
865 Ga0207661_10001651
866 Ga0207679_10153634
867 Ga0207667_10069936
868 Ga0207667_10127208
869 Ga0207667_10187767
870 Ga0207667_10270002
871 Ga0207667_10581632
872 Ga0207712_10086004
873 Ga0207668_10013209
874 Ga0207668_10229939
875 Ga0207677_10335451
876 Ga0207703_10073383
877 Ga0207703_10660064
878 Ga0207639_10008087
879 Ga0207639_10329279
880 Ga0207639_10457932
881 Ga0207639_10474916
882 Ga0207678_10099645
883 Ga0207678_10122781
884 Ga0207678_10143838
885 Ga0207678_10162232
886 Ga0207678_10273604
887 Ga0207702_10444428
888 Ga0207641_10520009
889 Ga0207648_10081718
890 Ga0207648_10133732
891 Ga0207676_10632015
892 Ga0207674_10091694
893 Ga0207674_10315174
894 Ga0207683_10216239
895 Ga0209179_1030046
896 Ga0209588_1028195
897 Ga0209813_10024321
898 Ga0268266_10002460
899 Ga0268266_10004661
900 Ga0268266_10015920
901 Ga0268265_10099590
902 Ga0268265_10133879
903 Ga0268264_10349515
904 Ga0307517_10000369
905 Ga0307515_10030519
906 Ga0307515_10090921
907 Ga0265330_10007158
908 Ga0265332_10084409
909 Ga0265328_10089627
910 Ga0265328_10108623
911 Ga0265325_10080950
912 Ga0265340_10000672
913 Ga0265339_10079649
914 Ga0265316_10367121
915 Ga0307508_10108597
916 Ga0265314_10123764
917 Ga0265342_10075248
918 Ga0307516_10038865
919 Ga0307516_10186034
920 Ga0307409_100299265
921 Ga0307510_10000998
922 Ga0307510_10019012
923 Ga0373934_0001558
924 Ga0373923_0001683
925 Ga0373936_0091225
926 Ga0373945_0035194
927 Ga0373945_0107868
928 Ga0373953_0000361
929 Ga0373954_0000316
930 Ga0373954_0007882
931 Ga0373956_0000552
932 Ga0373956_0099565
933 Ga0373957_0001213
934 Ga0373957_0013764
935 Ga0373943_0018493
936 Ga0373946_0023704
937 Ga0373955_0000487
938 Ga0373955_0121564
939 Ga0373931_0008509
940 Ga0373927_0000689
941 Ga0373927_0018091
942 Ga0373927_0271665
943 Ga0373933_0000457
944 Ga0373933_0002519
945 Ga0373933_0123293
946 Ga0373947_0175808
947 Ga0373937_0009000
948 Ga0373937_0054595
949 Ga0373937_0106364
950 Ga0373937_0277395
951 Ga0373937_0473322
952 Ga0373925_0012575
953 Ga0373925_0310041
954 Ga0395899_0016476
955 Ga0395900_0069888
956 Ga0395900_0086492
957 Ga0395900_0095571
958 Ga0395900_0704694
959 Ga0395898_0069601
960 Ga0395905_0247717
961 Ga0395901_0025301
962 Ga0395901_0170599
963 Ga0436365_0093056
964 Ga0436365_0481530
965 Ga0436361_1013230
966 Ga0466966_0136977
967 Ga0466963_0025384
968 Ga0495592_0003091
969 Ga0495592_0023120
970 Ga0495603_0000177
971 Ga0495603_0009078
972 Ga0495603_0034092
973 Ga0495629_0000398
974 Ga0495629_0035132
975 Ga0495629_0076861
976 Ga0495638_0029482
977 Ga0495638_0095492
978 Ga0495638_0237532
979 Ga0495651_0118563
980 Ga0495651_0236674
981 Ga0495653_0000598
982 Ga0495580_0000787
983 Ga0495582_0000270
984 Ga0495639_0000934
985 Ga0495639_0046735
986 Ga0495639_0132649
987 Ga0495662_0000993
988 Ga0495662_0072779
989 Ga0495664_0010266
990 Ga0495594_0020026
991 Ga0495596_0051846
992 Ga0495608_0003605
993 Ga0495608_0048171
994 Ga0495618_0031249
995 Ga0495628_0020320
996 Ga0495628_0059387
997 Ga0495628_0173347
998 Ga0495632_0023495
999 Ga0495643_0051248
1000 Ga0495644_0036429
1001 Ga0495644_0063134
1002 Ga0495648_0000552
1003 Ga0495648_0121754
1004 Ga0495652_0009837
1005 Ga0495652_0053793
1006 Ga0495665_0003851
1007 Ga0495640_0018303
1008 Ga0495640_0180467
1009 Ga0495587_0001477
1010 Ga0495587_0018599
1011 Ga0495587_0240779
1012 Ga0495598_0016764
1013 Ga0495645_0013443
1014 Ga0495645_0026867
1015 Ga0495645_0048587
1016 Ga0495622_0187537
1017 Ga0495633_0039699
1018 Ga0495667_0001371
1019 Ga0495656_0014338
1020 Ga0495656_0044632
1021 Ga0495634_0001270
1022 Ga0495634_0021114
1023 Ga0495611_0073044
1024 Ga0495625_0114741
1025 Ga0495625_0171506
1026 Ga0495625_0355898
1027 Ga0495635_0000102
1028 Ga0495635_0000463
1029 Ga0495659_0026752
1030 Ga0495659_0030017
1031 Ga0495661_0165612
1032 Ga0495588_0007900
1033 Ga0495588_0054875
1034 Ga0495657_0000677
1035 Ga0495657_0242038
1036 Ga0495599_0001270
1037 Ga0495599_0053286
1038 Ga0495599_0075486
1039 Ga0495623_0000625
1040 Ga0495623_0004014
1041 Ga0495623_0048172
1042 Ga0495646_0003261
1043 Ga0495646_0016166
1044 Ga0495646_0026066
1045 Ga0495647_0001462
1046 Ga0495647_0095922
1047 Ga0495658_0000636
1048 Ga0495658_0107627
1049 Ga0495669_0004639
1050 Ga0495669_0052783
1051 Ga0495669_0143892
1052 Ga0495613_0015258
1053 Ga0495613_0282693
1054 Ga0495624_0000635
1055 Ga0495624_0047924
1056 Ga0495670_0030185
1057 Ga0495671_0088814
1058 Ga0495600_0004238
1059 Ga0495600_0276929
1060 Ga0495581_0000666
1061 Ga0495604_0002400
1062 Ga0495604_0057108
1063 Ga0495674_0001332
1064 Ga0495674_0028322
1065 Ga0495672_0006967
1066 Ga0495676_0026159
1067 Ga0495676_0289656
1068 Ga0495680_0003276
1069 Ga0495680_0030065
1070 Ga0495680_0405393
1071 Ga0495675_0000456
1072 Ga0495685_024527
1073 Ga0495684_0000088
1074 Ga0495684_0018537
1075 Ga0495593_0001738
1076 Ga0495593_0003108
1077 Ga0495602_0023364
1078 Ga0495602_0095292
1079 Ga0495614_0017326
1080 Ga0496100_0110818
1081 Ga0496101_0042282
1082 Ga0496101_0075487
1083 Ga0496102_0075575
1084 Ga0496102_0091895
1085 Ga0496103_0285117
1086 Ga0496104_0271820
1087 Ga0496105_0090242
1088 Ga0496106_0130805
1089 Ga0496106_0192418
1090 Ga0496106_0387529
1091 Ga0496107_0043664
1092 Ga0496107_0275090
1093 Ga0496108_0082776
1094 Ga0496109_0194808
1095 Ga0496109_0686808
1096 Ga0496110_0059716
1097 Ga0496110_0155507
1098 Ga0496111_0029904
1099 Ga0496111_0050002
1100 Ga0496112_0128228
1101 Ga0496112_0148467
1102 Ga0496112_0184912
1103 Ga0496112_0378119
1104 Ga0496113_0021547
1105 Ga0496113_0031385
1106 Ga0496113_0264527
1107 Ga0496115_0013657
1108 Ga0496115_0015011
1109 Ga0496115_0192380
1110 Ga0496116_0000614
1111 Ga0496116_0131350
1112 Ga0496117_0053851
1113 Ga0496117_0094278
1114 Ga0496117_0201766
1115 Ga0496118_0022339
1116 Ga0496118_0060323
1117 Ga0496118_0113873
1118 Ga0496119_0070945
1119 Ga0496119_0082040
1120 Ga0496121_0001831
1121 Ga0496121_0004034
1122 Ga0496121_0005947
1123 Ga0496121_0030689
1124 Ga0496121_0035373
1125 Ga0496121_0093988
1126 Ga0496121_0094086
1127 Ga0496121_0247436
1128 Ga0496121_0267178
1129 Ga0496121_0345145
1130 Ga0496123_0026472
1131 Ga0496124_0084507
1132 Ga0496124_0165219
1133 Ga0496124_0450592
1134 Ga0496125_0024640
1135 Ga0496125_0045551
1136 Ga0496126_0014520
1137 Ga0496126_0021086
1138 Ga0496126_0022214
1139 Ga0496126_0104296
1140 Ga0496126_0132457
1141 Ga0496126_0155357
1142 Ga0496126_0224218
1143 Ga0496126_0269117
1144 Ga0501031_0168821
1145 Ga0501031_0228355
1146 Ga0501031_0307165
1147 Ga0501032_0012575
1148 Ga0501033_0067426
1149 Ga0501033_0229516
1150 Ga0501036_0010711
1151 Ga0501037_0179541
1152 Ga0501038_0002212
1153 Ga0501038_0055463
1154 Ga0501042_0436386
1155 Ga0501043_0012610
1156 Ga0501047_0137957
1157 Ga0501047_0143083
1158 Ga0501048_0111351
1159 Ga0501070_0063872
1160 Ga0501035_0015312
1161 Ga0501035_0198318
1162 Ga0501035_0352052
1163 Ga0501044_0061332
1164 Ga0501044_0143034
1165 nmdc:mga03683_29970_c1
1166 nmdc:mga03n38_4403_c1
1167 nmdc:mga00v17_217566_c1
1168 nmdc:mga00v17_40947_c1
1169 nmdc:mga00v17_5942_c1
1170 nmdc:mga0yw44_2168_c1
1171 nmdc:mga0yw44_23552_c1
1172 nmdc:mga0yw44_84927_c1
1173 nmdc:mga06z11_28787_c1
1174 nmdc:mga04h51_111832_c1
1175 nmdc:mga05p37_450826_c1
1176 nmdc:mga0n895_13512_c1
1177 nmdc:mga08x19_347232_c1
1178 nmdc:mga08x19_73275_c1
1179 nmdc:mga0sz30_40561_c1
1180 Ga0495601_0013055
1181 Ga0495601_0043899
1182 Ga0495601_0144267
1183 Ga0495595_0010622
1184 Ga0495595_0067281
1185 Ga0495595_0081213
1186 Ga0495619_0021169
1187 Ga0495619_0104382
1188 Ga0495619_0114567
1189 Ga0500643_065857
1190 Ga0500644_0048683
1191 Ga0500646_0027375
1192 Ga0500583_0055684
1193 Ga0500583_0136295
1194 Ga0500641_0000746
1195 Ga0500641_0084511
1196 Ga0500650_0003633
1197 Ga0500554_014121
1198 Ga0500556_0000030
1199 Ga0500562_059472
1200 Ga0500572_001228
1201 Ga0500595_000159
1202 Ga0500595_001073
1203 Ga0500595_001169
1204 Ga0500595_027758
1205 Ga0500595_053585
1206 Ga0500642_0000028
1207 Ga0500642_0073725
1208 Ga0500642_0115160
1209 Ga0500652_000170
1210 Ga0500655_033405
1211 Ga0500658_0035552
1212 Ga0500559_0000204
1213 Ga0500559_0000579
1214 Ga0500568_0000772
1215 Ga0500586_005334
1216 Ga0500590_065914
1217 Ga0500603_000967
1218 Ga0500604_0008804
1219 Ga0500616_0000139
1220 Ga0500616_0000413
1221 Ga0500622_0011373
1222 Ga0500622_0033941
1223 Ga0500633_0079896
1224 Ga0500634_0099648
1225 Ga0500638_016399
1226 Ga0500639_010198
1227 Ga0500636_0027080
1228 Ga0500637_0000349
1229 Ga0500637_0029118
1230 Ga0500637_0032667
1231 Ga0500645_016868
1232 Ga0500645_025154
1233 Ga0500609_012676
1234 Ga0500656_012338
1235 Ga0500596_001122
1236 Ga0466962_0083658
1237 2509153269
1238 2513691663
1239 2513889370
1240 2524439722
1241 2603859758
1242 2644288151
1243 2723845918
1244 2793082686
1245 2824686376
1246 2857530638
1247 2874609428
1248 2876813186
1249 2879110350
1250 2885373403
1251 2889040770
1252 2893070283
1253 2919076236
1254 2922367871
1255 2922392239
1256 2922395474
1257 8006968702
1258 8006990556
1259 8006996312
1260 8056678110

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02517

Rce1-like

Type II CAAX prenyl endopeptidase Rce1-like

186

279

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fn3-assembly1.cif.gz_C cryo-em structure of gamma secretase in class 1 of the apo- state ensemble 0.3007 25 253
6idf-assembly1.cif.gz_C cryo-em structure of gamma secretase in complex with a notch fragment 0.2914 25 253
1zb1-assembly2.cif.gz_B structure basis for endosomal targeting by the bro1 domain 0.2605 33 253
7wmn-assembly1.cif.gz_A a novel chemical derivative(89) of thrb agonist 0.2587 22 248
5hjp-assembly1.cif.gz_B identification of lxrbeta selective agonists for the treatment of alzheimer's disease 0.2585 20 251
ID Description Score Start End Superfamily
af_Q9ZZX1_1_342_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.2564 26 251 1.20.210.10
af_I1MZT7_156_506_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2552 33 253 1.20.1250.20
af_Q55DY8_111_308_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.2532 25 252 1.50.40.10
4onrA00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Decorin-binding protein 0.2492 103 253 1.20.1420.40
af_Q7XGH1_28_225_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2457 24 246 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A496V419-F1-model_v4 CPBP family intramembrane metalloprotease 0.9952 158 252 GO:0004222
GO:0016020
GO:0071586
AF-A0A1W9WEP6-F1-model_v4 CPBP family intramembrane metalloprotease 0.9946 158 252 GO:0004222
GO:0016020
GO:0071586
AF-A0A1I5FWA8-F1-model_v4 CAAX protease self-immunity 0.9807 155 247 GO:0004222
GO:0016020
GO:0071586
AF-A0A5A7W8G0-F1-model_v4 CPBP family intramembrane metalloprotease 0.976 38 253 GO:0004222
GO:0016020
GO:0071586
AF-A0A538PJC5-F1-model_v4 CPBP family intramembrane metalloprotease 0.9738 84 250 GO:0004222
GO:0016020
GO:0071586

Map