F470810
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 630 | 359 | 1260 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100018930|Ga0070697_1000189306 |
| Length | 291 |
| Sequence | MAGLVPAIHVLTSHQRKTNDDNNTRPKSVESHLMDSLNPAAPPITLIPTQRSPRIWKFWGTALWGLFIFAAMFVGQIAVVAWFVLWREGPIDIAAAIHVVGGGLTISLSVIMGLPAVLAALWIAIRFSRTPFADYLALRWPSWTNLLIGVLALFVLVMGWDVLSRAAGREVAPGFMGEVLKSARADGALWLLVIAFTVAAPITEEFFARGFLYRGWSESFLGPVGAIILSSLVWTALHLQYDWFFFGEVFSIGLLLGYLRYRSNSTWLTVVVHGLNNLAAVVQTILLAGST |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 256 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 257 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 258 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 303 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 305 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 306 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 313 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 315 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 316 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 321 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 326 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 327 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 331 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 334 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 335 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 336 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 337 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 338 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 339 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 340 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 341 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 342 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 343 | 2791355199 | |||
| 344 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 345 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 346 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 347 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 348 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 349 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 350 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 351 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 352 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 353 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 354 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 355 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 356 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 357 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 358 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 359 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.34 |
| Metatranscriptomes | 0 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.27 |
| Nodule | 2.06 |
| Rhizoplane | 4.92 |
| Rhizosphere | 72.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070697_100018930 | 3300005536 | Bacteria | 5434 |
| 2 | JGI25406J46586_10000853 | 3300003203 | Bacteria | 14355 |
| 3 | JGI25153J46596_10000691 | 3300003215 | Bacteria | 20594 |
| 4 | rootH1_10266576 | 3300003323 | Bacteria | 1399 |
| 5 | JGI25404J52841_10005203 | 3300003659 | Bacteria | 2682 |
| 6 | JGI25404J52841_10013261 | 3300003659 | Bacteria | 1787 |
| 7 | Ga0070658_10109923 | 3300005327 | Bacteria | 2283 |
| 8 | Ga0070683_100003061 | 3300005329 | Bacteria | 13452 |
| 9 | Ga0070670_100123979 | 3300005331 | Bacteria | 2230 |
| 10 | Ga0068869_100052116 | 3300005334 | Bacteria | 2970 |
| 11 | Ga0068869_100060565 | 3300005334 | Bacteria | 2774 |
| 12 | Ga0070680_100148597 | 3300005336 | Bacteria | 1967 |
| 13 | Ga0070682_100199466 | 3300005337 | Bacteria | 1410 |
| 14 | Ga0070689_100312718 | 3300005340 | Bacteria | 1310 |
| 15 | Ga0070691_10029773 | 3300005341 | Bacteria | 2556 |
| 16 | Ga0070661_100233549 | 3300005344 | Bacteria | 1414 |
| 17 | Ga0070692_10194924 | 3300005345 | Bacteria | 1183 |
| 18 | Ga0070668_100172559 | 3300005347 | Bacteria | 1761 |
| 19 | Ga0070668_100276841 | 3300005347 | Bacteria | 1400 |
| 20 | Ga0070671_100490271 | 3300005355 | Bacteria | 1056 |
| 21 | Ga0070674_100004144 | 3300005356 | Bacteria | 8232 |
| 22 | Ga0070659_100086928 | 3300005366 | Bacteria | 2502 |
| 23 | Ga0070709_10002233 | 3300005434 | Bacteria | 10499 |
| 24 | Ga0070709_10021654 | 3300005434 | Bacteria | 3747 |
| 25 | Ga0070709_10050453 | 3300005434 | Bacteria | 2607 |
| 26 | Ga0070709_10230242 | 3300005434 | Bacteria | 1326 |
| 27 | Ga0070714_100008237 | 3300005435 | Bacteria | 8125 |
| 28 | Ga0070714_100022740 | 3300005435 | Bacteria | 5144 |
| 29 | Ga0070714_100165361 | 3300005435 | Bacteria | 2005 |
| 30 | Ga0070714_100479050 | 3300005435 | Bacteria | 1185 |
| 31 | Ga0070713_100001790 | 3300005436 | Bacteria | 13842 |
| 32 | Ga0070713_100009929 | 3300005436 | Bacteria | 6853 |
| 33 | Ga0070713_100077740 | 3300005436 | Bacteria | 2823 |
| 34 | Ga0070713_100146135 | 3300005436 | Bacteria | 2099 |
| 35 | Ga0070713_100226263 | 3300005436 | Bacteria | 1699 |
| 36 | Ga0070710_10002542 | 3300005437 | Bacteria | 8659 |
| 37 | Ga0070710_10246362 | 3300005437 | Bacteria | 1147 |
| 38 | Ga0070711_100414607 | 3300005439 | Bacteria | 1096 |
| 39 | Ga0070663_100024377 | 3300005455 | Bacteria | 4071 |
| 40 | Ga0070663_100030738 | 3300005455 | Bacteria | 3685 |
| 41 | Ga0070663_100033369 | 3300005455 | Bacteria | 3556 |
| 42 | Ga0070663_100058380 | 3300005455 | Bacteria | 2771 |
| 43 | Ga0070663_100235031 | 3300005455 | Bacteria | 1445 |
| 44 | Ga0070678_100367255 | 3300005456 | Bacteria | 1242 |
| 45 | Ga0070662_100394145 | 3300005457 | Bacteria | 1142 |
| 46 | Ga0070681_10136865 | 3300005458 | Bacteria | 2380 |
| 47 | Ga0070681_10234838 | 3300005458 | Bacteria | 1748 |
| 48 | Ga0068867_100344603 | 3300005459 | Bacteria | 1242 |
| 49 | Ga0070706_100373428 | 3300005467 | Bacteria | 1328 |
| 50 | Ga0070706_100561204 | 3300005467 | Bacteria | 1062 |
| 51 | Ga0070698_100377167 | 3300005471 | Bacteria | 1351 |
| 52 | Ga0070699_100060567 | 3300005518 | Bacteria | 3280 |
| 53 | Ga0070679_100242574 | 3300005530 | Bacteria | 1759 |
| 54 | Ga0070679_100625705 | 3300005530 | Bacteria | 1019 |
| 55 | Ga0070684_100199198 | 3300005535 | Bacteria | 1823 |
| 56 | Ga0070697_100537122 | 3300005536 | Bacteria | 1025 |
| 57 | Ga0068853_100036396 | 3300005539 | Bacteria | 4185 |
| 58 | Ga0068853_100228228 | 3300005539 | Bacteria | 1702 |
| 59 | Ga0068853_100507689 | 3300005539 | Bacteria | 1139 |
| 60 | Ga0068853_100593507 | 3300005539 | Bacteria | 1051 |
| 61 | Ga0070693_100116921 | 3300005547 | Bacteria | 1649 |
| 62 | Ga0070665_100064873 | 3300005548 | Bacteria | 3663 |
| 63 | Ga0070665_100104462 | 3300005548 | Bacteria | 2835 |
| 64 | Ga0070665_100207151 | 3300005548 | Bacteria | 1962 |
| 65 | Ga0068855_100093598 | 3300005563 | Bacteria | 3465 |
| 66 | Ga0068855_100110749 | 3300005563 | Bacteria | 3151 |
| 67 | Ga0068855_100169449 | 3300005563 | Bacteria | 2473 |
| 68 | Ga0068855_100260114 | 3300005563 | Bacteria | 1933 |
| 69 | Ga0068857_100078539 | 3300005577 | Bacteria | 2946 |
| 70 | Ga0068856_100188455 | 3300005614 | Bacteria | 2076 |
| 71 | Ga0068852_100066059 | 3300005616 | Bacteria | 3158 |
| 72 | Ga0068852_100085700 | 3300005616 | Bacteria | 2807 |
| 73 | Ga0068852_100149890 | 3300005616 | Bacteria | 2168 |
| 74 | Ga0068859_100096291 | 3300005617 | Bacteria | 3012 |
| 75 | Ga0068861_100083970 | 3300005719 | Bacteria | 2499 |
| 76 | Ga0068861_100114747 | 3300005719 | Bacteria | 2163 |
| 77 | Ga0068861_100516443 | 3300005719 | Bacteria | 1083 |
| 78 | Ga0068870_10254690 | 3300005840 | Bacteria | 1090 |
| 79 | Ga0068863_100195680 | 3300005841 | Bacteria | 1943 |
| 80 | Ga0068858_100260996 | 3300005842 | Bacteria | 1646 |
| 81 | Ga0068860_100175408 | 3300005843 | Bacteria | 2071 |
| 82 | Ga0068862_100112782 | 3300005844 | Bacteria | 2388 |
| 83 | Ga0068862_100150171 | 3300005844 | Bacteria | 2073 |
| 84 | Ga0081455_10004176 | 3300005937 | Bacteria | 16283 |
| 85 | Ga0081455_10010174 | 3300005937 | Bacteria | 9576 |
| 86 | Ga0081455_10082583 | 3300005937 | Bacteria | 2628 |
| 87 | Ga0081540_1000916 | 3300005983 | Bacteria | 26580 |
| 88 | Ga0081540_1002076 | 3300005983 | Bacteria | 16707 |
| 89 | Ga0081540_1007867 | 3300005983 | Bacteria | 7535 |
| 90 | Ga0081540_1009948 | 3300005983 | Bacteria | 6485 |
| 91 | Ga0081540_1010080 | 3300005983 | Bacteria | 6432 |
| 92 | Ga0081540_1013183 | 3300005983 | Bacteria | 5392 |
| 93 | Ga0081540_1023779 | 3300005983 | Bacteria | 3572 |
| 94 | Ga0081540_1033556 | 3300005983 | Bacteria | 2785 |
| 95 | Ga0081540_1038342 | 3300005983 | Bacteria | 2526 |
| 96 | Ga0081540_1091421 | 3300005983 | Bacteria | 1338 |
| 97 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 98 | Ga0081539_10020813 | 3300005985 | Bacteria | 4411 |
| 99 | Ga0070717_10011110 | 3300006028 | Bacteria | 6823 |
| 100 | Ga0070717_10011832 | 3300006028 | Bacteria | 6639 |
| 101 | Ga0070717_10155077 | 3300006028 | Bacteria | 1983 |
| 102 | Ga0075365_10008505 | 3300006038 | Bacteria | 5836 |
| 103 | Ga0075365_10009018 | 3300006038 | Bacteria | 5704 |
| 104 | Ga0075368_10038622 | 3300006042 | Bacteria | 1869 |
| 105 | Ga0075363_100004318 | 3300006048 | Bacteria | 6190 |
| 106 | Ga0075364_10096502 | 3300006051 | Bacteria | 1966 |
| 107 | Ga0075364_10106705 | 3300006051 | Bacteria | 1866 |
| 108 | Ga0075364_10191583 | 3300006051 | Bacteria | 1385 |
| 109 | Ga0070715_10001251 | 3300006163 | Bacteria | 7276 |
| 110 | Ga0070716_100001709 | 3300006173 | Bacteria | 9895 |
| 111 | Ga0070712_100001161 | 3300006175 | Bacteria | 15933 |
| 112 | Ga0070712_100121902 | 3300006175 | Bacteria | 1963 |
| 113 | Ga0075362_10031729 | 3300006177 | Bacteria | 2288 |
| 114 | Ga0075367_10004932 | 3300006178 | Bacteria | 6577 |
| 115 | Ga0075367_10086371 | 3300006178 | Bacteria | 1904 |
| 116 | Ga0097621_100179502 | 3300006237 | Bacteria | 1829 |
| 117 | Ga0075370_10005485 | 3300006353 | Bacteria | 6313 |
| 118 | Ga0068871_100227010 | 3300006358 | Bacteria | 1619 |
| 119 | Ga0075434_100058499 | 3300006871 | Bacteria | 3831 |
| 120 | Ga0075434_100255361 | 3300006871 | Bacteria | 1772 |
| 121 | Ga0097620_100096286 | 3300006931 | Bacteria | 3012 |
| 122 | Ga0099794_10037474 | 3300007265 | Bacteria | 2295 |
| 123 | Ga0099794_10093914 | 3300007265 | Bacteria | 1491 |
| 124 | Ga0099795_10043655 | 3300007788 | Bacteria | 1605 |
| 125 | Ga0099795_10044626 | 3300007788 | Bacteria | 1591 |
| 126 | Ga0105240_10010935 | 3300009093 | Bacteria | 12718 |
| 127 | Ga0105240_10086695 | 3300009093 | Bacteria | 3835 |
| 128 | Ga0105240_10380741 | 3300009093 | Bacteria | 1594 |
| 129 | Ga0105240_10393842 | 3300009093 | Bacteria | 1562 |
| 130 | Ga0111539_10107307 | 3300009094 | Bacteria | 3276 |
| 131 | Ga0105247_10080814 | 3300009101 | Bacteria | 2048 |
| 132 | Ga0114129_10089261 | 3300009147 | Bacteria | 4273 |
| 133 | Ga0105243_10021839 | 3300009148 | Bacteria | 4860 |
| 134 | Ga0105243_10122579 | 3300009148 | Bacteria | 2194 |
| 135 | Ga0105241_10004891 | 3300009174 | Bacteria | 9881 |
| 136 | Ga0105248_10126043 | 3300009177 | Bacteria | 2889 |
| 137 | Ga0105248_10234871 | 3300009177 | Bacteria | 2064 |
| 138 | Ga0105237_10055128 | 3300009545 | Bacteria | 3982 |
| 139 | Ga0105237_10081307 | 3300009545 | Bacteria | 3230 |
| 140 | Ga0105237_10103828 | 3300009545 | Bacteria | 2834 |
| 141 | Ga0105237_10301210 | 3300009545 | Bacteria | 1606 |
| 142 | Ga0105237_10552242 | 3300009545 | Bacteria | 1158 |
| 143 | Ga0105238_10029225 | 3300009551 | Bacteria | 5617 |
| 144 | Ga0105238_10215461 | 3300009551 | Bacteria | 1896 |
| 145 | Ga0105249_10177450 | 3300009553 | Bacteria | 2070 |
| 146 | Ga0099796_10006618 | 3300010159 | Bacteria | 2980 |
| 147 | Ga0105239_10051701 | 3300010375 | Bacteria | 4504 |
| 148 | Ga0105239_10152234 | 3300010375 | Bacteria | 2582 |
| 149 | Ga0105239_10176562 | 3300010375 | Bacteria | 2389 |
| 150 | Ga0105239_10333746 | 3300010375 | Bacteria | 1711 |
| 151 | Ga0105239_10562033 | 3300010375 | Bacteria | 1300 |
| 152 | Ga0105239_10909895 | 3300010375 | Bacteria | 1010 |
| 153 | Ga0105246_10326456 | 3300011119 | Bacteria | 1249 |
| 154 | Ga0157370_10033888 | 3300013104 | Bacteria | 4977 |
| 155 | Ga0157370_10226401 | 3300013104 | Bacteria | 1731 |
| 156 | Ga0157370_10227914 | 3300013104 | Bacteria | 1725 |
| 157 | Ga0157369_10020068 | 3300013105 | Bacteria | 7474 |
| 158 | Ga0157369_10059704 | 3300013105 | Bacteria | 4113 |
| 159 | Ga0157369_10084240 | 3300013105 | Bacteria | 3398 |
| 160 | Ga0157369_10299154 | 3300013105 | Bacteria | 1674 |
| 161 | Ga0157374_10305588 | 3300013296 | Bacteria | 1574 |
| 162 | Ga0157374_10433744 | 3300013296 | Bacteria | 1314 |
| 163 | Ga0157378_10312619 | 3300013297 | Bacteria | 1524 |
| 164 | Ga0163162_10174038 | 3300013306 | Bacteria | 2277 |
| 165 | Ga0163162_10697794 | 3300013306 | Bacteria | 1137 |
| 166 | Ga0157372_10141856 | 3300013307 | Bacteria | 2769 |
| 167 | Ga0157375_10104163 | 3300013308 | Bacteria | 2926 |
| 168 | Ga0157375_10307999 | 3300013308 | Bacteria | 1748 |
| 169 | Ga0163163_10368519 | 3300014325 | Bacteria | 1493 |
| 170 | Ga0157380_10086780 | 3300014326 | Bacteria | 2572 |
| 171 | Ga0157380_10236593 | 3300014326 | Bacteria | 1644 |
| 172 | Ga0157377_10094537 | 3300014745 | Bacteria | 1771 |
| 173 | Ga0157376_10222800 | 3300014969 | Bacteria | 1748 |
| 174 | Ga0157376_10276499 | 3300014969 | Bacteria | 1580 |
| 175 | Ga0157376_10680951 | 3300014969 | Bacteria | 1032 |
| 176 | Ga0163161_10041961 | 3300017792 | Bacteria | 3289 |
| 177 | Ga0213872_10038795 | 3300021361 | Bacteria | 2174 |
| 178 | Ga0213876_10075853 | 3300021384 | Bacteria | 1776 |
| 179 | Ga0207653_10013839 | 3300025885 | Bacteria | 2528 |
| 180 | Ga0207692_10006314 | 3300025898 | Bacteria | 4803 |
| 181 | Ga0207692_10059541 | 3300025898 | Bacteria | 1972 |
| 182 | Ga0207692_10334133 | 3300025898 | Bacteria | 930 |
| 183 | Ga0207642_10066243 | 3300025899 | Bacteria | 1700 |
| 184 | Ga0207710_10017955 | 3300025900 | Bacteria | 3005 |
| 185 | Ga0207710_10058250 | 3300025900 | Bacteria | 1746 |
| 186 | Ga0207688_10072741 | 3300025901 | Bacteria | 1953 |
| 187 | Ga0207647_10142011 | 3300025904 | Bacteria | 1407 |
| 188 | Ga0207699_10032420 | 3300025906 | Bacteria | 2944 |
| 189 | Ga0207699_10109690 | 3300025906 | Bacteria | 1767 |
| 190 | Ga0207645_10076652 | 3300025907 | Bacteria | 2142 |
| 191 | Ga0207643_10070736 | 3300025908 | Bacteria | 2007 |
| 192 | Ga0207643_10207891 | 3300025908 | Bacteria | 1194 |
| 193 | Ga0207707_10032881 | 3300025912 | Bacteria | 4540 |
| 194 | Ga0207707_10223247 | 3300025912 | Bacteria | 1640 |
| 195 | Ga0207695_10080329 | 3300025913 | Bacteria | 3302 |
| 196 | Ga0207695_10119813 | 3300025913 | Bacteria | 2601 |
| 197 | Ga0207695_10282252 | 3300025913 | Bacteria | 1554 |
| 198 | Ga0207671_10220117 | 3300025914 | Bacteria | 1487 |
| 199 | Ga0207671_10232885 | 3300025914 | Bacteria | 1445 |
| 200 | Ga0207693_10002224 | 3300025915 | Bacteria | 16891 |
| 201 | Ga0207693_10010627 | 3300025915 | Bacteria | 7469 |
| 202 | Ga0207693_10098488 | 3300025915 | Bacteria | 2293 |
| 203 | Ga0207663_10004497 | 3300025916 | Bacteria | 6939 |
| 204 | Ga0207663_10076274 | 3300025916 | Bacteria | 2178 |
| 205 | Ga0207660_10247507 | 3300025917 | Bacteria | 1406 |
| 206 | Ga0207660_10255958 | 3300025917 | Bacteria | 1383 |
| 207 | Ga0207657_10128699 | 3300025919 | Bacteria | 2077 |
| 208 | Ga0207657_10238841 | 3300025919 | Bacteria | 1451 |
| 209 | Ga0207649_10154426 | 3300025920 | Bacteria | 1584 |
| 210 | Ga0207652_10059534 | 3300025921 | Bacteria | 3293 |
| 211 | Ga0207694_10151031 | 3300025924 | Bacteria | 1871 |
| 212 | Ga0207694_10208588 | 3300025924 | Bacteria | 1591 |
| 213 | Ga0207650_10163541 | 3300025925 | Bacteria | 1765 |
| 214 | Ga0207687_10515325 | 3300025927 | Bacteria | 1000 |
| 215 | Ga0207700_10001654 | 3300025928 | Bacteria | 12677 |
| 216 | Ga0207700_10043237 | 3300025928 | Bacteria | 3308 |
| 217 | Ga0207700_10057360 | 3300025928 | Bacteria | 2936 |
| 218 | Ga0207664_10023714 | 3300025929 | Bacteria | 4602 |
| 219 | Ga0207664_10185348 | 3300025929 | Bacteria | 1789 |
| 220 | Ga0207664_10695904 | 3300025929 | Bacteria | 914 |
| 221 | Ga0207644_10148517 | 3300025931 | Bacteria | 1812 |
| 222 | Ga0207644_10362503 | 3300025931 | Bacteria | 1179 |
| 223 | Ga0207690_10195817 | 3300025932 | Bacteria | 1531 |
| 224 | Ga0207690_10398114 | 3300025932 | Bacteria | 1098 |
| 225 | Ga0207706_10206067 | 3300025933 | Bacteria | 1724 |
| 226 | Ga0207709_10080150 | 3300025935 | Bacteria | 2102 |
| 227 | Ga0207669_10002996 | 3300025937 | Bacteria | 7269 |
| 228 | Ga0207704_10474287 | 3300025938 | Bacteria | 1003 |
| 229 | Ga0207665_10001251 | 3300025939 | Bacteria | 17140 |
| 230 | Ga0207665_10125910 | 3300025939 | Bacteria | 1814 |
| 231 | Ga0207665_10331897 | 3300025939 | Bacteria | 1144 |
| 232 | Ga0207691_10136105 | 3300025940 | Bacteria | 2167 |
| 233 | Ga0207711_10059809 | 3300025941 | Bacteria | 3281 |
| 234 | Ga0207689_10006687 | 3300025942 | Bacteria | 10172 |
| 235 | Ga0207661_10001651 | 3300025944 | Bacteria | 15207 |
| 236 | Ga0207679_10153634 | 3300025945 | Bacteria | 1877 |
| 237 | Ga0207667_10069936 | 3300025949 | Bacteria | 3654 |
| 238 | Ga0207667_10127208 | 3300025949 | Bacteria | 2625 |
| 239 | Ga0207667_10187767 | 3300025949 | Bacteria | 2121 |
| 240 | Ga0207667_10270002 | 3300025949 | Bacteria | 1739 |
| 241 | Ga0207667_10581632 | 3300025949 | Bacteria | 1130 |
| 242 | Ga0207712_10086004 | 3300025961 | Bacteria | 2303 |
| 243 | Ga0207668_10013209 | 3300025972 | Bacteria | 5077 |
| 244 | Ga0207668_10229939 | 3300025972 | Bacteria | 1494 |
| 245 | Ga0207677_10335451 | 3300026023 | Bacteria | 1261 |
| 246 | Ga0207703_10073383 | 3300026035 | Bacteria | 2831 |
| 247 | Ga0207703_10660064 | 3300026035 | Bacteria | 992 |
| 248 | Ga0207639_10008087 | 3300026041 | Bacteria | 7191 |
| 249 | Ga0207639_10329279 | 3300026041 | Bacteria | 1358 |
| 250 | Ga0207639_10457932 | 3300026041 | Bacteria | 1159 |
| 251 | Ga0207639_10474916 | 3300026041 | Bacteria | 1139 |
| 252 | Ga0207678_10099645 | 3300026067 | Bacteria | 2482 |
| 253 | Ga0207678_10122781 | 3300026067 | Bacteria | 2216 |
| 254 | Ga0207678_10143838 | 3300026067 | Bacteria | 2035 |
| 255 | Ga0207678_10162232 | 3300026067 | Bacteria | 1909 |
| 256 | Ga0207678_10273604 | 3300026067 | Bacteria | 1448 |
| 257 | Ga0207702_10444428 | 3300026078 | Bacteria | 1257 |
| 258 | Ga0207641_10520009 | 3300026088 | Bacteria | 1157 |
| 259 | Ga0207648_10081718 | 3300026089 | Bacteria | 2818 |
| 260 | Ga0207648_10133732 | 3300026089 | Bacteria | 2183 |
| 261 | Ga0207676_10632015 | 3300026095 | Bacteria | 1031 |
| 262 | Ga0207674_10091694 | 3300026116 | Bacteria | 3028 |
| 263 | Ga0207674_10315174 | 3300026116 | Bacteria | 1513 |
| 264 | Ga0207683_10216239 | 3300026121 | Bacteria | 1746 |
| 265 | Ga0209179_1030046 | 3300027512 | Bacteria | 1109 |
| 266 | Ga0209588_1028195 | 3300027671 | Bacteria | 1787 |
| 267 | Ga0209813_10024321 | 3300027866 | Bacteria | 1731 |
| 268 | Ga0268266_10002460 | 3300028379 | Bacteria | 19801 |
| 269 | Ga0268266_10004661 | 3300028379 | Bacteria | 13065 |
| 270 | Ga0268266_10015920 | 3300028379 | Bacteria | 6435 |
| 271 | Ga0268265_10099590 | 3300028380 | Bacteria | 2343 |
| 272 | Ga0268265_10133879 | 3300028380 | Bacteria | 2064 |
| 273 | Ga0268264_10349515 | 3300028381 | Bacteria | 1407 |
| 274 | Ga0307517_10000369 | 3300028786 | Bacteria | 77795 |
| 275 | Ga0307515_10030519 | 3300028794 | Bacteria | 9043 |
| 276 | Ga0307515_10090921 | 3300028794 | Bacteria | 3821 |
| 277 | Ga0265330_10007158 | 3300031235 | Bacteria | 5465 |
| 278 | Ga0265332_10084409 | 3300031238 | Bacteria | 1346 |
| 279 | Ga0265328_10089627 | 3300031239 | Bacteria | 1136 |
| 280 | Ga0265328_10108623 | 3300031239 | Bacteria | 1030 |
| 281 | Ga0265325_10080950 | 3300031241 | Bacteria | 1614 |
| 282 | Ga0265340_10000672 | 3300031247 | Bacteria | 19165 |
| 283 | Ga0265339_10079649 | 3300031249 | Bacteria | 1733 |
| 284 | Ga0265316_10367121 | 3300031344 | Bacteria | 1040 |
| 285 | Ga0307508_10108597 | 3300031616 | Bacteria | 2374 |
| 286 | Ga0265314_10123764 | 3300031711 | Bacteria | 1623 |
| 287 | Ga0265342_10075248 | 3300031712 | Bacteria | 1960 |
| 288 | Ga0307516_10038865 | 3300031730 | Bacteria | 4745 |
| 289 | Ga0307516_10186034 | 3300031730 | Bacteria | 1807 |
| 290 | Ga0307409_100299265 | 3300031995 | Bacteria | 1496 |
| 291 | Ga0307510_10000998 | 3300033180 | Bacteria | 30010 |
| 292 | Ga0307510_10019012 | 3300033180 | Bacteria | 8062 |
| 293 | Ga0373934_0001558 | 3300035086 | Bacteria | 8414 |
| 294 | Ga0373923_0001683 | 3300035111 | Bacteria | 6465 |
| 295 | Ga0373936_0091225 | 3300035113 | Bacteria | 1278 |
| 296 | Ga0373945_0035194 | 3300035116 | Bacteria | 1789 |
| 297 | Ga0373945_0107868 | 3300035116 | Bacteria | 1096 |
| 298 | Ga0373953_0000361 | 3300035117 | Bacteria | 12290 |
| 299 | Ga0373954_0000316 | 3300035118 | Bacteria | 17666 |
| 300 | Ga0373954_0007882 | 3300035118 | Bacteria | 4664 |
| 301 | Ga0373956_0000552 | 3300035119 | Bacteria | 15350 |
| 302 | Ga0373956_0099565 | 3300035119 | Bacteria | 1347 |
| 303 | Ga0373957_0001213 | 3300035120 | Bacteria | 6888 |
| 304 | Ga0373957_0013764 | 3300035120 | Bacteria | 2752 |
| 305 | Ga0373943_0018493 | 3300035170 | Bacteria | 3203 |
| 306 | Ga0373946_0023704 | 3300035171 | Bacteria | 2400 |
| 307 | Ga0373955_0000487 | 3300035172 | Bacteria | 16820 |
| 308 | Ga0373955_0121564 | 3300035172 | Bacteria | 1518 |
| 309 | Ga0373931_0008509 | 3300035691 | Bacteria | 4870 |
| 310 | Ga0373927_0000689 | 3300035695 | Bacteria | 25810 |
| 311 | Ga0373927_0018091 | 3300035695 | Bacteria | 4635 |
| 312 | Ga0373927_0271665 | 3300035695 | Bacteria | 1115 |
| 313 | Ga0373933_0000457 | 3300035724 | Bacteria | 25599 |
| 314 | Ga0373933_0002519 | 3300035724 | Bacteria | 10290 |
| 315 | Ga0373933_0123293 | 3300035724 | Bacteria | 1624 |
| 316 | Ga0373947_0175808 | 3300035725 | Bacteria | 1391 |
| 317 | Ga0373937_0009000 | 3300036401 | Bacteria | 8667 |
| 318 | Ga0373937_0054595 | 3300036401 | Bacteria | 3667 |
| 319 | Ga0373937_0106364 | 3300036401 | Bacteria | 2608 |
| 320 | Ga0373937_0277395 | 3300036401 | Bacteria | 1582 |
| 321 | Ga0373937_0473322 | 3300036401 | Bacteria | 1190 |
| 322 | Ga0373925_0012575 | 3300037068 | Bacteria | 6134 |
| 323 | Ga0373925_0310041 | 3300037068 | Bacteria | 1275 |
| 324 | Ga0395899_0016476 | 3300037312 | Bacteria | 5636 |
| 325 | Ga0395900_0069888 | 3300037418 | Bacteria | 3610 |
| 326 | Ga0395900_0086492 | 3300037418 | Bacteria | 3222 |
| 327 | Ga0395900_0095571 | 3300037418 | Bacteria | 3053 |
| 328 | Ga0395900_0704694 | 3300037418 | Bacteria | 943 |
| 329 | Ga0395898_0069601 | 3300037466 | Bacteria | 3404 |
| 330 | Ga0395905_0247717 | 3300037471 | Bacteria | 1665 |
| 331 | Ga0395901_0025301 | 3300038443 | Bacteria | 6093 |
| 332 | Ga0395901_0170599 | 3300038443 | Bacteria | 2283 |
| 333 | Ga0436365_0093056 | 3300039437 | Bacteria | 1193 |
| 334 | Ga0436365_0481530 | 3300039437 | Bacteria | 3606 |
| 335 | Ga0436361_1013230 | 3300039447 | Bacteria | 2454 |
| 336 | Ga0466966_0136977 | 3300044684 | Bacteria | 1497 |
| 337 | Ga0466963_0025384 | 3300044694 | Bacteria | 3779 |
| 338 | Ga0495592_0003091 | 3300046454 | Bacteria | 11883 |
| 339 | Ga0495592_0023120 | 3300046454 | Bacteria | 4728 |
| 340 | Ga0495603_0000177 | 3300046455 | Bacteria | 32632 |
| 341 | Ga0495603_0009078 | 3300046455 | Bacteria | 6010 |
| 342 | Ga0495603_0034092 | 3300046455 | Bacteria | 3063 |
| 343 | Ga0495629_0000398 | 3300046459 | Bacteria | 36605 |
| 344 | Ga0495629_0035132 | 3300046459 | Bacteria | 3543 |
| 345 | Ga0495629_0076861 | 3300046459 | Bacteria | 2330 |
| 346 | Ga0495638_0029482 | 3300046460 | Bacteria | 3538 |
| 347 | Ga0495638_0095492 | 3300046460 | Bacteria | 1785 |
| 348 | Ga0495638_0237532 | 3300046460 | Bacteria | 1011 |
| 349 | Ga0495651_0118563 | 3300046462 | Bacteria | 1947 |
| 350 | Ga0495651_0236674 | 3300046462 | Bacteria | 1254 |
| 351 | Ga0495653_0000598 | 3300046463 | Bacteria | 27691 |
| 352 | Ga0495580_0000787 | 3300046472 | Bacteria | 27379 |
| 353 | Ga0495582_0000270 | 3300046473 | Bacteria | 29034 |
| 354 | Ga0495639_0000934 | 3300046475 | Bacteria | 13202 |
| 355 | Ga0495639_0046735 | 3300046475 | Bacteria | 1960 |
| 356 | Ga0495639_0132649 | 3300046475 | Bacteria | 1193 |
| 357 | Ga0495662_0000993 | 3300046476 | Bacteria | 13882 |
| 358 | Ga0495662_0072779 | 3300046476 | Bacteria | 1667 |
| 359 | Ga0495664_0010266 | 3300046477 | Bacteria | 5254 |
| 360 | Ga0495594_0020026 | 3300046499 | Bacteria | 3561 |
| 361 | Ga0495596_0051846 | 3300046500 | Bacteria | 1607 |
| 362 | Ga0495608_0003605 | 3300046511 | Bacteria | 11110 |
| 363 | Ga0495608_0048171 | 3300046511 | Bacteria | 2832 |
| 364 | Ga0495618_0031249 | 3300046514 | Bacteria | 3330 |
| 365 | Ga0495628_0020320 | 3300046516 | Bacteria | 5480 |
| 366 | Ga0495628_0059387 | 3300046516 | Bacteria | 3002 |
| 367 | Ga0495628_0173347 | 3300046516 | Bacteria | 1635 |
| 368 | Ga0495632_0023495 | 3300046519 | Bacteria | 3292 |
| 369 | Ga0495643_0051248 | 3300046522 | Bacteria | 2221 |
| 370 | Ga0495644_0036429 | 3300046523 | Bacteria | 1856 |
| 371 | Ga0495644_0063134 | 3300046523 | Bacteria | 1392 |
| 372 | Ga0495648_0000552 | 3300046524 | Bacteria | 40192 |
| 373 | Ga0495648_0121754 | 3300046524 | Bacteria | 1401 |
| 374 | Ga0495652_0009837 | 3300046529 | Bacteria | 8667 |
| 375 | Ga0495652_0053793 | 3300046529 | Bacteria | 3430 |
| 376 | Ga0495665_0003851 | 3300046531 | Bacteria | 8124 |
| 377 | Ga0495640_0018303 | 3300046533 | Bacteria | 5200 |
| 378 | Ga0495640_0180467 | 3300046533 | Bacteria | 1345 |
| 379 | Ga0495587_0001477 | 3300046536 | Bacteria | 15649 |
| 380 | Ga0495587_0018599 | 3300046536 | Bacteria | 4309 |
| 381 | Ga0495587_0240779 | 3300046536 | Bacteria | 1018 |
| 382 | Ga0495598_0016764 | 3300046537 | Bacteria | 1876 |
| 383 | Ga0495645_0013443 | 3300046543 | Bacteria | 5787 |
| 384 | Ga0495645_0026867 | 3300046543 | Bacteria | 4180 |
| 385 | Ga0495645_0048587 | 3300046543 | Bacteria | 3089 |
| 386 | Ga0495622_0187537 | 3300046557 | Bacteria | 925 |
| 387 | Ga0495633_0039699 | 3300046558 | Bacteria | 2245 |
| 388 | Ga0495667_0001371 | 3300046559 | Bacteria | 16022 |
| 389 | Ga0495656_0014338 | 3300046615 | Bacteria | 2970 |
| 390 | Ga0495656_0044632 | 3300046615 | Bacteria | 1867 |
| 391 | Ga0495634_0001270 | 3300046642 | Bacteria | 23127 |
| 392 | Ga0495634_0021114 | 3300046642 | Bacteria | 4609 |
| 393 | Ga0495611_0073044 | 3300046648 | Bacteria | 1570 |
| 394 | Ga0495625_0114741 | 3300046660 | Bacteria | 1839 |
| 395 | Ga0495625_0171506 | 3300046660 | Bacteria | 1448 |
| 396 | Ga0495625_0355898 | 3300046660 | Bacteria | 924 |
| 397 | Ga0495635_0000102 | 3300046663 | Bacteria | 50623 |
| 398 | Ga0495635_0000463 | 3300046663 | Bacteria | 25676 |
| 399 | Ga0495659_0026752 | 3300046664 | Bacteria | 1985 |
| 400 | Ga0495659_0030017 | 3300046664 | Bacteria | 1890 |
| 401 | Ga0495661_0165612 | 3300046665 | Bacteria | 1183 |
| 402 | Ga0495588_0007900 | 3300046674 | Bacteria | 4860 |
| 403 | Ga0495588_0054875 | 3300046674 | Bacteria | 2056 |
| 404 | Ga0495657_0000677 | 3300046675 | Bacteria | 30671 |
| 405 | Ga0495657_0242038 | 3300046675 | Bacteria | 1088 |
| 406 | Ga0495599_0001270 | 3300046678 | Bacteria | 14337 |
| 407 | Ga0495599_0053286 | 3300046678 | Bacteria | 2534 |
| 408 | Ga0495599_0075486 | 3300046678 | Bacteria | 2105 |
| 409 | Ga0495623_0000625 | 3300046679 | Bacteria | 23594 |
| 410 | Ga0495623_0004014 | 3300046679 | Bacteria | 9684 |
| 411 | Ga0495623_0048172 | 3300046679 | Bacteria | 2704 |
| 412 | Ga0495646_0003261 | 3300046680 | Bacteria | 10094 |
| 413 | Ga0495646_0016166 | 3300046680 | Bacteria | 4737 |
| 414 | Ga0495646_0026066 | 3300046680 | Bacteria | 3672 |
| 415 | Ga0495647_0001462 | 3300046681 | Bacteria | 7325 |
| 416 | Ga0495647_0095922 | 3300046681 | Bacteria | 1222 |
| 417 | Ga0495658_0000636 | 3300046683 | Bacteria | 19065 |
| 418 | Ga0495658_0107627 | 3300046683 | Bacteria | 1673 |
| 419 | Ga0495669_0004639 | 3300046684 | Bacteria | 5696 |
| 420 | Ga0495669_0052783 | 3300046684 | Bacteria | 1827 |
| 421 | Ga0495669_0143892 | 3300046684 | Bacteria | 1126 |
| 422 | Ga0495613_0015258 | 3300046689 | Bacteria | 5711 |
| 423 | Ga0495613_0282693 | 3300046689 | Bacteria | 1152 |
| 424 | Ga0495624_0000635 | 3300046690 | Bacteria | 27507 |
| 425 | Ga0495624_0047924 | 3300046690 | Bacteria | 2714 |
| 426 | Ga0495670_0030185 | 3300046691 | Bacteria | 2693 |
| 427 | Ga0495671_0088814 | 3300046692 | Bacteria | 1513 |
| 428 | Ga0495600_0004238 | 3300046809 | Bacteria | 8566 |
| 429 | Ga0495600_0276929 | 3300046809 | Bacteria | 1063 |
| 430 | Ga0495581_0000666 | 3300047315 | Bacteria | 18025 |
| 431 | Ga0495604_0002400 | 3300047317 | Bacteria | 15012 |
| 432 | Ga0495604_0057108 | 3300047317 | Bacteria | 3001 |
| 433 | Ga0495674_0001332 | 3300047319 | Bacteria | 24063 |
| 434 | Ga0495674_0028322 | 3300047319 | Bacteria | 5110 |
| 435 | Ga0495672_0006967 | 3300047320 | Bacteria | 8596 |
| 436 | Ga0495676_0026159 | 3300047321 | Bacteria | 5027 |
| 437 | Ga0495676_0289656 | 3300047321 | Bacteria | 1107 |
| 438 | Ga0495680_0003276 | 3300047322 | Bacteria | 16054 |
| 439 | Ga0495680_0030065 | 3300047322 | Bacteria | 4440 |
| 440 | Ga0495680_0405393 | 3300047322 | Bacteria | 941 |
| 441 | Ga0495675_0000456 | 3300047444 | Bacteria | 26992 |
| 442 | Ga0495685_024527 | 3300047447 | Bacteria | 2076 |
| 443 | Ga0495684_0000088 | 3300047471 | Bacteria | 64704 |
| 444 | Ga0495684_0018537 | 3300047471 | Bacteria | 5362 |
| 445 | Ga0495593_0001738 | 3300047673 | Bacteria | 12907 |
| 446 | Ga0495593_0003108 | 3300047673 | Bacteria | 9989 |
| 447 | Ga0495602_0023364 | 3300048088 | Bacteria | 6024 |
| 448 | Ga0495602_0095292 | 3300048088 | Bacteria | 2457 |
| 449 | Ga0495614_0017326 | 3300048089 | Bacteria | 3130 |
| 450 | Ga0496100_0110818 | 3300048903 | Bacteria | 1906 |
| 451 | Ga0496101_0042282 | 3300048904 | Bacteria | 3253 |
| 452 | Ga0496101_0075487 | 3300048904 | Bacteria | 2481 |
| 453 | Ga0496102_0075575 | 3300048905 | Bacteria | 3097 |
| 454 | Ga0496102_0091895 | 3300048905 | Bacteria | 2810 |
| 455 | Ga0496103_0285117 | 3300048906 | Bacteria | 1062 |
| 456 | Ga0496104_0271820 | 3300048907 | Bacteria | 1607 |
| 457 | Ga0496105_0090242 | 3300048908 | Bacteria | 2531 |
| 458 | Ga0496106_0130805 | 3300048909 | Bacteria | 1968 |
| 459 | Ga0496106_0192418 | 3300048909 | Bacteria | 1622 |
| 460 | Ga0496106_0387529 | 3300048909 | Bacteria | 1123 |
| 461 | Ga0496107_0043664 | 3300048910 | Bacteria | 3221 |
| 462 | Ga0496107_0275090 | 3300048910 | Bacteria | 1253 |
| 463 | Ga0496108_0082776 | 3300048911 | Bacteria | 2722 |
| 464 | Ga0496109_0194808 | 3300048912 | Bacteria | 1905 |
| 465 | Ga0496109_0686808 | 3300048912 | Bacteria | 961 |
| 466 | Ga0496110_0059716 | 3300048913 | Bacteria | 3362 |
| 467 | Ga0496110_0155507 | 3300048913 | Bacteria | 2071 |
| 468 | Ga0496111_0029904 | 3300048914 | Bacteria | 3871 |
| 469 | Ga0496111_0050002 | 3300048914 | Bacteria | 3014 |
| 470 | Ga0496112_0128228 | 3300048915 | Bacteria | 2508 |
| 471 | Ga0496112_0148467 | 3300048915 | Bacteria | 2312 |
| 472 | Ga0496112_0184912 | 3300048915 | Bacteria | 2047 |
| 473 | Ga0496112_0378119 | 3300048915 | Bacteria | 1357 |
| 474 | Ga0496113_0021547 | 3300048916 | Bacteria | 4547 |
| 475 | Ga0496113_0031385 | 3300048916 | Bacteria | 3856 |
| 476 | Ga0496113_0264527 | 3300048916 | Bacteria | 1374 |
| 477 | Ga0496115_0013657 | 3300048918 | Bacteria | 6147 |
| 478 | Ga0496115_0015011 | 3300048918 | Bacteria | 5871 |
| 479 | Ga0496115_0192380 | 3300048918 | Bacteria | 1685 |
| 480 | Ga0496116_0000614 | 3300048919 | Bacteria | 47004 |
| 481 | Ga0496116_0131350 | 3300048919 | Bacteria | 1427 |
| 482 | Ga0496117_0053851 | 3300048920 | Bacteria | 2823 |
| 483 | Ga0496117_0094278 | 3300048920 | Bacteria | 1916 |
| 484 | Ga0496117_0201766 | 3300048920 | Bacteria | 1123 |
| 485 | Ga0496118_0022339 | 3300048921 | Bacteria | 5535 |
| 486 | Ga0496118_0060323 | 3300048921 | Bacteria | 2817 |
| 487 | Ga0496118_0113873 | 3300048921 | Bacteria | 1785 |
| 488 | Ga0496119_0070945 | 3300048922 | Bacteria | 2041 |
| 489 | Ga0496119_0082040 | 3300048922 | Bacteria | 1855 |
| 490 | Ga0496121_0001831 | 3300048924 | Bacteria | 34280 |
| 491 | Ga0496121_0004034 | 3300048924 | Bacteria | 20175 |
| 492 | Ga0496121_0005947 | 3300048924 | Bacteria | 15432 |
| 493 | Ga0496121_0030689 | 3300048924 | Bacteria | 4931 |
| 494 | Ga0496121_0035373 | 3300048924 | Bacteria | 4479 |
| 495 | Ga0496121_0093988 | 3300048924 | Bacteria | 2333 |
| 496 | Ga0496121_0094086 | 3300048924 | Bacteria | 2332 |
| 497 | Ga0496121_0247436 | 3300048924 | Bacteria | 1238 |
| 498 | Ga0496121_0267178 | 3300048924 | Bacteria | 1178 |
| 499 | Ga0496121_0345145 | 3300048924 | Bacteria | 993 |
| 500 | Ga0496123_0026472 | 3300048926 | Bacteria | 4342 |
| 501 | Ga0496124_0084507 | 3300048927 | Bacteria | 2602 |
| 502 | Ga0496124_0165219 | 3300048927 | Bacteria | 1721 |
| 503 | Ga0496124_0450592 | 3300048927 | Bacteria | 878 |
| 504 | Ga0496125_0024640 | 3300048928 | Bacteria | 5527 |
| 505 | Ga0496125_0045551 | 3300048928 | Bacteria | 3689 |
| 506 | Ga0496126_0014520 | 3300048929 | Bacteria | 7957 |
| 507 | Ga0496126_0021086 | 3300048929 | Bacteria | 6373 |
| 508 | Ga0496126_0022214 | 3300048929 | Bacteria | 6177 |
| 509 | Ga0496126_0104296 | 3300048929 | Bacteria | 2477 |
| 510 | Ga0496126_0132457 | 3300048929 | Bacteria | 2153 |
| 511 | Ga0496126_0155357 | 3300048929 | Bacteria | 1958 |
| 512 | Ga0496126_0224218 | 3300048929 | Bacteria | 1577 |
| 513 | Ga0496126_0269117 | 3300048929 | Bacteria | 1414 |
| 514 | Ga0501031_0168821 | 3300049568 | Bacteria | 1430 |
| 515 | Ga0501031_0228355 | 3300049568 | Bacteria | 1212 |
| 516 | Ga0501031_0307165 | 3300049568 | Bacteria | 1028 |
| 517 | Ga0501032_0012575 | 3300049569 | Bacteria | 6044 |
| 518 | Ga0501033_0067426 | 3300049570 | Bacteria | 2631 |
| 519 | Ga0501033_0229516 | 3300049570 | Bacteria | 1319 |
| 520 | Ga0501036_0010711 | 3300049572 | Bacteria | 7580 |
| 521 | Ga0501037_0179541 | 3300049573 | Bacteria | 1502 |
| 522 | Ga0501038_0002212 | 3300049574 | Bacteria | 18090 |
| 523 | Ga0501038_0055463 | 3300049574 | Bacteria | 3404 |
| 524 | Ga0501042_0436386 | 3300049578 | Bacteria | 949 |
| 525 | Ga0501043_0012610 | 3300049579 | Bacteria | 6611 |
| 526 | Ga0501047_0137957 | 3300049581 | Bacteria | 2318 |
| 527 | Ga0501047_0143083 | 3300049581 | Bacteria | 2269 |
| 528 | Ga0501048_0111351 | 3300049582 | Bacteria | 1933 |
| 529 | Ga0501070_0063872 | 3300049586 | Bacteria | 3050 |
| 530 | Ga0501035_0015312 | 3300049822 | Bacteria | 7077 |
| 531 | Ga0501035_0198318 | 3300049822 | Bacteria | 1723 |
| 532 | Ga0501035_0352052 | 3300049822 | Bacteria | 1232 |
| 533 | Ga0501044_0061332 | 3300049823 | Bacteria | 3847 |
| 534 | Ga0501044_0143034 | 3300049823 | Bacteria | 2379 |
| 535 | nmdc:mga03683_29970_c1 | 3300050489 | Bacteria | 2174 |
| 536 | nmdc:mga03n38_4403_c1 | 3300050490 | Bacteria | 4662 |
| 537 | nmdc:mga00v17_217566_c1 | 3300050491 | Bacteria | 1236 |
| 538 | nmdc:mga00v17_40947_c1 | 3300050491 | Bacteria | 2780 |
| 539 | nmdc:mga00v17_5942_c1 | 3300050491 | Bacteria | 2477 |
| 540 | nmdc:mga0yw44_2168_c1 | 3300050492 | Bacteria | 8242 |
| 541 | nmdc:mga0yw44_23552_c1 | 3300050492 | Bacteria | 3471 |
| 542 | nmdc:mga0yw44_84927_c1 | 3300050492 | Bacteria | 1991 |
| 543 | nmdc:mga06z11_28787_c1 | 3300050494 | Bacteria | 2669 |
| 544 | nmdc:mga04h51_111832_c1 | 3300050495 | Bacteria | 1008 |
| 545 | nmdc:mga05p37_450826_c1 | 3300050507 | Bacteria | 1489 |
| 546 | nmdc:mga0n895_13512_c1 | 3300050512 | Bacteria | 7370 |
| 547 | nmdc:mga08x19_347232_c1 | 3300050514 | Bacteria | 1035 |
| 548 | nmdc:mga08x19_73275_c1 | 3300050514 | Bacteria | 2235 |
| 549 | nmdc:mga0sz30_40561_c1 | 3300050516 | Bacteria | 1957 |
| 550 | Ga0495601_0013055 | 3300053077 | Bacteria | 4993 |
| 551 | Ga0495601_0043899 | 3300053077 | Bacteria | 2808 |
| 552 | Ga0495601_0144267 | 3300053077 | Bacteria | 1554 |
| 553 | Ga0495595_0010622 | 3300053084 | Bacteria | 3830 |
| 554 | Ga0495595_0067281 | 3300053084 | Bacteria | 1688 |
| 555 | Ga0495595_0081213 | 3300053084 | Bacteria | 1544 |
| 556 | Ga0495619_0021169 | 3300053085 | Bacteria | 4149 |
| 557 | Ga0495619_0104382 | 3300053085 | Bacteria | 1931 |
| 558 | Ga0495619_0114567 | 3300053085 | Bacteria | 1845 |
| 559 | Ga0500643_065857 | 3300053087 | Bacteria | 1010 |
| 560 | Ga0500644_0048683 | 3300053088 | Bacteria | 1443 |
| 561 | Ga0500646_0027375 | 3300053090 | Bacteria | 1551 |
| 562 | Ga0500583_0055684 | 3300053092 | Bacteria | 1850 |
| 563 | Ga0500583_0136295 | 3300053092 | Bacteria | 1219 |
| 564 | Ga0500641_0000746 | 3300053096 | Bacteria | 11801 |
| 565 | Ga0500641_0084511 | 3300053096 | Bacteria | 1350 |
| 566 | Ga0500650_0003633 | 3300053098 | Bacteria | 5420 |
| 567 | Ga0500554_014121 | 3300053102 | Bacteria | 2053 |
| 568 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 569 | Ga0500562_059472 | 3300053108 | Bacteria | 1026 |
| 570 | Ga0500572_001228 | 3300053111 | Bacteria | 7232 |
| 571 | Ga0500595_000159 | 3300053119 | Bacteria | 44312 |
| 572 | Ga0500595_001073 | 3300053119 | Bacteria | 15180 |
| 573 | Ga0500595_001169 | 3300053119 | Bacteria | 14529 |
| 574 | Ga0500595_027758 | 3300053119 | Bacteria | 1935 |
| 575 | Ga0500595_053585 | 3300053119 | Bacteria | 1241 |
| 576 | Ga0500642_0000028 | 3300053130 | Bacteria | 117281 |
| 577 | Ga0500642_0073725 | 3300053130 | Bacteria | 1557 |
| 578 | Ga0500642_0115160 | 3300053130 | Bacteria | 1256 |
| 579 | Ga0500652_000170 | 3300053131 | Bacteria | 25102 |
| 580 | Ga0500655_033405 | 3300053133 | Bacteria | 995 |
| 581 | Ga0500658_0035552 | 3300053134 | Bacteria | 1972 |
| 582 | Ga0500559_0000204 | 3300053136 | Bacteria | 47160 |
| 583 | Ga0500559_0000579 | 3300053136 | Bacteria | 25120 |
| 584 | Ga0500568_0000772 | 3300053139 | Bacteria | 22609 |
| 585 | Ga0500586_005334 | 3300053145 | Bacteria | 3243 |
| 586 | Ga0500590_065914 | 3300053148 | Bacteria | 1809 |
| 587 | Ga0500603_000967 | 3300053150 | Bacteria | 6789 |
| 588 | Ga0500604_0008804 | 3300053151 | Bacteria | 2680 |
| 589 | Ga0500616_0000139 | 3300053153 | Bacteria | 123841 |
| 590 | Ga0500616_0000413 | 3300053153 | Bacteria | 57779 |
| 591 | Ga0500622_0011373 | 3300053156 | Bacteria | 4848 |
| 592 | Ga0500622_0033941 | 3300053156 | Bacteria | 2674 |
| 593 | Ga0500633_0079896 | 3300053160 | Bacteria | 1182 |
| 594 | Ga0500634_0099648 | 3300053161 | Bacteria | 1457 |
| 595 | Ga0500638_016399 | 3300053162 | Bacteria | 3418 |
| 596 | Ga0500639_010198 | 3300053163 | Bacteria | 4918 |
| 597 | Ga0500636_0027080 | 3300053177 | Bacteria | 3385 |
| 598 | Ga0500637_0000349 | 3300053178 | Bacteria | 17523 |
| 599 | Ga0500637_0029118 | 3300053178 | Bacteria | 3061 |
| 600 | Ga0500637_0032667 | 3300053178 | Bacteria | 2902 |
| 601 | Ga0500645_016868 | 3300053730 | Bacteria | 2296 |
| 602 | Ga0500645_025154 | 3300053730 | Bacteria | 1817 |
| 603 | Ga0500609_012676 | 3300053731 | Bacteria | 1140 |
| 604 | Ga0500656_012338 | 3300053732 | Bacteria | 964 |
| 605 | Ga0500596_001122 | 3300053735 | Bacteria | 5382 |
| 606 | Ga0466962_0083658 | 3300061719 | Bacteria | 1527 |
| 607 | 2509153269 | 2508501128 | Bacteria | 8613869 |
| 608 | 2513691663 | 2513237101 | Bacteria | 7952346 |
| 609 | 2513889370 | 2513237141 | Bacteria | 8496279 |
| 610 | 2524439722 | 2524023205 | Bacteria | 8918781 |
| 611 | 2603859758 | 2602042107 | Bacteria | 6226103 |
| 612 | 2644288151 | 2643221651 | Bacteria | 4798932 |
| 613 | 2723845918 | 2721755755 | Bacteria | 8322773 |
| 614 | 2793082686 | |||
| 615 | 2824686376 | 2824679649 | Bacteria | 8248951 |
| 616 | 2857530638 | 2857524615 | Bacteria | 6615449 |
| 617 | 2874609428 | 2874604998 | Bacteria | 7834745 |
| 618 | 2876813186 | 2876808645 | Bacteria | 8824342 |
| 619 | 2879110350 | 2879110137 | Bacteria | 8907982 |
| 620 | 2885373403 | 2885366525 | Bacteria | 8326213 |
| 621 | 2889040770 | 2889033259 | Bacteria | 9099371 |
| 622 | 2893070283 | 2893066018 | Bacteria | 6158120 |
| 623 | 2919076236 | 2919073203 | Bacteria | 6531949 |
| 624 | 2922367871 | 2922361189 | Bacteria | 7436256 |
| 625 | 2922392239 | 2922386360 | Bacteria | 7017218 |
| 626 | 2922395474 | 2922393267 | Bacteria | 8285685 |
| 627 | 8006968702 | 8006964411 | Bacteria | 8966052 |
| 628 | 8006990556 | 8006984368 | Bacteria | 9651211 |
| 629 | 8006996312 | 8006994254 | Bacteria | 8309700 |
| 630 | 8056678110 | 8056673599 | Bacteria | 7871253 |
| 631 | Ga0070697_100018930 | |||
| 632 | JGI25406J46586_10000853 | |||
| 633 | JGI25153J46596_10000691 | |||
| 634 | rootH1_10266576 | |||
| 635 | JGI25404J52841_10005203 | |||
| 636 | JGI25404J52841_10013261 | |||
| 637 | Ga0070658_10109923 | |||
| 638 | Ga0070683_100003061 | |||
| 639 | Ga0070670_100123979 | |||
| 640 | Ga0068869_100052116 | |||
| 641 | Ga0068869_100060565 | |||
| 642 | Ga0070680_100148597 | |||
| 643 | Ga0070682_100199466 | |||
| 644 | Ga0070689_100312718 | |||
| 645 | Ga0070691_10029773 | |||
| 646 | Ga0070661_100233549 | |||
| 647 | Ga0070692_10194924 | |||
| 648 | Ga0070668_100172559 | |||
| 649 | Ga0070668_100276841 | |||
| 650 | Ga0070671_100490271 | |||
| 651 | Ga0070674_100004144 | |||
| 652 | Ga0070659_100086928 | |||
| 653 | Ga0070709_10002233 | |||
| 654 | Ga0070709_10021654 | |||
| 655 | Ga0070709_10050453 | |||
| 656 | Ga0070709_10230242 | |||
| 657 | Ga0070714_100008237 | |||
| 658 | Ga0070714_100022740 | |||
| 659 | Ga0070714_100165361 | |||
| 660 | Ga0070714_100479050 | |||
| 661 | Ga0070713_100001790 | |||
| 662 | Ga0070713_100009929 | |||
| 663 | Ga0070713_100077740 | |||
| 664 | Ga0070713_100146135 | |||
| 665 | Ga0070713_100226263 | |||
| 666 | Ga0070710_10002542 | |||
| 667 | Ga0070710_10246362 | |||
| 668 | Ga0070711_100414607 | |||
| 669 | Ga0070663_100024377 | |||
| 670 | Ga0070663_100030738 | |||
| 671 | Ga0070663_100033369 | |||
| 672 | Ga0070663_100058380 | |||
| 673 | Ga0070663_100235031 | |||
| 674 | Ga0070678_100367255 | |||
| 675 | Ga0070662_100394145 | |||
| 676 | Ga0070681_10136865 | |||
| 677 | Ga0070681_10234838 | |||
| 678 | Ga0068867_100344603 | |||
| 679 | Ga0070706_100373428 | |||
| 680 | Ga0070706_100561204 | |||
| 681 | Ga0070698_100377167 | |||
| 682 | Ga0070699_100060567 | |||
| 683 | Ga0070679_100242574 | |||
| 684 | Ga0070679_100625705 | |||
| 685 | Ga0070684_100199198 | |||
| 686 | Ga0070697_100537122 | |||
| 687 | Ga0068853_100036396 | |||
| 688 | Ga0068853_100228228 | |||
| 689 | Ga0068853_100507689 | |||
| 690 | Ga0068853_100593507 | |||
| 691 | Ga0070693_100116921 | |||
| 692 | Ga0070665_100064873 | |||
| 693 | Ga0070665_100104462 | |||
| 694 | Ga0070665_100207151 | |||
| 695 | Ga0068855_100093598 | |||
| 696 | Ga0068855_100110749 | |||
| 697 | Ga0068855_100169449 | |||
| 698 | Ga0068855_100260114 | |||
| 699 | Ga0068857_100078539 | |||
| 700 | Ga0068856_100188455 | |||
| 701 | Ga0068852_100066059 | |||
| 702 | Ga0068852_100085700 | |||
| 703 | Ga0068852_100149890 | |||
| 704 | Ga0068859_100096291 | |||
| 705 | Ga0068861_100083970 | |||
| 706 | Ga0068861_100114747 | |||
| 707 | Ga0068861_100516443 | |||
| 708 | Ga0068870_10254690 | |||
| 709 | Ga0068863_100195680 | |||
| 710 | Ga0068858_100260996 | |||
| 711 | Ga0068860_100175408 | |||
| 712 | Ga0068862_100112782 | |||
| 713 | Ga0068862_100150171 | |||
| 714 | Ga0081455_10004176 | |||
| 715 | Ga0081455_10010174 | |||
| 716 | Ga0081455_10082583 | |||
| 717 | Ga0081540_1000916 | |||
| 718 | Ga0081540_1002076 | |||
| 719 | Ga0081540_1007867 | |||
| 720 | Ga0081540_1009948 | |||
| 721 | Ga0081540_1010080 | |||
| 722 | Ga0081540_1013183 | |||
| 723 | Ga0081540_1023779 | |||
| 724 | Ga0081540_1033556 | |||
| 725 | Ga0081540_1038342 | |||
| 726 | Ga0081540_1091421 | |||
| 727 | Ga0081539_10000231 | |||
| 728 | Ga0081539_10020813 | |||
| 729 | Ga0070717_10011110 | |||
| 730 | Ga0070717_10011832 | |||
| 731 | Ga0070717_10155077 | |||
| 732 | Ga0075365_10008505 | |||
| 733 | Ga0075365_10009018 | |||
| 734 | Ga0075368_10038622 | |||
| 735 | Ga0075363_100004318 | |||
| 736 | Ga0075364_10096502 | |||
| 737 | Ga0075364_10106705 | |||
| 738 | Ga0075364_10191583 | |||
| 739 | Ga0070715_10001251 | |||
| 740 | Ga0070716_100001709 | |||
| 741 | Ga0070712_100001161 | |||
| 742 | Ga0070712_100121902 | |||
| 743 | Ga0075362_10031729 | |||
| 744 | Ga0075367_10004932 | |||
| 745 | Ga0075367_10086371 | |||
| 746 | Ga0097621_100179502 | |||
| 747 | Ga0075370_10005485 | |||
| 748 | Ga0068871_100227010 | |||
| 749 | Ga0075434_100058499 | |||
| 750 | Ga0075434_100255361 | |||
| 751 | Ga0097620_100096286 | |||
| 752 | Ga0099794_10037474 | |||
| 753 | Ga0099794_10093914 | |||
| 754 | Ga0099795_10043655 | |||
| 755 | Ga0099795_10044626 | |||
| 756 | Ga0105240_10010935 | |||
| 757 | Ga0105240_10086695 | |||
| 758 | Ga0105240_10380741 | |||
| 759 | Ga0105240_10393842 | |||
| 760 | Ga0111539_10107307 | |||
| 761 | Ga0105247_10080814 | |||
| 762 | Ga0114129_10089261 | |||
| 763 | Ga0105243_10021839 | |||
| 764 | Ga0105243_10122579 | |||
| 765 | Ga0105241_10004891 | |||
| 766 | Ga0105248_10126043 | |||
| 767 | Ga0105248_10234871 | |||
| 768 | Ga0105237_10055128 | |||
| 769 | Ga0105237_10081307 | |||
| 770 | Ga0105237_10103828 | |||
| 771 | Ga0105237_10301210 | |||
| 772 | Ga0105237_10552242 | |||
| 773 | Ga0105238_10029225 | |||
| 774 | Ga0105238_10215461 | |||
| 775 | Ga0105249_10177450 | |||
| 776 | Ga0099796_10006618 | |||
| 777 | Ga0105239_10051701 | |||
| 778 | Ga0105239_10152234 | |||
| 779 | Ga0105239_10176562 | |||
| 780 | Ga0105239_10333746 | |||
| 781 | Ga0105239_10562033 | |||
| 782 | Ga0105239_10909895 | |||
| 783 | Ga0105246_10326456 | |||
| 784 | Ga0157370_10033888 | |||
| 785 | Ga0157370_10226401 | |||
| 786 | Ga0157370_10227914 | |||
| 787 | Ga0157369_10020068 | |||
| 788 | Ga0157369_10059704 | |||
| 789 | Ga0157369_10084240 | |||
| 790 | Ga0157369_10299154 | |||
| 791 | Ga0157374_10305588 | |||
| 792 | Ga0157374_10433744 | |||
| 793 | Ga0157378_10312619 | |||
| 794 | Ga0163162_10174038 | |||
| 795 | Ga0163162_10697794 | |||
| 796 | Ga0157372_10141856 | |||
| 797 | Ga0157375_10104163 | |||
| 798 | Ga0157375_10307999 | |||
| 799 | Ga0163163_10368519 | |||
| 800 | Ga0157380_10086780 | |||
| 801 | Ga0157380_10236593 | |||
| 802 | Ga0157377_10094537 | |||
| 803 | Ga0157376_10222800 | |||
| 804 | Ga0157376_10276499 | |||
| 805 | Ga0157376_10680951 | |||
| 806 | Ga0163161_10041961 | |||
| 807 | Ga0213872_10038795 | |||
| 808 | Ga0213876_10075853 | |||
| 809 | Ga0207653_10013839 | |||
| 810 | Ga0207692_10006314 | |||
| 811 | Ga0207692_10059541 | |||
| 812 | Ga0207692_10334133 | |||
| 813 | Ga0207642_10066243 | |||
| 814 | Ga0207710_10017955 | |||
| 815 | Ga0207710_10058250 | |||
| 816 | Ga0207688_10072741 | |||
| 817 | Ga0207647_10142011 | |||
| 818 | Ga0207699_10032420 | |||
| 819 | Ga0207699_10109690 | |||
| 820 | Ga0207645_10076652 | |||
| 821 | Ga0207643_10070736 | |||
| 822 | Ga0207643_10207891 | |||
| 823 | Ga0207707_10032881 | |||
| 824 | Ga0207707_10223247 | |||
| 825 | Ga0207695_10080329 | |||
| 826 | Ga0207695_10119813 | |||
| 827 | Ga0207695_10282252 | |||
| 828 | Ga0207671_10220117 | |||
| 829 | Ga0207671_10232885 | |||
| 830 | Ga0207693_10002224 | |||
| 831 | Ga0207693_10010627 | |||
| 832 | Ga0207693_10098488 | |||
| 833 | Ga0207663_10004497 | |||
| 834 | Ga0207663_10076274 | |||
| 835 | Ga0207660_10247507 | |||
| 836 | Ga0207660_10255958 | |||
| 837 | Ga0207657_10128699 | |||
| 838 | Ga0207657_10238841 | |||
| 839 | Ga0207649_10154426 | |||
| 840 | Ga0207652_10059534 | |||
| 841 | Ga0207694_10151031 | |||
| 842 | Ga0207694_10208588 | |||
| 843 | Ga0207650_10163541 | |||
| 844 | Ga0207687_10515325 | |||
| 845 | Ga0207700_10001654 | |||
| 846 | Ga0207700_10043237 | |||
| 847 | Ga0207700_10057360 | |||
| 848 | Ga0207664_10023714 | |||
| 849 | Ga0207664_10185348 | |||
| 850 | Ga0207664_10695904 | |||
| 851 | Ga0207644_10148517 | |||
| 852 | Ga0207644_10362503 | |||
| 853 | Ga0207690_10195817 | |||
| 854 | Ga0207690_10398114 | |||
| 855 | Ga0207706_10206067 | |||
| 856 | Ga0207709_10080150 | |||
| 857 | Ga0207669_10002996 | |||
| 858 | Ga0207704_10474287 | |||
| 859 | Ga0207665_10001251 | |||
| 860 | Ga0207665_10125910 | |||
| 861 | Ga0207665_10331897 | |||
| 862 | Ga0207691_10136105 | |||
| 863 | Ga0207711_10059809 | |||
| 864 | Ga0207689_10006687 | |||
| 865 | Ga0207661_10001651 | |||
| 866 | Ga0207679_10153634 | |||
| 867 | Ga0207667_10069936 | |||
| 868 | Ga0207667_10127208 | |||
| 869 | Ga0207667_10187767 | |||
| 870 | Ga0207667_10270002 | |||
| 871 | Ga0207667_10581632 | |||
| 872 | Ga0207712_10086004 | |||
| 873 | Ga0207668_10013209 | |||
| 874 | Ga0207668_10229939 | |||
| 875 | Ga0207677_10335451 | |||
| 876 | Ga0207703_10073383 | |||
| 877 | Ga0207703_10660064 | |||
| 878 | Ga0207639_10008087 | |||
| 879 | Ga0207639_10329279 | |||
| 880 | Ga0207639_10457932 | |||
| 881 | Ga0207639_10474916 | |||
| 882 | Ga0207678_10099645 | |||
| 883 | Ga0207678_10122781 | |||
| 884 | Ga0207678_10143838 | |||
| 885 | Ga0207678_10162232 | |||
| 886 | Ga0207678_10273604 | |||
| 887 | Ga0207702_10444428 | |||
| 888 | Ga0207641_10520009 | |||
| 889 | Ga0207648_10081718 | |||
| 890 | Ga0207648_10133732 | |||
| 891 | Ga0207676_10632015 | |||
| 892 | Ga0207674_10091694 | |||
| 893 | Ga0207674_10315174 | |||
| 894 | Ga0207683_10216239 | |||
| 895 | Ga0209179_1030046 | |||
| 896 | Ga0209588_1028195 | |||
| 897 | Ga0209813_10024321 | |||
| 898 | Ga0268266_10002460 | |||
| 899 | Ga0268266_10004661 | |||
| 900 | Ga0268266_10015920 | |||
| 901 | Ga0268265_10099590 | |||
| 902 | Ga0268265_10133879 | |||
| 903 | Ga0268264_10349515 | |||
| 904 | Ga0307517_10000369 | |||
| 905 | Ga0307515_10030519 | |||
| 906 | Ga0307515_10090921 | |||
| 907 | Ga0265330_10007158 | |||
| 908 | Ga0265332_10084409 | |||
| 909 | Ga0265328_10089627 | |||
| 910 | Ga0265328_10108623 | |||
| 911 | Ga0265325_10080950 | |||
| 912 | Ga0265340_10000672 | |||
| 913 | Ga0265339_10079649 | |||
| 914 | Ga0265316_10367121 | |||
| 915 | Ga0307508_10108597 | |||
| 916 | Ga0265314_10123764 | |||
| 917 | Ga0265342_10075248 | |||
| 918 | Ga0307516_10038865 | |||
| 919 | Ga0307516_10186034 | |||
| 920 | Ga0307409_100299265 | |||
| 921 | Ga0307510_10000998 | |||
| 922 | Ga0307510_10019012 | |||
| 923 | Ga0373934_0001558 | |||
| 924 | Ga0373923_0001683 | |||
| 925 | Ga0373936_0091225 | |||
| 926 | Ga0373945_0035194 | |||
| 927 | Ga0373945_0107868 | |||
| 928 | Ga0373953_0000361 | |||
| 929 | Ga0373954_0000316 | |||
| 930 | Ga0373954_0007882 | |||
| 931 | Ga0373956_0000552 | |||
| 932 | Ga0373956_0099565 | |||
| 933 | Ga0373957_0001213 | |||
| 934 | Ga0373957_0013764 | |||
| 935 | Ga0373943_0018493 | |||
| 936 | Ga0373946_0023704 | |||
| 937 | Ga0373955_0000487 | |||
| 938 | Ga0373955_0121564 | |||
| 939 | Ga0373931_0008509 | |||
| 940 | Ga0373927_0000689 | |||
| 941 | Ga0373927_0018091 | |||
| 942 | Ga0373927_0271665 | |||
| 943 | Ga0373933_0000457 | |||
| 944 | Ga0373933_0002519 | |||
| 945 | Ga0373933_0123293 | |||
| 946 | Ga0373947_0175808 | |||
| 947 | Ga0373937_0009000 | |||
| 948 | Ga0373937_0054595 | |||
| 949 | Ga0373937_0106364 | |||
| 950 | Ga0373937_0277395 | |||
| 951 | Ga0373937_0473322 | |||
| 952 | Ga0373925_0012575 | |||
| 953 | Ga0373925_0310041 | |||
| 954 | Ga0395899_0016476 | |||
| 955 | Ga0395900_0069888 | |||
| 956 | Ga0395900_0086492 | |||
| 957 | Ga0395900_0095571 | |||
| 958 | Ga0395900_0704694 | |||
| 959 | Ga0395898_0069601 | |||
| 960 | Ga0395905_0247717 | |||
| 961 | Ga0395901_0025301 | |||
| 962 | Ga0395901_0170599 | |||
| 963 | Ga0436365_0093056 | |||
| 964 | Ga0436365_0481530 | |||
| 965 | Ga0436361_1013230 | |||
| 966 | Ga0466966_0136977 | |||
| 967 | Ga0466963_0025384 | |||
| 968 | Ga0495592_0003091 | |||
| 969 | Ga0495592_0023120 | |||
| 970 | Ga0495603_0000177 | |||
| 971 | Ga0495603_0009078 | |||
| 972 | Ga0495603_0034092 | |||
| 973 | Ga0495629_0000398 | |||
| 974 | Ga0495629_0035132 | |||
| 975 | Ga0495629_0076861 | |||
| 976 | Ga0495638_0029482 | |||
| 977 | Ga0495638_0095492 | |||
| 978 | Ga0495638_0237532 | |||
| 979 | Ga0495651_0118563 | |||
| 980 | Ga0495651_0236674 | |||
| 981 | Ga0495653_0000598 | |||
| 982 | Ga0495580_0000787 | |||
| 983 | Ga0495582_0000270 | |||
| 984 | Ga0495639_0000934 | |||
| 985 | Ga0495639_0046735 | |||
| 986 | Ga0495639_0132649 | |||
| 987 | Ga0495662_0000993 | |||
| 988 | Ga0495662_0072779 | |||
| 989 | Ga0495664_0010266 | |||
| 990 | Ga0495594_0020026 | |||
| 991 | Ga0495596_0051846 | |||
| 992 | Ga0495608_0003605 | |||
| 993 | Ga0495608_0048171 | |||
| 994 | Ga0495618_0031249 | |||
| 995 | Ga0495628_0020320 | |||
| 996 | Ga0495628_0059387 | |||
| 997 | Ga0495628_0173347 | |||
| 998 | Ga0495632_0023495 | |||
| 999 | Ga0495643_0051248 | |||
| 1000 | Ga0495644_0036429 | |||
| 1001 | Ga0495644_0063134 | |||
| 1002 | Ga0495648_0000552 | |||
| 1003 | Ga0495648_0121754 | |||
| 1004 | Ga0495652_0009837 | |||
| 1005 | Ga0495652_0053793 | |||
| 1006 | Ga0495665_0003851 | |||
| 1007 | Ga0495640_0018303 | |||
| 1008 | Ga0495640_0180467 | |||
| 1009 | Ga0495587_0001477 | |||
| 1010 | Ga0495587_0018599 | |||
| 1011 | Ga0495587_0240779 | |||
| 1012 | Ga0495598_0016764 | |||
| 1013 | Ga0495645_0013443 | |||
| 1014 | Ga0495645_0026867 | |||
| 1015 | Ga0495645_0048587 | |||
| 1016 | Ga0495622_0187537 | |||
| 1017 | Ga0495633_0039699 | |||
| 1018 | Ga0495667_0001371 | |||
| 1019 | Ga0495656_0014338 | |||
| 1020 | Ga0495656_0044632 | |||
| 1021 | Ga0495634_0001270 | |||
| 1022 | Ga0495634_0021114 | |||
| 1023 | Ga0495611_0073044 | |||
| 1024 | Ga0495625_0114741 | |||
| 1025 | Ga0495625_0171506 | |||
| 1026 | Ga0495625_0355898 | |||
| 1027 | Ga0495635_0000102 | |||
| 1028 | Ga0495635_0000463 | |||
| 1029 | Ga0495659_0026752 | |||
| 1030 | Ga0495659_0030017 | |||
| 1031 | Ga0495661_0165612 | |||
| 1032 | Ga0495588_0007900 | |||
| 1033 | Ga0495588_0054875 | |||
| 1034 | Ga0495657_0000677 | |||
| 1035 | Ga0495657_0242038 | |||
| 1036 | Ga0495599_0001270 | |||
| 1037 | Ga0495599_0053286 | |||
| 1038 | Ga0495599_0075486 | |||
| 1039 | Ga0495623_0000625 | |||
| 1040 | Ga0495623_0004014 | |||
| 1041 | Ga0495623_0048172 | |||
| 1042 | Ga0495646_0003261 | |||
| 1043 | Ga0495646_0016166 | |||
| 1044 | Ga0495646_0026066 | |||
| 1045 | Ga0495647_0001462 | |||
| 1046 | Ga0495647_0095922 | |||
| 1047 | Ga0495658_0000636 | |||
| 1048 | Ga0495658_0107627 | |||
| 1049 | Ga0495669_0004639 | |||
| 1050 | Ga0495669_0052783 | |||
| 1051 | Ga0495669_0143892 | |||
| 1052 | Ga0495613_0015258 | |||
| 1053 | Ga0495613_0282693 | |||
| 1054 | Ga0495624_0000635 | |||
| 1055 | Ga0495624_0047924 | |||
| 1056 | Ga0495670_0030185 | |||
| 1057 | Ga0495671_0088814 | |||
| 1058 | Ga0495600_0004238 | |||
| 1059 | Ga0495600_0276929 | |||
| 1060 | Ga0495581_0000666 | |||
| 1061 | Ga0495604_0002400 | |||
| 1062 | Ga0495604_0057108 | |||
| 1063 | Ga0495674_0001332 | |||
| 1064 | Ga0495674_0028322 | |||
| 1065 | Ga0495672_0006967 | |||
| 1066 | Ga0495676_0026159 | |||
| 1067 | Ga0495676_0289656 | |||
| 1068 | Ga0495680_0003276 | |||
| 1069 | Ga0495680_0030065 | |||
| 1070 | Ga0495680_0405393 | |||
| 1071 | Ga0495675_0000456 | |||
| 1072 | Ga0495685_024527 | |||
| 1073 | Ga0495684_0000088 | |||
| 1074 | Ga0495684_0018537 | |||
| 1075 | Ga0495593_0001738 | |||
| 1076 | Ga0495593_0003108 | |||
| 1077 | Ga0495602_0023364 | |||
| 1078 | Ga0495602_0095292 | |||
| 1079 | Ga0495614_0017326 | |||
| 1080 | Ga0496100_0110818 | |||
| 1081 | Ga0496101_0042282 | |||
| 1082 | Ga0496101_0075487 | |||
| 1083 | Ga0496102_0075575 | |||
| 1084 | Ga0496102_0091895 | |||
| 1085 | Ga0496103_0285117 | |||
| 1086 | Ga0496104_0271820 | |||
| 1087 | Ga0496105_0090242 | |||
| 1088 | Ga0496106_0130805 | |||
| 1089 | Ga0496106_0192418 | |||
| 1090 | Ga0496106_0387529 | |||
| 1091 | Ga0496107_0043664 | |||
| 1092 | Ga0496107_0275090 | |||
| 1093 | Ga0496108_0082776 | |||
| 1094 | Ga0496109_0194808 | |||
| 1095 | Ga0496109_0686808 | |||
| 1096 | Ga0496110_0059716 | |||
| 1097 | Ga0496110_0155507 | |||
| 1098 | Ga0496111_0029904 | |||
| 1099 | Ga0496111_0050002 | |||
| 1100 | Ga0496112_0128228 | |||
| 1101 | Ga0496112_0148467 | |||
| 1102 | Ga0496112_0184912 | |||
| 1103 | Ga0496112_0378119 | |||
| 1104 | Ga0496113_0021547 | |||
| 1105 | Ga0496113_0031385 | |||
| 1106 | Ga0496113_0264527 | |||
| 1107 | Ga0496115_0013657 | |||
| 1108 | Ga0496115_0015011 | |||
| 1109 | Ga0496115_0192380 | |||
| 1110 | Ga0496116_0000614 | |||
| 1111 | Ga0496116_0131350 | |||
| 1112 | Ga0496117_0053851 | |||
| 1113 | Ga0496117_0094278 | |||
| 1114 | Ga0496117_0201766 | |||
| 1115 | Ga0496118_0022339 | |||
| 1116 | Ga0496118_0060323 | |||
| 1117 | Ga0496118_0113873 | |||
| 1118 | Ga0496119_0070945 | |||
| 1119 | Ga0496119_0082040 | |||
| 1120 | Ga0496121_0001831 | |||
| 1121 | Ga0496121_0004034 | |||
| 1122 | Ga0496121_0005947 | |||
| 1123 | Ga0496121_0030689 | |||
| 1124 | Ga0496121_0035373 | |||
| 1125 | Ga0496121_0093988 | |||
| 1126 | Ga0496121_0094086 | |||
| 1127 | Ga0496121_0247436 | |||
| 1128 | Ga0496121_0267178 | |||
| 1129 | Ga0496121_0345145 | |||
| 1130 | Ga0496123_0026472 | |||
| 1131 | Ga0496124_0084507 | |||
| 1132 | Ga0496124_0165219 | |||
| 1133 | Ga0496124_0450592 | |||
| 1134 | Ga0496125_0024640 | |||
| 1135 | Ga0496125_0045551 | |||
| 1136 | Ga0496126_0014520 | |||
| 1137 | Ga0496126_0021086 | |||
| 1138 | Ga0496126_0022214 | |||
| 1139 | Ga0496126_0104296 | |||
| 1140 | Ga0496126_0132457 | |||
| 1141 | Ga0496126_0155357 | |||
| 1142 | Ga0496126_0224218 | |||
| 1143 | Ga0496126_0269117 | |||
| 1144 | Ga0501031_0168821 | |||
| 1145 | Ga0501031_0228355 | |||
| 1146 | Ga0501031_0307165 | |||
| 1147 | Ga0501032_0012575 | |||
| 1148 | Ga0501033_0067426 | |||
| 1149 | Ga0501033_0229516 | |||
| 1150 | Ga0501036_0010711 | |||
| 1151 | Ga0501037_0179541 | |||
| 1152 | Ga0501038_0002212 | |||
| 1153 | Ga0501038_0055463 | |||
| 1154 | Ga0501042_0436386 | |||
| 1155 | Ga0501043_0012610 | |||
| 1156 | Ga0501047_0137957 | |||
| 1157 | Ga0501047_0143083 | |||
| 1158 | Ga0501048_0111351 | |||
| 1159 | Ga0501070_0063872 | |||
| 1160 | Ga0501035_0015312 | |||
| 1161 | Ga0501035_0198318 | |||
| 1162 | Ga0501035_0352052 | |||
| 1163 | Ga0501044_0061332 | |||
| 1164 | Ga0501044_0143034 | |||
| 1165 | nmdc:mga03683_29970_c1 | |||
| 1166 | nmdc:mga03n38_4403_c1 | |||
| 1167 | nmdc:mga00v17_217566_c1 | |||
| 1168 | nmdc:mga00v17_40947_c1 | |||
| 1169 | nmdc:mga00v17_5942_c1 | |||
| 1170 | nmdc:mga0yw44_2168_c1 | |||
| 1171 | nmdc:mga0yw44_23552_c1 | |||
| 1172 | nmdc:mga0yw44_84927_c1 | |||
| 1173 | nmdc:mga06z11_28787_c1 | |||
| 1174 | nmdc:mga04h51_111832_c1 | |||
| 1175 | nmdc:mga05p37_450826_c1 | |||
| 1176 | nmdc:mga0n895_13512_c1 | |||
| 1177 | nmdc:mga08x19_347232_c1 | |||
| 1178 | nmdc:mga08x19_73275_c1 | |||
| 1179 | nmdc:mga0sz30_40561_c1 | |||
| 1180 | Ga0495601_0013055 | |||
| 1181 | Ga0495601_0043899 | |||
| 1182 | Ga0495601_0144267 | |||
| 1183 | Ga0495595_0010622 | |||
| 1184 | Ga0495595_0067281 | |||
| 1185 | Ga0495595_0081213 | |||
| 1186 | Ga0495619_0021169 | |||
| 1187 | Ga0495619_0104382 | |||
| 1188 | Ga0495619_0114567 | |||
| 1189 | Ga0500643_065857 | |||
| 1190 | Ga0500644_0048683 | |||
| 1191 | Ga0500646_0027375 | |||
| 1192 | Ga0500583_0055684 | |||
| 1193 | Ga0500583_0136295 | |||
| 1194 | Ga0500641_0000746 | |||
| 1195 | Ga0500641_0084511 | |||
| 1196 | Ga0500650_0003633 | |||
| 1197 | Ga0500554_014121 | |||
| 1198 | Ga0500556_0000030 | |||
| 1199 | Ga0500562_059472 | |||
| 1200 | Ga0500572_001228 | |||
| 1201 | Ga0500595_000159 | |||
| 1202 | Ga0500595_001073 | |||
| 1203 | Ga0500595_001169 | |||
| 1204 | Ga0500595_027758 | |||
| 1205 | Ga0500595_053585 | |||
| 1206 | Ga0500642_0000028 | |||
| 1207 | Ga0500642_0073725 | |||
| 1208 | Ga0500642_0115160 | |||
| 1209 | Ga0500652_000170 | |||
| 1210 | Ga0500655_033405 | |||
| 1211 | Ga0500658_0035552 | |||
| 1212 | Ga0500559_0000204 | |||
| 1213 | Ga0500559_0000579 | |||
| 1214 | Ga0500568_0000772 | |||
| 1215 | Ga0500586_005334 | |||
| 1216 | Ga0500590_065914 | |||
| 1217 | Ga0500603_000967 | |||
| 1218 | Ga0500604_0008804 | |||
| 1219 | Ga0500616_0000139 | |||
| 1220 | Ga0500616_0000413 | |||
| 1221 | Ga0500622_0011373 | |||
| 1222 | Ga0500622_0033941 | |||
| 1223 | Ga0500633_0079896 | |||
| 1224 | Ga0500634_0099648 | |||
| 1225 | Ga0500638_016399 | |||
| 1226 | Ga0500639_010198 | |||
| 1227 | Ga0500636_0027080 | |||
| 1228 | Ga0500637_0000349 | |||
| 1229 | Ga0500637_0029118 | |||
| 1230 | Ga0500637_0032667 | |||
| 1231 | Ga0500645_016868 | |||
| 1232 | Ga0500645_025154 | |||
| 1233 | Ga0500609_012676 | |||
| 1234 | Ga0500656_012338 | |||
| 1235 | Ga0500596_001122 | |||
| 1236 | Ga0466962_0083658 | |||
| 1237 | 2509153269 | |||
| 1238 | 2513691663 | |||
| 1239 | 2513889370 | |||
| 1240 | 2524439722 | |||
| 1241 | 2603859758 | |||
| 1242 | 2644288151 | |||
| 1243 | 2723845918 | |||
| 1244 | 2793082686 | |||
| 1245 | 2824686376 | |||
| 1246 | 2857530638 | |||
| 1247 | 2874609428 | |||
| 1248 | 2876813186 | |||
| 1249 | 2879110350 | |||
| 1250 | 2885373403 | |||
| 1251 | 2889040770 | |||
| 1252 | 2893070283 | |||
| 1253 | 2919076236 | |||
| 1254 | 2922367871 | |||
| 1255 | 2922392239 | |||
| 1256 | 2922395474 | |||
| 1257 | 8006968702 | |||
| 1258 | 8006990556 | |||
| 1259 | 8006996312 | |||
| 1260 | 8056678110 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5fn3-assembly1.cif.gz_C | cryo-em structure of gamma secretase in class 1 of the apo- state ensemble | 0.3007 | 25 | 253 |
| 6idf-assembly1.cif.gz_C | cryo-em structure of gamma secretase in complex with a notch fragment | 0.2914 | 25 | 253 |
| 1zb1-assembly2.cif.gz_B | structure basis for endosomal targeting by the bro1 domain | 0.2605 | 33 | 253 |
| 7wmn-assembly1.cif.gz_A | a novel chemical derivative(89) of thrb agonist | 0.2587 | 22 | 248 |
| 5hjp-assembly1.cif.gz_B | identification of lxrbeta selective agonists for the treatment of alzheimer's disease | 0.2585 | 20 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9ZZX1_1_342_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.2564 | 26 | 251 | 1.20.210.10 |
| af_I1MZT7_156_506_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2552 | 33 | 253 | 1.20.1250.20 |
| af_Q55DY8_111_308_1.50.40.10 | Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain | 0.2532 | 25 | 252 | 1.50.40.10 |
| 4onrA00 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Decorin-binding protein | 0.2492 | 103 | 253 | 1.20.1420.40 |
| af_Q7XGH1_28_225_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2457 | 24 | 246 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496V419-F1-model_v4 | CPBP family intramembrane metalloprotease | 0.9952 | 158 | 252 |
GO:0004222
GO:0016020 GO:0071586 |
| AF-A0A1W9WEP6-F1-model_v4 | CPBP family intramembrane metalloprotease | 0.9946 | 158 | 252 |
GO:0004222
GO:0016020 GO:0071586 |
| AF-A0A1I5FWA8-F1-model_v4 | CAAX protease self-immunity | 0.9807 | 155 | 247 |
GO:0004222
GO:0016020 GO:0071586 |
| AF-A0A5A7W8G0-F1-model_v4 | CPBP family intramembrane metalloprotease | 0.976 | 38 | 253 |
GO:0004222
GO:0016020 GO:0071586 |
| AF-A0A538PJC5-F1-model_v4 | CPBP family intramembrane metalloprotease | 0.9738 | 84 | 250 |
GO:0004222
GO:0016020 GO:0071586 |