F470894

General Info

Members Datasets Scaffolds Average Seq Length
631 297 631 246

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100110702|Ga0070714_1001107022
Length 243
Sequence MSETNTGAPPAHIAIIMDGNGRWAKSRGLMRHAGHKAGLDTARAIIEHCAERKVGVLTLFTFSSENWQRPETEVGLLMELFLVALGKDVRDLHKNGIRVRFIGDRAAFSPKLQGGMAEAETLTARNPRMLLNIAVGYGGRWDILDAARRLAAQGKLETADETALGAAMALGDGPDPDLFIRTGGEKRISNFLLWNLAYTELYFTDTLWPDFGKSQLDEAIIWFQARQRRFGKTGEQMEDRERA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
151 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
156 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
194 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
210 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
211 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
212 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
213 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
214 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
215 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
216 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
220 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
221 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
222 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
223 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
226 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 2.38
Rhizosphere 94.45
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10117779 3300005293 Bacteria 2336
2 Ga0065707_10083272 3300005295 Bacteria 9720
3 Ga0065707_10085402 3300005295 Bacteria 6181
4 Ga0070676_10001863 3300005328 Bacteria 10736
5 Ga0070676_10212112 3300005328 Bacteria 1275
6 Ga0070683_100347404 3300005329 Bacteria 1413
7 Ga0070690_100001101 3300005330 Bacteria 13893
8 Ga0070690_100027355 3300005330 Bacteria 3525
9 Ga0070690_100140187 3300005330 Bacteria 1641
10 Ga0070670_100003676 3300005331 Bacteria 12785
11 Ga0070670_100060245 3300005331 Bacteria 3259
12 Ga0070670_100258838 3300005331 Bacteria 1517
13 Ga0070670_100344443 3300005331 Bacteria 1309
14 Ga0070677_10027683 3300005333 Bacteria 2136
15 Ga0070666_10181299 3300005335 Bacteria 1477
16 Ga0070680_100049944 3300005336 Bacteria 3411
17 Ga0070682_100076899 3300005337 Bacteria 2150
18 Ga0070682_100128779 3300005337 Bacteria 1710
19 Ga0070689_100003117 3300005340 Bacteria 10950
20 Ga0070689_100014601 3300005340 Bacteria 5710
21 Ga0070689_100022584 3300005340 Bacteria 4699
22 Ga0070689_100240999 3300005340 Bacteria 1489
23 Ga0070689_100312810 3300005340 Bacteria 1310
24 Ga0070691_10195240 3300005341 Bacteria 1061
25 Ga0070687_100002410 3300005343 Bacteria 6987
26 Ga0070661_100140217 3300005344 Bacteria 1821
27 Ga0070668_100011367 3300005347 Bacteria 6631
28 Ga0070669_100010367 3300005353 Bacteria 6619
29 Ga0070669_100060857 3300005353 Bacteria 2774
30 Ga0070669_100176074 3300005353 Bacteria 1671
31 Ga0070675_100002544 3300005354 Bacteria 13645
32 Ga0070675_100008341 3300005354 Bacteria 8040
33 Ga0070675_100203523 3300005354 Bacteria 1718
34 Ga0070671_100061485 3300005355 Bacteria 3128
35 Ga0070671_100665646 3300005355 Bacteria 902
36 Ga0070674_100000687 3300005356 Bacteria 17126
37 Ga0070674_100072370 3300005356 Bacteria 2441
38 Ga0070674_100268553 3300005356 Bacteria 1347
39 Ga0070673_100009396 3300005364 Bacteria 6563
40 Ga0070673_100016833 3300005364 Bacteria 5183
41 Ga0070673_100039789 3300005364 Bacteria 3602
42 Ga0070688_100125584 3300005365 Bacteria 1724
43 Ga0070688_100219988 3300005365 Bacteria 1338
44 Ga0070688_100244949 3300005365 Bacteria 1274
45 Ga0070667_100022124 3300005367 Bacteria 5273
46 Ga0070667_100043527 3300005367 Bacteria 3768
47 Ga0070667_100548850 3300005367 Bacteria 1062
48 Ga0070714_100110702 3300005435 Bacteria 2431
49 Ga0070713_100210102 3300005436 Bacteria 1761
50 Ga0070701_10038359 3300005438 Bacteria 2424
51 Ga0070701_10056323 3300005438 Bacteria 2056
52 Ga0070711_100004271 3300005439 Bacteria 8404
53 Ga0070711_100121670 3300005439 Bacteria 1931
54 Ga0070711_100121996 3300005439 Bacteria 1929
55 Ga0070705_100002488 3300005440 Bacteria 9262
56 Ga0070705_100032948 3300005440 Bacteria 2884
57 Ga0070700_100084892 3300005441 Bacteria 2053
58 Ga0070700_100149940 3300005441 Bacteria 1594
59 Ga0070694_100047554 3300005444 Bacteria 2884
60 Ga0070694_100068407 3300005444 Bacteria 2441
61 Ga0070694_100148749 3300005444 Bacteria 1708
62 Ga0070678_100047671 3300005456 Bacteria 3081
63 Ga0070678_100491796 3300005456 Bacteria 1081
64 Ga0070678_100491858 3300005456 Bacteria 1081
65 Ga0070662_100002548 3300005457 Bacteria 11222
66 Ga0070662_100023946 3300005457 Bacteria 4201
67 Ga0070662_100100118 3300005457 Bacteria 2192
68 Ga0070681_10003522 3300005458 Bacteria 14664
69 Ga0070681_10023343 3300005458 Bacteria 6219
70 Ga0070681_10043647 3300005458 Bacteria 4490
71 Ga0070681_10235398 3300005458 Bacteria 1745
72 Ga0068867_100010102 3300005459 Bacteria 6652
73 Ga0068867_100020743 3300005459 Bacteria 4684
74 Ga0070685_10017277 3300005466 Bacteria 3859
75 Ga0070685_10029825 3300005466 Bacteria 3034
76 Ga0070679_100006962 3300005530 Bacteria 10552
77 Ga0070679_100588829 3300005530 Bacteria 1056
78 Ga0070679_100747898 3300005530 Bacteria 920
79 Ga0070684_100015392 3300005535 Bacteria 6230
80 Ga0070684_100104912 3300005535 Bacteria 2529
81 Ga0068853_100390032 3300005539 Bacteria 1302
82 Ga0070672_100001677 3300005543 Bacteria 13800
83 Ga0070672_100021856 3300005543 Bacteria 4688
84 Ga0070672_100183081 3300005543 Bacteria 1746
85 Ga0070672_100487604 3300005543 Bacteria 1065
86 Ga0070686_100003731 3300005544 Bacteria 8370
87 Ga0070686_100015999 3300005544 Bacteria 4357
88 Ga0070686_100042530 3300005544 Bacteria 2846
89 Ga0070686_100052475 3300005544 Bacteria 2600
90 Ga0070695_100190601 3300005545 Bacteria 1459
91 Ga0070695_100218703 3300005545 Bacteria 1371
92 Ga0070696_100000163 3300005546 Bacteria 37742
93 Ga0070696_100198437 3300005546 Bacteria 1497
94 Ga0070665_100006360 3300005548 Bacteria 12045
95 Ga0070665_100040029 3300005548 Bacteria 4712
96 Ga0070665_100211971 3300005548 Bacteria 1938
97 Ga0070665_100499298 3300005548 Bacteria 1228
98 Ga0070704_100096067 3300005549 Bacteria 2221
99 Ga0068855_100003333 3300005563 Bacteria 19649
100 Ga0068855_100016755 3300005563 Bacteria 8814
101 Ga0068855_101097448 3300005563 Bacteria 832
102 Ga0070664_100005455 3300005564 Bacteria 10212
103 Ga0070664_100039620 3300005564 Bacteria 3971
104 Ga0070664_100180879 3300005564 Bacteria 1874
105 Ga0068857_100233738 3300005577 Bacteria 1682
106 Ga0068856_100108153 3300005614 Bacteria 2777
107 Ga0070702_100011363 3300005615 Bacteria 4427
108 Ga0068859_100011511 3300005617 Bacteria 8893
109 Ga0068859_100021941 3300005617 Bacteria 6402
110 Ga0068859_100281646 3300005617 Bacteria 1755
111 Ga0068859_100381571 3300005617 Bacteria 1505
112 Ga0068864_100002045 3300005618 Bacteria 16656
113 Ga0068864_100002439 3300005618 Bacteria 15376
114 Ga0068864_100180420 3300005618 Bacteria 1930
115 Ga0068866_10034628 3300005718 Bacteria 2461
116 Ga0068866_10038460 3300005718 Bacteria 2356
117 Ga0068861_100003473 3300005719 Bacteria 10458
118 Ga0068861_100005236 3300005719 Bacteria 8741
119 Ga0068861_100008857 3300005719 Bacteria 6935
120 Ga0068861_100017281 3300005719 Bacteria 5117
121 Ga0068861_100033104 3300005719 Bacteria 3811
122 Ga0068861_100033975 3300005719 Bacteria 3767
123 Ga0068861_100371092 3300005719 Bacteria 1261
124 Ga0068870_10002942 3300005840 Bacteria 7178
125 Ga0068870_10026255 3300005840 Bacteria 2902
126 Ga0068870_10082443 3300005840 Bacteria 1781
127 Ga0068863_100002890 3300005841 Bacteria 17011
128 Ga0068863_100004762 3300005841 Bacteria 13370
129 Ga0068863_100433948 3300005841 Bacteria 1288
130 Ga0068858_100012146 3300005842 Bacteria 8120
131 Ga0068858_100019368 3300005842 Bacteria 6363
132 Ga0068858_100752229 3300005842 Bacteria 950
133 Ga0068860_100093912 3300005843 Bacteria 2859
134 Ga0068860_100142094 3300005843 Bacteria 2308
135 Ga0068862_100001400 3300005844 Bacteria 22361
136 Ga0068862_100002538 3300005844 Bacteria 16147
137 Ga0068862_100008962 3300005844 Bacteria 8283
138 Ga0068862_100050879 3300005844 Bacteria 3542
139 Ga0068862_100119052 3300005844 Bacteria 2326
140 Ga0070712_100321671 3300006175 Bacteria 1258
141 Ga0097621_100011072 3300006237 Bacteria 6632
142 Ga0097621_100041180 3300006237 Bacteria 3717
143 Ga0097621_100350440 3300006237 Bacteria 1313
144 Ga0068871_100008181 3300006358 Bacteria 7512
145 Ga0068871_100227687 3300006358 Bacteria 1617
146 Ga0068871_100247607 3300006358 Bacteria 1551
147 Ga0075428_100003524 3300006844 Bacteria 17140
148 Ga0075428_100010558 3300006844 Bacteria 10266
149 Ga0075428_100057971 3300006844 Bacteria 4240
150 Ga0075428_100223805 3300006844 Bacteria 2031
151 Ga0075430_100004165 3300006846 Bacteria 12204
152 Ga0075430_100058924 3300006846 Bacteria 3228
153 Ga0075430_100129044 3300006846 Bacteria 2107
154 Ga0075430_100188277 3300006846 Bacteria 1716
155 Ga0075430_100266004 3300006846 Bacteria 1420
156 Ga0075430_100543041 3300006846 Bacteria 959
157 Ga0075431_100000318 3300006847 Bacteria 37976
158 Ga0075431_100006075 3300006847 Bacteria 11973
159 Ga0075431_100019257 3300006847 Bacteria 6957
160 Ga0075431_100081593 3300006847 Bacteria 3339
161 Ga0075431_100138436 3300006847 Bacteria 2509
162 Ga0075434_100270477 3300006871 Bacteria 1719
163 Ga0075429_100001918 3300006880 Bacteria 17254
164 Ga0068865_100005610 3300006881 Bacteria 7615
165 Ga0068865_100369982 3300006881 Bacteria 1166
166 Ga0097620_100011511 3300006931 Bacteria 8893
167 Ga0097620_100021941 3300006931 Bacteria 6402
168 Ga0097620_100281650 3300006931 Bacteria 1755
169 Ga0097620_100381570 3300006931 Bacteria 1505
170 Ga0075435_100056574 3300007076 Bacteria 3171
171 Ga0099795_10000075 3300007788 Bacteria 17387
172 Ga0105250_10000005 3300009092 Bacteria 422580
173 Ga0105240_10000096 3300009093 Bacteria 179543
174 Ga0105240_10010627 3300009093 Bacteria 12932
175 Ga0105240_10054925 3300009093 Bacteria 4989
176 Ga0111539_10023643 3300009094 Bacteria 7551
177 Ga0111539_10030953 3300009094 Bacteria 6502
178 Ga0111539_10093018 3300009094 Bacteria 3542
179 Ga0111539_10122978 3300009094 Bacteria 3041
180 Ga0111539_10374914 3300009094 Bacteria 1656
181 Ga0111539_10546423 3300009094 Bacteria 1349
182 Ga0111539_10640436 3300009094 Bacteria 1238
183 Ga0105245_10009466 3300009098 Bacteria 8498
184 Ga0105247_10024700 3300009101 Bacteria 3623
185 Ga0105247_10152924 3300009101 Bacteria 1522
186 Ga0114129_10022191 3300009147 Bacteria 9012
187 Ga0114129_10047662 3300009147 Bacteria 6021
188 Ga0114129_10727062 3300009147 Bacteria 1273
189 Ga0105243_10223885 3300009148 Bacteria 1664
190 Ga0105243_10556013 3300009148 Bacteria 1097
191 Ga0105241_10428336 3300009174 Bacteria 1166
192 Ga0105248_10000927 3300009177 Bacteria 32633
193 Ga0105248_10002211 3300009177 Bacteria 21553
194 Ga0105248_10334862 3300009177 Bacteria 1704
195 Ga0105238_10109519 3300009551 Bacteria 2743
196 Ga0105249_10042397 3300009553 Bacteria 4138
197 Ga0105249_10155934 3300009553 Bacteria 2202
198 Ga0105249_10223321 3300009553 Bacteria 1855
199 Ga0105030_101632 3300009987 Bacteria 1976
200 Ga0099796_10000041 3300010159 Bacteria 26122
201 Ga0099796_10024361 3300010159 Bacteria 1899
202 Ga0105246_10256532 3300011119 Bacteria 1391
203 Ga0157370_10234748 3300013104 Bacteria 1697
204 Ga0157369_10047434 3300013105 Bacteria 4664
205 Ga0157374_10002219 3300013296 Bacteria 16376
206 Ga0157374_10804867 3300013296 Bacteria 956
207 Ga0163162_10005133 3300013306 Bacteria 12619
208 Ga0163162_10125957 3300013306 Bacteria 2668
209 Ga0157372_10151956 3300013307 Bacteria 2673
210 Ga0157375_10029153 3300013308 Bacteria 5186
211 Ga0157514_118433 3300013874 Bacteria 1568
212 Ga0163163_10021084 3300014325 Bacteria 6147
213 Ga0163163_10035034 3300014325 Bacteria 4866
214 Ga0157380_10001526 3300014326 Bacteria 15211
215 Ga0157380_10007906 3300014326 Bacteria 7569
216 Ga0157380_10023810 3300014326 Bacteria 4625
217 Ga0157380_10094297 3300014326 Bacteria 2477
218 Ga0157380_10291200 3300014326 Bacteria 1499
219 Ga0157380_10492781 3300014326 Bacteria 1188
220 Ga0157377_10008214 3300014745 Bacteria 5079
221 Ga0157377_10392112 3300014745 Bacteria 943
222 Ga0157379_10000311 3300014968 Bacteria 38664
223 Ga0157379_10016987 3300014968 Bacteria 6405
224 Ga0157379_10208717 3300014968 Bacteria 1767
225 Ga0157379_10216275 3300014968 Bacteria 1736
226 Ga0157379_10833643 3300014968 Bacteria 872
227 Ga0157376_10283152 3300014969 Bacteria 1562
228 Ga0157376_10292418 3300014969 Bacteria 1539
229 Ga0163161_10385288 3300017792 Bacteria 1121
230 Ga0163161_10633028 3300017792 Bacteria 885
231 Ga0207696_1000470 3300025711 Bacteria 34731
232 Ga0207682_10015058 3300025893 Bacteria 3011
233 Ga0207682_10159148 3300025893 Bacteria 1022
234 Ga0207692_10290823 3300025898 Bacteria 991
235 Ga0207642_10027689 3300025899 Bacteria 2323
236 Ga0207688_10124247 3300025901 Bacteria 1508
237 Ga0207699_10137464 3300025906 Bacteria 1602
238 Ga0207645_10000328 3300025907 Bacteria 39622
239 Ga0207645_10017215 3300025907 Bacteria 4774
240 Ga0207645_10238821 3300025907 Bacteria 1200
241 Ga0207643_10005288 3300025908 Bacteria 6907
242 Ga0207643_10032712 3300025908 Bacteria 2906
243 Ga0207643_10088849 3300025908 Bacteria 1799
244 Ga0207654_10271841 3300025911 Bacteria 1143
245 Ga0207707_10004072 3300025912 Bacteria 12941
246 Ga0207707_10006250 3300025912 Bacteria 10400
247 Ga0207707_10008989 3300025912 Bacteria 8677
248 Ga0207707_10049560 3300025912 Bacteria 3659
249 Ga0207695_10000836 3300025913 Bacteria 56759
250 Ga0207695_10009041 3300025913 Bacteria 12383
251 Ga0207695_10055015 3300025913 Bacteria 4150
252 Ga0207663_10048278 3300025916 Bacteria 2634
253 Ga0207663_10131190 3300025916 Bacteria 1732
254 Ga0207663_10276455 3300025916 Bacteria 1246
255 Ga0207660_10013421 3300025917 Bacteria 5369
256 Ga0207660_10127806 3300025917 Bacteria 1931
257 Ga0207660_10595125 3300025917 Bacteria 901
258 Ga0207662_10018456 3300025918 Bacteria 3959
259 Ga0207649_10106185 3300025920 Bacteria 1867
260 Ga0207652_10001982 3300025921 Bacteria 17714
261 Ga0207652_10065733 3300025921 Bacteria 3141
262 Ga0207652_10221539 3300025921 Bacteria 1705
263 Ga0207681_10011754 3300025923 Bacteria 5383
264 Ga0207681_10050016 3300025923 Bacteria 2827
265 Ga0207681_10383458 3300025923 Bacteria 1132
266 Ga0207681_10533130 3300025923 Bacteria 964
267 Ga0207694_10225623 3300025924 Bacteria 1529
268 Ga0207650_10022398 3300025925 Bacteria 4471
269 Ga0207650_10061558 3300025925 Bacteria 2802
270 Ga0207650_10062171 3300025925 Bacteria 2789
271 Ga0207659_10028250 3300025926 Bacteria 3810
272 Ga0207659_10064429 3300025926 Bacteria 2652
273 Ga0207659_10111164 3300025926 Bacteria 2083
274 Ga0207687_10287716 3300025927 Bacteria 1320
275 Ga0207664_10032053 3300025929 Bacteria 4026
276 Ga0207690_10078328 3300025932 Bacteria 2300
277 Ga0207706_10000476 3300025933 Bacteria 42949
278 Ga0207706_10171654 3300025933 Bacteria 1905
279 Ga0207706_10174679 3300025933 Bacteria 1887
280 Ga0207670_10014599 3300025936 Bacteria 4670
281 Ga0207669_10020431 3300025937 Bacteria 3473
282 Ga0207669_10062244 3300025937 Bacteria 2297
283 Ga0207669_10435504 3300025937 Bacteria 1035
284 Ga0207704_10019354 3300025938 Bacteria 3573
285 Ga0207704_10173070 3300025938 Bacteria 1551
286 Ga0207704_10370082 3300025938 Bacteria 1122
287 Ga0207691_10013230 3300025940 Bacteria 7903
288 Ga0207691_10026146 3300025940 Bacteria 5477
289 Ga0207691_10098260 3300025940 Bacteria 2615
290 Ga0207691_10562969 3300025940 Bacteria 966
291 Ga0207711_10559056 3300025941 Bacteria 1067
292 Ga0207689_10006698 3300025942 Bacteria 10164
293 Ga0207689_10101721 3300025942 Bacteria 2360
294 Ga0207689_10302840 3300025942 Bacteria 1325
295 Ga0207689_10764309 3300025942 Bacteria 815
296 Ga0207661_10588714 3300025944 Bacteria 1021
297 Ga0207679_10085067 3300025945 Bacteria 2428
298 Ga0207679_10133114 3300025945 Bacteria 1998
299 Ga0207667_10000859 3300025949 Bacteria 39082
300 Ga0207667_10008918 3300025949 Bacteria 11864
301 Ga0207667_10030874 3300025949 Bacteria 5791
302 Ga0207651_10006633 3300025960 Bacteria 6084
303 Ga0207651_10042234 3300025960 Bacteria 3033
304 Ga0207651_10235111 3300025960 Bacteria 1490
305 Ga0207712_10008158 3300025961 Bacteria 6618
306 Ga0207712_10135957 3300025961 Bacteria 1880
307 Ga0207712_10343749 3300025961 Bacteria 1238
308 Ga0207668_10054973 3300025972 Bacteria 2765
309 Ga0207668_10059709 3300025972 Bacteria 2673
310 Ga0207640_10102706 3300025981 Bacteria 2008
311 Ga0207640_10249731 3300025981 Bacteria 1376
312 Ga0207658_10080979 3300025986 Bacteria 2489
313 Ga0207658_10125795 3300025986 Bacteria 2051
314 Ga0207677_10038461 3300026023 Bacteria 3137
315 Ga0207677_10051445 3300026023 Bacteria 2793
316 Ga0207703_10008219 3300026035 Bacteria 8244
317 Ga0207703_10157555 3300026035 Bacteria 1986
318 Ga0207639_10333010 3300026041 Bacteria 1351
319 Ga0207639_10483660 3300026041 Bacteria 1129
320 Ga0207708_10009104 3300026075 Bacteria 7348
321 Ga0207708_10017361 3300026075 Bacteria 5417
322 Ga0207708_10174181 3300026075 Bacteria 1705
323 Ga0207708_10362298 3300026075 Bacteria 1192
324 Ga0207641_10009300 3300026088 Bacteria 8107
325 Ga0207641_10142750 3300026088 Bacteria 2162
326 Ga0207641_10408195 3300026088 Bacteria 1305
327 Ga0207648_10000334 3300026089 Bacteria 51629
328 Ga0207648_10012447 3300026089 Bacteria 7966
329 Ga0207648_10164457 3300026089 Bacteria 1960
330 Ga0207648_10561261 3300026089 Bacteria 1049
331 Ga0207676_10004587 3300026095 Bacteria 9787
332 Ga0207676_10013079 3300026095 Bacteria 5957
333 Ga0207676_10038711 3300026095 Bacteria 3642
334 Ga0207674_10061347 3300026116 Bacteria 3799
335 Ga0207675_100000130 3300026118 Bacteria 63098
336 Ga0207675_100010328 3300026118 Bacteria 8750
337 Ga0207675_100023600 3300026118 Bacteria 5723
338 Ga0207675_100026519 3300026118 Bacteria 5394
339 Ga0207675_100039298 3300026118 Bacteria 4416
340 Ga0207675_100114026 3300026118 Bacteria 2552
341 Ga0207675_100310700 3300026118 Bacteria 1537
342 Ga0207675_100390053 3300026118 Bacteria 1371
343 Ga0207675_100563324 3300026118 Bacteria 1140
344 Ga0207683_10052091 3300026121 Bacteria 3586
345 Ga0209179_1001849 3300027512 Bacteria 2717
346 Ga0209983_1009942 3300027665 Bacteria 1944
347 Ga0209971_1003982 3300027682 Bacteria 3494
348 Ga0209998_10000403 3300027717 Bacteria 12312
349 Ga0207428_10015902 3300027907 Bacteria 6491
350 Ga0207428_10068513 3300027907 Bacteria 2791
351 Ga0207428_10145422 3300027907 Bacteria 1807
352 Ga0265354_1000572 3300028016 Bacteria 6269
353 Ga0265355_1006965 3300028036 Bacteria 891
354 Ga0268266_10005164 3300028379 Bacteria 12303
355 Ga0268266_10050681 3300028379 Bacteria 3562
356 Ga0268266_10066917 3300028379 Bacteria 3108
357 Ga0268266_10553333 3300028379 Bacteria 1103
358 Ga0268265_10000229 3300028380 Bacteria 64020
359 Ga0268265_10002881 3300028380 Bacteria 12635
360 Ga0268265_10028437 3300028380 Bacteria 4002
361 Ga0268264_10098251 3300028381 Bacteria 2539
362 Ga0268264_10115597 3300028381 Bacteria 2357
363 Ga0265326_10012593 3300028558 Bacteria 2484
364 Ga0265319_1020919 3300028563 Bacteria 2413
365 Ga0265334_10000092 3300028573 Bacteria 64246
366 Ga0265334_10015782 3300028573 Bacteria 3134
367 Ga0265334_10016134 3300028573 Bacteria 3090
368 Ga0265318_10084899 3300028577 Bacteria 1167
369 Ga0307515_10131960 3300028794 Bacteria 2744
370 Ga0265338_10008550 3300028800 Bacteria 12393
371 Ga0265338_10015759 3300028800 Bacteria 8278
372 Ga0265338_10045487 3300028800 Bacteria 4035
373 Ga0265770_1000679 3300030878 Bacteria 4744
374 Ga0265760_10004101 3300031090 Bacteria 4196
375 Ga0265330_10047808 3300031235 Bacteria 1882
376 Ga0265332_10003170 3300031238 Bacteria 8005
377 Ga0265328_10018951 3300031239 Bacteria 2647
378 Ga0265320_10021292 3300031240 Bacteria 3492
379 Ga0265320_10185802 3300031240 Bacteria 931
380 Ga0265325_10026302 3300031241 Bacteria 3152
381 Ga0265340_10007598 3300031247 Bacteria 5882
382 Ga0265340_10056382 3300031247 Bacteria 1890
383 Ga0265340_10058181 3300031247 Bacteria 1856
384 Ga0265339_10011854 3300031249 Bacteria 5348
385 Ga0265339_10072542 3300031249 Bacteria 1832
386 Ga0265331_10003689 3300031250 Bacteria 9747
387 Ga0307513_10464445 3300031456 Bacteria 988
388 Ga0265313_10000109 3300031595 Bacteria 83136
389 Ga0265313_10011088 3300031595 Bacteria 5622
390 Ga0265313_10144393 3300031595 Bacteria 1021
391 Ga0307508_10320885 3300031616 Bacteria 1141
392 Ga0316575_10035455 3300031665 Bacteria 1962
393 Ga0316575_10052829 3300031665 Bacteria 1618
394 Ga0316575_10054900 3300031665 Bacteria 1586
395 Ga0316579_10138386 3300031691 Bacteria 1174
396 Ga0265314_10014543 3300031711 Bacteria 6290
397 Ga0265342_10014672 3300031712 Bacteria 5192
398 Ga0316576_10005175 3300031727 Bacteria 7925
399 Ga0316576_10059980 3300031727 Bacteria 2786
400 Ga0316576_10064162 3300031727 Bacteria 2697
401 Ga0316578_10003227 3300031728 Bacteria 7400
402 Ga0316578_10014130 3300031728 Bacteria 4255
403 Ga0307516_10000209 3300031730 Bacteria 75193
404 Ga0307516_10283452 3300031730 Bacteria 1338
405 Ga0307405_10020726 3300031731 Bacteria 3679
406 Ga0307405_10121336 3300031731 Bacteria 1789
407 Ga0307405_10346776 3300031731 Bacteria 1144
408 Ga0316577_10053267 3300031733 Bacteria 2258
409 Ga0316577_10057610 3300031733 Bacteria 2169
410 Ga0307413_10014541 3300031824 Bacteria 4002
411 Ga0307413_10045868 3300031824 Bacteria 2595
412 Ga0307413_10109949 3300031824 Bacteria 1843
413 Ga0307413_10171043 3300031824 Bacteria 1538
414 Ga0307410_10011726 3300031852 Bacteria 5029
415 Ga0307410_10095215 3300031852 Bacteria 2123
416 Ga0307410_10300063 3300031852 Bacteria 1267
417 Ga0307410_10368400 3300031852 Bacteria 1153
418 Ga0307406_10099368 3300031901 Bacteria 1978
419 Ga0307406_10265474 3300031901 Bacteria 1301
420 Ga0307406_10297744 3300031901 Bacteria 1238
421 Ga0307406_10381964 3300031901 Bacteria 1111
422 Ga0307406_10590603 3300031901 Bacteria 914
423 Ga0307407_10032156 3300031903 Bacteria 2849
424 Ga0307407_10084000 3300031903 Bacteria 1933
425 Ga0307407_10348559 3300031903 Bacteria 1048
426 Ga0307412_10080429 3300031911 Bacteria 2251
427 Ga0307409_100027912 3300031995 Bacteria 4010
428 Ga0307409_100049418 3300031995 Bacteria 3207
429 Ga0307409_100214998 3300031995 Bacteria 1731
430 Ga0307409_100250881 3300031995 Bacteria 1618
431 Ga0307416_100243907 3300032002 Bacteria 1743
432 Ga0307416_100743499 3300032002 Bacteria 1073
433 Ga0307414_10023992 3300032004 Bacteria 3880
434 Ga0307411_10000427 3300032005 Bacteria 14309
435 Ga0307411_10001335 3300032005 Bacteria 9939
436 Ga0307411_10077324 3300032005 Bacteria 2278
437 Ga0307415_100021999 3300032126 Bacteria 3929
438 Ga0316580_10015332 3300032139 Bacteria 2344
439 Ga0316593_10008462 3300032168 Bacteria 2871
440 Ga0373948_0037180 3300034817 Bacteria 1006
441 Ga0373929_0024713 3300035085 Bacteria 1243
442 Ga0373936_0071829 3300035113 Bacteria 1428
443 Ga0373954_0023716 3300035118 Bacteria 2793
444 Ga0373946_0082746 3300035171 Bacteria 1408
445 Ga0373955_0032272 3300035172 Bacteria 2748
446 Ga0373955_0125835 3300035172 Bacteria 1493
447 Ga0373962_0101982 3300035242 Bacteria 896
448 Ga0316574_0000055 3300035398 Bacteria 29301
449 Ga0316574_0038361 3300035398 Bacteria 2940
450 Ga0316574_0140099 3300035398 Bacteria 1558
451 Ga0316574_0159266 3300035398 Bacteria 1454
452 Ga0316574_0309412 3300035398 Bacteria 1004
453 Ga0373935_0215091 3300035692 Bacteria 1333
454 Ga0373927_0000003 3300035695 Bacteria 480348
455 Ga0373933_0109635 3300035724 Bacteria 1721
456 Ga0373933_0123745 3300035724 Bacteria 1621
457 Ga0373937_0026263 3300036401 Bacteria 5262
458 Ga0373937_0065893 3300036401 Bacteria 3335
459 Ga0316582_0043131 3300036647 Bacteria 2829
460 Ga0316582_0248873 3300036647 Bacteria 1218
461 Ga0316584_0001792 3300036712 Bacteria 13245
462 Ga0316584_0020680 3300036712 Bacteria 4775
463 Ga0316584_0031574 3300036712 Bacteria 3916
464 Ga0316584_0109519 3300036712 Bacteria 2067
465 Ga0400490_56804 3300038726 Bacteria 19256
466 Ga0400491_15621 3300038727 Bacteria 2809
467 Ga0400486_24254 3300038742 Bacteria 1761
468 Ga0400483_073268 3300039062 Bacteria 11164
469 Ga0400483_223374 3300039062 Bacteria 5286
470 Ga0400489_95956 3300039093 Bacteria 1352
471 Ga0451797_1154171 3300041453 Bacteria 1100
472 Ga0451841_0568682 3300041498 Bacteria 3503
473 Ga0451849_1496435 3300041505 Bacteria 771
474 Ga0451853_1522387 3300041512 Bacteria 2064
475 Ga0439433_0030933 3300041999 Bacteria 1224
476 Ga0439443_000230 3300042003 Bacteria 4312
477 Ga0450923_003145 3300042125 Bacteria 2456
478 Ga0450896_000315 3300042133 Bacteria 4592
479 Ga0450896_009501 3300042133 Bacteria 1354
480 Ga0439446_0002211 3300042156 Bacteria 4641
481 Ga0439446_0007461 3300042156 Bacteria 2876
482 Ga0450908_002638 3300042184 Bacteria 3517
483 Ga0439434_0037539 3300042435 Bacteria 1483
484 Ga0439435_0007606 3300042436 Bacteria 2486
485 Ga0450918_003576 3300042531 Bacteria 2883
486 Ga0450918_031512 3300042531 Bacteria 937
487 Ga0451577_0131818 3300042876 Bacteria 2242
488 Ga0453684_0115260 3300044712 Bacteria 3256
489 Ga0466957_0330333 3300044842 Bacteria 1030
490 Ga0451576_0046301 3300045051 Bacteria 4580
491 Ga0451576_0047403 3300045051 Bacteria 4518
492 Ga0451576_0071884 3300045051 Bacteria 3600
493 Ga0451576_0390807 3300045051 Bacteria 1458
494 Ga0495638_0003871 3300046460 Bacteria 11606
495 Ga0495638_0010678 3300046460 Bacteria 6359
496 Ga0495638_0078316 3300046460 Bacteria 2011
497 Ga0495650_0013982 3300046471 Bacteria 4210
498 Ga0495630_0083281 3300046517 Bacteria 2415
499 Ga0495644_0023198 3300046523 Bacteria 2362
500 Ga0495645_0164257 3300046543 Bacteria 1533
501 Ga0495633_0015655 3300046558 Bacteria 3932
502 Ga0495656_0040102 3300046615 Bacteria 1950
503 Ga0495656_0081373 3300046615 Bacteria 1462
504 Ga0495634_0382260 3300046642 Bacteria 839
505 Ga0495611_0097475 3300046648 Bacteria 1363
506 Ga0495625_0003242 3300046660 Bacteria 16463
507 Ga0495625_0347281 3300046660 Bacteria 939
508 Ga0495659_0104326 3300046664 Bacteria 1101
509 Ga0495647_0001520 3300046681 Bacteria 7162
510 Ga0495647_0044078 3300046681 Bacteria 1710
511 Ga0495649_0006638 3300046694 Bacteria 7190
512 Ga0495672_0027190 3300047320 Bacteria 3638
513 Ga0495680_0104882 3300047322 Bacteria 2102
514 Ga0495686_0141037 3300047472 Bacteria 1422
515 Ga0495615_0030875 3300048090 Bacteria 1282
516 Ga0496100_0076223 3300048903 Bacteria 2251
517 Ga0496104_0044072 3300048907 Bacteria 4192
518 Ga0496104_0395272 3300048907 Bacteria 1295
519 Ga0496105_0000714 3300048908 Bacteria 22482
520 Ga0496105_0360477 3300048908 Bacteria 1160
521 Ga0496108_0058195 3300048911 Bacteria 3248
522 Ga0496109_0052934 3300048912 Bacteria 3701
523 Ga0496109_0346883 3300048912 Bacteria 1402
524 Ga0496110_0079484 3300048913 Bacteria 2920
525 Ga0496112_0132206 3300048915 Bacteria 2466
526 Ga0496113_0039378 3300048916 Bacteria 3479
527 Ga0496114_0017738 3300048917 Bacteria 5752
528 Ga0496114_0186884 3300048917 Bacteria 1811
529 Ga0496115_0011549 3300048918 Bacteria 6620
530 Ga0496121_0010107 3300048924 Bacteria 10702
531 Ga0501036_0033090 3300049572 Bacteria 4372
532 Ga0501036_0305315 3300049572 Bacteria 1331
533 Ga0501037_0057197 3300049573 Bacteria 2848
534 Ga0501037_0402148 3300049573 Bacteria 939
535 Ga0501038_0067011 3300049574 Bacteria 3055
536 Ga0501038_0289698 3300049574 Bacteria 1287
537 Ga0501039_0007266 3300049575 Bacteria 8438
538 Ga0501039_0029119 3300049575 Bacteria 4253
539 Ga0501039_0041474 3300049575 Bacteria 3555
540 Ga0501040_0008032 3300049576 Bacteria 6854
541 Ga0501040_0013250 3300049576 Bacteria 5422
542 Ga0501041_0053200 3300049577 Bacteria 2469
543 Ga0501041_0096510 3300049577 Bacteria 1827
544 Ga0501041_0148002 3300049577 Bacteria 1465
545 Ga0501042_0060549 3300049578 Bacteria 2704
546 Ga0501042_0073896 3300049578 Bacteria 2439
547 Ga0501042_0126208 3300049578 Bacteria 1843
548 Ga0501042_0126968 3300049578 Bacteria 1837
549 Ga0501042_0206754 3300049578 Bacteria 1415
550 Ga0501046_0348008 3300049580 Bacteria 1076
551 Ga0501046_0594327 3300049580 Bacteria 786
552 Ga0501047_0162605 3300049581 Bacteria 2104
553 Ga0501048_0001704 3300049582 Bacteria 16763
554 Ga0501048_0117355 3300049582 Bacteria 1880
555 Ga0501048_0122853 3300049582 Bacteria 1835
556 Ga0501067_0003850 3300049583 Bacteria 8287
557 Ga0501068_0008035 3300049584 Bacteria 5850
558 Ga0501071_0030458 3300049587 Bacteria 3817
559 Ga0501071_0050826 3300049587 Bacteria 2986
560 Ga0501071_0066577 3300049587 Bacteria 2618
561 Ga0501072_0000598 3300049588 Bacteria 26005
562 Ga0501072_0007104 3300049588 Bacteria 8497
563 Ga0501072_0103081 3300049588 Bacteria 2268
564 Ga0501072_0165707 3300049588 Bacteria 1763
565 Ga0501072_0472696 3300049588 Bacteria 992
566 Ga0501073_0000567 3300049589 Bacteria 26062
567 Ga0501073_0116930 3300049589 Bacteria 1848
568 Ga0501073_0243290 3300049589 Bacteria 1242
569 Ga0501075_0000499 3300049591 Bacteria 23531
570 Ga0501075_0006057 3300049591 Bacteria 8296
571 Ga0501075_0031316 3300049591 Bacteria 3947
572 Ga0501075_0042693 3300049591 Bacteria 3400
573 Ga0501075_0047461 3300049591 Bacteria 3227
574 Ga0501075_0266732 3300049591 Bacteria 1305
575 Ga0501076_0014690 3300049592 Bacteria 5903
576 Ga0501076_0262353 3300049592 Bacteria 1414
577 Ga0501076_0329513 3300049592 Bacteria 1252
578 Ga0501076_0472553 3300049592 Bacteria 1033
579 Ga0501077_0007565 3300049593 Bacteria 6703
580 Ga0501077_0017655 3300049593 Bacteria 4506
581 Ga0501077_0296747 3300049593 Bacteria 1029
582 Ga0501079_0000225 3300049741 Bacteria 33701
583 Ga0501079_0025899 3300049741 Bacteria 4499
584 Ga0501079_0062714 3300049741 Bacteria 2867
585 Ga0501079_0129787 3300049741 Bacteria 1961
586 Ga0501079_0158952 3300049741 Bacteria 1761
587 Ga0501079_0583072 3300049741 Bacteria 880
588 Ga0501080_0004604 3300049742 Bacteria 12291
589 Ga0501080_0035821 3300049742 Bacteria 4632
590 Ga0501080_0058724 3300049742 Bacteria 3581
591 Ga0501080_0127488 3300049742 Bacteria 2356
592 Ga0501081_0001700 3300049743 Bacteria 13649
593 Ga0501081_0027392 3300049743 Bacteria 3845
594 Ga0501081_0029850 3300049743 Bacteria 3686
595 Ga0501081_0069355 3300049743 Bacteria 2456
596 Ga0501083_0200083 3300049744 Bacteria 1303
597 Ga0501083_0267217 3300049744 Bacteria 1113
598 Ga0501035_0029886 3300049822 Bacteria 4969
599 Ga0501035_0244502 3300049822 Bacteria 1525
600 Ga0501045_0024714 3300049824 Bacteria 4314
601 Ga0501045_0028931 3300049824 Bacteria 4000
602 Ga0501045_0036634 3300049824 Bacteria 3563
603 nmdc:mga05p37_8696_c1 3300050507 Bacteria 11997
604 nmdc:mga0qj67_8382_c1 3300050509 Bacteria 7664
605 nmdc:mga0qj67_96736_c1 3300050509 Bacteria 2377
606 nmdc:mga06r32_14131_c1 3300050510 Bacteria 7241
607 nmdc:mga06r32_31753_c1 3300050510 Bacteria 4963
608 nmdc:mga08y16_16105_c1 3300050511 Bacteria 7863
609 nmdc:mga08y16_377577_c1 3300050511 Bacteria 1453
610 nmdc:mga0n895_450208_c1 3300050512 Bacteria 1300
611 nmdc:mga0n895_60682_c1 3300050512 Bacteria 3732
612 nmdc:mga0rr50_85913_c1 3300050513 Bacteria 2439
613 nmdc:mga0a205_9400_c1 3300050515 Bacteria 8935
614 Ga0495601_0053948 3300053077 Bacteria 2542
615 Ga0500652_008335 3300053131 Bacteria 3449
616 Ga0500658_0034955 3300053134 Bacteria 1987
617 Ga0500616_0034541 3300053153 Bacteria 2754
618 Ga0500616_0139332 3300053153 Bacteria 1136
619 Ga0500637_0000552 3300053178 Bacteria 14665
620 Ga0501084_0001080 3300054114 Bacteria 21231
621 Ga0501084_0244853 3300054114 Bacteria 1513
622 Ga0501082_0001398 3300060353 Bacteria 21254
623 Ga0501082_0009770 3300060353 Bacteria 8264
624 Ga0501082_0035083 3300060353 Bacteria 4323
625 Ga0501082_0099965 3300060353 Bacteria 2508
626 Ga0501082_0142641 3300060353 Bacteria 2079
627 Ga0530510_0007188 3300061734 Bacteria 7748
628 Ga0530510_0027223 3300061734 Bacteria 4097
629 Ga0530510_0061263 3300061734 Bacteria 2724
630 Ga0530510_0186046 3300061734 Bacteria 1541
631 Ga0530510_0258970 3300061734 Bacteria 1297

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100076899 Ga0070682_1000768993 225
2 3300005354 Ga0070675_100008341 Ga0070675_1000083415 225
3 3300009094 Ga0111539_10546423 Ga0111539_105464232 225
4 3300031903 Ga0307407_10348559 Ga0307407_103485592 225
5 3300046615 Ga0495656_0040102 Ga0495656_0040102_97_798 225
6 3300048090 Ga0495615_0030875 Ga0495615_0030875_347_1048 225
7 3300005355 Ga0070671_100665646 Ga0070671_1006656461 227
8 3300005456 Ga0070678_100491796 Ga0070678_1004917962 227
9 3300005548 Ga0070665_100006360 Ga0070665_10000636010 227
10 3300025942 Ga0207689_10101721 Ga0207689_101017212 227
11 3300028379 Ga0268266_10005164 Ga0268266_100051643 227
12 3300031731 Ga0307405_10121336 Ga0307405_101213362 227
13 3300031824 Ga0307413_10014541 Ga0307413_100145412 227
14 3300031901 Ga0307406_10381964 Ga0307406_103819642 227
15 3300031995 Ga0307409_100049418 Ga0307409_1000494184 227
16 3300032005 Ga0307411_10001335 Ga0307411_100013355 227
17 3300005459 Ga0068867_100020743 Ga0068867_1000207433 229
18 3300005563 Ga0068855_100016755 Ga0068855_1000167557 229
19 3300005564 Ga0070664_100180879 Ga0070664_1001808792 229
20 3300005840 Ga0068870_10082443 Ga0068870_100824432 229
21 3300005844 Ga0068862_100008962 Ga0068862_1000089625 229
22 3300006846 Ga0075430_100266004 Ga0075430_1002660042 229
23 3300006847 Ga0075431_100000318 Ga0075431_1000003185 229
24 3300009093 Ga0105240_10010627 Ga0105240_100106277 229
25 3300009094 Ga0111539_10023643 Ga0111539_100236434 229
26 3300009094 Ga0111539_10640436 Ga0111539_106404363 229
27 3300009147 Ga0114129_10047662 Ga0114129_100476625 229
28 3300009147 Ga0114129_10727062 Ga0114129_107270622 229
29 3300009551 Ga0105238_10109519 Ga0105238_101095193 229
30 3300009553 Ga0105249_10155934 Ga0105249_101559342 229
31 3300013104 Ga0157370_10234748 Ga0157370_102347482 229
32 3300013105 Ga0157369_10047434 Ga0157369_100474344 229
33 3300013307 Ga0157372_10151956 Ga0157372_101519563 229
34 3300014326 Ga0157380_10023810 Ga0157380_100238102 229
35 3300014326 Ga0157380_10094297 Ga0157380_100942973 229
36 3300025908 Ga0207643_10088849 Ga0207643_100888492 229
37 3300025912 Ga0207707_10004072 Ga0207707_100040724 229
38 3300025912 Ga0207707_10008989 Ga0207707_100089892 229
39 3300025913 Ga0207695_10009041 Ga0207695_1000904112 229
40 3300025917 Ga0207660_10013421 Ga0207660_100134213 229
41 3300025917 Ga0207660_10127806 Ga0207660_101278062 229
42 3300025917 Ga0207660_10595125 Ga0207660_105951251 229
43 3300025921 Ga0207652_10001982 Ga0207652_100019824 229
44 3300025921 Ga0207652_10065733 Ga0207652_100657333 229
45 3300025945 Ga0207679_10133114 Ga0207679_101331142 229
46 3300025949 Ga0207667_10000859 Ga0207667_1000085918 229
47 3300025949 Ga0207667_10030874 Ga0207667_100308745 229
48 3300026075 Ga0207708_10009104 Ga0207708_100091046 229
49 3300030878 Ga0265770_1000679 Ga0265770_10006795 229
50 3300031691 Ga0316579_10138386 Ga0316579_101383862 229
51 3300031995 Ga0307409_100214998 Ga0307409_1002149983 229
52 3300032168 Ga0316593_10008462 Ga0316593_100084623 229
53 3300035398 Ga0316574_0140099 Ga0316574_0140099_379_1074 229
54 3300035724 Ga0373933_0109635 Ga0373933_0109635_104_796 229
55 3300036712 Ga0316584_0020680 Ga0316584_0020680_1693_2388 229
56 3300038726 Ga0400490_56804 Ga0400490_56804_8664_9371 229
57 3300038727 Ga0400491_15621 Ga0400491_15621_1429_2136 229
58 3300038742 Ga0400486_24254 Ga0400486_24254_530_1237 229
59 3300039093 Ga0400489_95956 Ga0400489_95956_574_1281 229
60 3300046642 Ga0495634_0382260 Ga0495634_0382260_89_793 229
61 3300046681 Ga0495647_0044078 Ga0495647_0044078_29_727 229
62 3300010159 Ga0099796_10000041 Ga0099796_100000415 232
63 3300045051 Ga0451576_0046301 Ga0451576_0046301_331_1032 233
64 3300049572 Ga0501036_0033090 Ga0501036_0033090_525_1226 233
65 3300049572 Ga0501036_0305315 Ga0501036_0305315_466_1167 233
66 3300049575 Ga0501039_0029119 Ga0501039_0029119_1940_2641 233
67 3300049576 Ga0501040_0008032 Ga0501040_0008032_3632_4333 233
68 3300049577 Ga0501041_0096510 Ga0501041_0096510_614_1315 233
69 3300049582 Ga0501048_0117355 Ga0501048_0117355_185_886 233
70 3300049587 Ga0501071_0050826 Ga0501071_0050826_898_1599 233
71 3300049587 Ga0501071_0066577 Ga0501071_0066577_611_1312 233
72 3300049588 Ga0501072_0007104 Ga0501072_0007104_6496_7197 233
73 3300049588 Ga0501072_0103081 Ga0501072_0103081_1392_2093 233
74 3300049588 Ga0501072_0165707 Ga0501072_0165707_1026_1727 233
75 3300049589 Ga0501073_0243290 Ga0501073_0243290_514_1215 233
76 3300049591 Ga0501075_0042693 Ga0501075_0042693_172_873 233
77 3300049591 Ga0501075_0047461 Ga0501075_0047461_979_1680 233
78 3300049592 Ga0501076_0262353 Ga0501076_0262353_602_1303 233
79 3300049592 Ga0501076_0472553 Ga0501076_0472553_287_988 233
80 3300049593 Ga0501077_0296747 Ga0501077_0296747_182_883 233
81 3300049741 Ga0501079_0062714 Ga0501079_0062714_318_1019 233
82 3300049741 Ga0501079_0158952 Ga0501079_0158952_410_1111 233
83 3300049742 Ga0501080_0127488 Ga0501080_0127488_321_1022 233
84 3300049743 Ga0501081_0069355 Ga0501081_0069355_1406_2107 233
85 3300049822 Ga0501035_0244502 Ga0501035_0244502_228_929 233
86 3300053178 Ga0500637_0000552 Ga0500637_0000552_376_1077 233
87 3300054114 Ga0501084_0244853 Ga0501084_0244853_651_1352 233
88 3300060353 Ga0501082_0099965 Ga0501082_0099965_642_1343 233
89 3300061734 Ga0530510_0061263 Ga0530510_0061263_633_1334 233
90 3300061734 Ga0530510_0186046 Ga0530510_0186046_83_784 233
91 3300005328 Ga0070676_10212112 Ga0070676_102121122 234
92 3300005364 Ga0070673_100009396 Ga0070673_1000093965 234
93 3300031456 Ga0307513_10464445 Ga0307513_104644451 234
94 3300031824 Ga0307413_10171043 Ga0307413_101710432 234
95 3300031852 Ga0307410_10368400 Ga0307410_103684002 234
96 3300005331 Ga0070670_100258838 Ga0070670_1002588382 236
97 3300005340 Ga0070689_100312810 Ga0070689_1003128102 236
98 3300005365 Ga0070688_100219988 Ga0070688_1002199882 236
99 3300005544 Ga0070686_100042530 Ga0070686_1000425302 236
100 3300005842 Ga0068858_100752229 Ga0068858_1007522292 236
101 3300025933 Ga0207706_10174679 Ga0207706_101746792 236
102 3300026035 Ga0207703_10157555 Ga0207703_101575552 236
103 3300005295 Ga0065707_10085402 Ga0065707_100854024 237
104 3300005367 Ga0070667_100548850 Ga0070667_1005488502 237
105 3300009093 Ga0105240_10054925 Ga0105240_100549253 237
106 3300025949 Ga0207667_10008918 Ga0207667_100089185 237
107 3300036647 Ga0316582_0248873 Ga0316582_0248873_315_1100 237
108 3300041453 Ga0451797_1154171 Ga0451797_1154171_131_847 237
109 3300047320 Ga0495672_0027190 Ga0495672_0027190_476_1189 237
110 3300048924 Ga0496121_0010107 Ga0496121_0010107_6756_7472 237
111 3300049580 Ga0501046_0348008 Ga0501046_0348008_12_725 237
112 3300049580 Ga0501046_0594327 Ga0501046_0594327_18_731 237
113 3300049581 Ga0501047_0162605 Ga0501047_0162605_229_942 237
114 3300050509 nmdc:mga0qj67_96736_c1 nmdc:mga0qj67_96736_c1_1387_2103 237
115 3300005328 Ga0070676_10001863 Ga0070676_100018635 238
116 3300005435 Ga0070714_100110702 Ga0070714_1001107022 238
117 3300005548 Ga0070665_100211971 Ga0070665_1002119713 238
118 3300005548 Ga0070665_100499298 Ga0070665_1004992982 238
119 3300005719 Ga0068861_100017281 Ga0068861_1000172815 238
120 3300009094 Ga0111539_10374914 Ga0111539_103749142 238
121 3300009177 Ga0105248_10334862 Ga0105248_103348622 238
122 3300014326 Ga0157380_10007906 Ga0157380_100079063 238
123 3300014326 Ga0157380_10291200 Ga0157380_102912002 238
124 3300025929 Ga0207664_10032053 Ga0207664_100320533 238
125 3300025942 Ga0207689_10302840 Ga0207689_103028402 238
126 3300025981 Ga0207640_10249731 Ga0207640_102497312 238
127 3300026089 Ga0207648_10164457 Ga0207648_101644572 238
128 3300026089 Ga0207648_10561261 Ga0207648_105612612 238
129 3300026118 Ga0207675_100023600 Ga0207675_1000236004 238
130 3300028379 Ga0268266_10050681 Ga0268266_100506814 238
131 3300028573 Ga0265334_10015782 Ga0265334_100157822 238
132 3300028794 Ga0307515_10131960 Ga0307515_101319601 238
133 3300028800 Ga0265338_10008550 Ga0265338_100085505 238
134 3300031235 Ga0265330_10047808 Ga0265330_100478082 238
135 3300031595 Ga0265313_10011088 Ga0265313_100110883 238
136 3300031852 Ga0307410_10011726 Ga0307410_100117264 238
137 3300031901 Ga0307406_10265474 Ga0307406_102654742 238
138 3300031903 Ga0307407_10032156 Ga0307407_100321564 238
139 3300031995 Ga0307409_100027912 Ga0307409_1000279124 238
140 3300032005 Ga0307411_10000427 Ga0307411_100004273 238
141 3300041505 Ga0451849_1496435 Ga0451849_1496435_23_745 238
142 3300042156 Ga0439446_0002211 Ga0439446_0002211_2724_3443 238
143 3300042435 Ga0439434_0037539 Ga0439434_0037539_357_1076 238
144 3300042531 Ga0450918_031512 Ga0450918_031512_76_795 238
145 3300050511 nmdc:mga08y16_377577_c1 nmdc:mga08y16_377577_c1_146_889 238
146 3300053153 Ga0500616_0034541 Ga0500616_0034541_1336_2055 238
147 3300005436 Ga0070713_100210102 Ga0070713_1002101022 239
148 3300005439 Ga0070711_100004271 Ga0070711_1000042717 239
149 3300005458 Ga0070681_10003522 Ga0070681_1000352213 239
150 3300005458 Ga0070681_10043647 Ga0070681_100436473 239
151 3300005546 Ga0070696_100000163 Ga0070696_1000001632 239
152 3300007788 Ga0099795_10000075 Ga0099795_1000007512 239
153 3300009148 Ga0105243_10556013 Ga0105243_105560131 239
154 3300010159 Ga0099796_10024361 Ga0099796_100243613 239
155 3300025912 Ga0207707_10006250 Ga0207707_100062508 239
156 3300025912 Ga0207707_10049560 Ga0207707_100495603 239
157 3300025913 Ga0207695_10055015 Ga0207695_100550155 239
158 3300025916 Ga0207663_10131190 Ga0207663_101311902 239
159 3300025921 Ga0207652_10221539 Ga0207652_102215393 239
160 3300025944 Ga0207661_10588714 Ga0207661_105887142 239
161 3300026118 Ga0207675_100310700 Ga0207675_1003107002 239
162 3300027512 Ga0209179_1001849 Ga0209179_10018494 239
163 3300028016 Ga0265354_1000572 Ga0265354_10005722 239
164 3300028036 Ga0265355_1006965 Ga0265355_10069651 239
165 3300031090 Ga0265760_10004101 Ga0265760_100041015 239
166 3300031249 Ga0265339_10072542 Ga0265339_100725422 239
167 3300031595 Ga0265313_10144393 Ga0265313_101443931 239
168 3300035113 Ga0373936_0071829 Ga0373936_0071829_548_1279 239
169 3300035172 Ga0373955_0125835 Ga0373955_0125835_522_1253 239
170 3300035692 Ga0373935_0215091 Ga0373935_0215091_344_1075 239
171 3300048903 Ga0496100_0076223 Ga0496100_0076223_1221_1952 239
172 3300048908 Ga0496105_0000714 Ga0496105_0000714_7961_8692 239
173 3300048917 Ga0496114_0017738 Ga0496114_0017738_2057_2788 239
174 3300048918 Ga0496115_0011549 Ga0496115_0011549_3689_4420 239
175 3300005330 Ga0070690_100027355 Ga0070690_1000273554 240
176 3300005340 Ga0070689_100022584 Ga0070689_1000225842 240
177 3300005341 Ga0070691_10195240 Ga0070691_101952402 240
178 3300005365 Ga0070688_100125584 Ga0070688_1001255842 240
179 3300005438 Ga0070701_10038359 Ga0070701_100383593 240
180 3300005440 Ga0070705_100032948 Ga0070705_1000329482 240
181 3300005444 Ga0070694_100068407 Ga0070694_1000684072 240
182 3300005539 Ga0068853_100390032 Ga0068853_1003900322 240
183 3300005544 Ga0070686_100015999 Ga0070686_1000159992 240
184 3300005546 Ga0070696_100198437 Ga0070696_1001984372 240
185 3300005549 Ga0070704_100096067 Ga0070704_1000960672 240
186 3300005615 Ga0070702_100011363 Ga0070702_1000113633 240
187 3300005617 Ga0068859_100281646 Ga0068859_1002816462 240
188 3300005719 Ga0068861_100033104 Ga0068861_1000331042 240
189 3300005841 Ga0068863_100433948 Ga0068863_1004339482 240
190 3300005843 Ga0068860_100142094 Ga0068860_1001420943 240
191 3300006237 Ga0097621_100350440 Ga0097621_1003504402 240
192 3300006358 Ga0068871_100008181 Ga0068871_1000081817 240
193 3300006931 Ga0097620_100281650 Ga0097620_1002816502 240
194 3300014968 Ga0157379_10833643 Ga0157379_108336431 240
195 3300014969 Ga0157376_10283152 Ga0157376_102831522 240
196 3300017792 Ga0163161_10385288 Ga0163161_103852882 240
197 3300026041 Ga0207639_10483660 Ga0207639_104836602 240
198 3300026088 Ga0207641_10408195 Ga0207641_104081952 240
199 3300026118 Ga0207675_100039298 Ga0207675_1000392984 240
200 3300028381 Ga0268264_10115597 Ga0268264_101155972 240
201 3300028800 Ga0265338_10045487 Ga0265338_100454875 240
202 3300031240 Ga0265320_10185802 Ga0265320_101858022 240
203 3300031247 Ga0265340_10007598 Ga0265340_100075982 240
204 3300031247 Ga0265340_10058181 Ga0265340_100581812 240
205 3300048907 Ga0496104_0395272 Ga0496104_0395272_388_1134 240
206 3300049573 Ga0501037_0402148 Ga0501037_0402148_164_913 240
207 3300005719 Ga0068861_100005236 Ga0068861_1000052363 241
208 3300006846 Ga0075430_100058924 Ga0075430_1000589242 241
209 3300026118 Ga0207675_100010328 Ga0207675_1000103287 241
210 3300031616 Ga0307508_10320885 Ga0307508_103208851 241
211 3300031730 Ga0307516_10000209 Ga0307516_1000020942 241
212 3300035171 Ga0373946_0082746 Ga0373946_0082746_280_1017 241
213 3300036712 Ga0316584_0109519 Ga0316584_0109519_493_1233 241
214 3300046460 Ga0495638_0010678 Ga0495638_0010678_3499_4227 241
215 3300046523 Ga0495644_0023198 Ga0495644_0023198_1343_2074 241
216 3300046543 Ga0495645_0164257 Ga0495645_0164257_106_837 241
217 3300046558 Ga0495633_0015655 Ga0495633_0015655_2832_3563 241
218 3300046615 Ga0495656_0081373 Ga0495656_0081373_487_1218 241
219 3300046660 Ga0495625_0003242 Ga0495625_0003242_6509_7237 241
220 3300046681 Ga0495647_0001520 Ga0495647_0001520_1706_2437 241
221 3300005353 Ga0070669_100060857 Ga0070669_1000608571 242
222 3300005840 Ga0068870_10026255 Ga0068870_100262552 242
223 3300014326 Ga0157380_10492781 Ga0157380_104927812 242
224 3300025893 Ga0207682_10015058 Ga0207682_100150583 242
225 3300025906 Ga0207699_10137464 Ga0207699_101374642 242
226 3300025908 Ga0207643_10032712 Ga0207643_100327122 242
227 3300025923 Ga0207681_10533130 Ga0207681_105331302 242
228 3300025926 Ga0207659_10111164 Ga0207659_101111643 242
229 3300025937 Ga0207669_10020431 Ga0207669_100204313 242
230 3300025940 Ga0207691_10098260 Ga0207691_100982603 242
231 3300025960 Ga0207651_10042234 Ga0207651_100422344 242
232 3300025986 Ga0207658_10080979 Ga0207658_100809792 242
233 3300026075 Ga0207708_10017361 Ga0207708_100173615 242
234 3300026095 Ga0207676_10038711 Ga0207676_100387114 242
235 3300026118 Ga0207675_100390053 Ga0207675_1003900532 242
236 3300031665 Ga0316575_10035455 Ga0316575_100354552 242
237 3300035118 Ga0373954_0023716 Ga0373954_0023716_582_1325 242
238 3300035398 Ga0316574_0309412 Ga0316574_0309412_151_900 242
239 3300035724 Ga0373933_0123745 Ga0373933_0123745_782_1525 242
240 3300046460 Ga0495638_0003871 Ga0495638_0003871_8021_8788 242
241 3300046517 Ga0495630_0083281 Ga0495630_0083281_385_1140 242
242 3300046694 Ga0495649_0006638 Ga0495649_0006638_3150_3917 242
243 3300005353 Ga0070669_100010367 Ga0070669_1000103675 243
244 3300005356 Ga0070674_100000687 Ga0070674_10000068712 243
245 3300005439 Ga0070711_100121670 Ga0070711_1001216702 243
246 3300005457 Ga0070662_100002548 Ga0070662_1000025482 243
247 3300005543 Ga0070672_100001677 Ga0070672_1000016774 243
248 3300005545 Ga0070695_100218703 Ga0070695_1002187032 243
249 3300005718 Ga0068866_10034628 Ga0068866_100346284 243
250 3300005719 Ga0068861_100003473 Ga0068861_1000034739 243
251 3300006175 Ga0070712_100321671 Ga0070712_1003216712 243
252 3300006846 Ga0075430_100543041 Ga0075430_1005430411 243
253 3300006847 Ga0075431_100138436 Ga0075431_1001384362 243
254 3300006881 Ga0068865_100005610 Ga0068865_1000056102 243
255 3300025898 Ga0207692_10290823 Ga0207692_102908232 243
256 3300025899 Ga0207642_10027689 Ga0207642_100276892 243
257 3300025907 Ga0207645_10000328 Ga0207645_1000032814 243
258 3300025916 Ga0207663_10048278 Ga0207663_100482783 243
259 3300025923 Ga0207681_10011754 Ga0207681_100117543 243
260 3300025933 Ga0207706_10000476 Ga0207706_1000047630 243
261 3300025937 Ga0207669_10062244 Ga0207669_100622443 243
262 3300025938 Ga0207704_10019354 Ga0207704_100193544 243
263 3300025940 Ga0207691_10013230 Ga0207691_100132305 243
264 3300025961 Ga0207712_10135957 Ga0207712_101359572 243
265 3300026089 Ga0207648_10000334 Ga0207648_1000033444 243
266 3300026118 Ga0207675_100000130 Ga0207675_10000013013 243
267 3300027665 Ga0209983_1009942 Ga0209983_10099422 243
268 3300027682 Ga0209971_1003982 Ga0209971_10039824 243
269 3300027717 Ga0209998_10000403 Ga0209998_1000040312 243
270 3300028558 Ga0265326_10012593 Ga0265326_100125932 243
271 3300028563 Ga0265319_1020919 Ga0265319_10209193 243
272 3300028573 Ga0265334_10000092 Ga0265334_1000009219 243
273 3300028573 Ga0265334_10016134 Ga0265334_100161344 243
274 3300028577 Ga0265318_10084899 Ga0265318_100848992 243
275 3300028800 Ga0265338_10015759 Ga0265338_100157593 243
276 3300031238 Ga0265332_10003170 Ga0265332_100031702 243
277 3300031239 Ga0265328_10018951 Ga0265328_100189512 243
278 3300031240 Ga0265320_10021292 Ga0265320_100212924 243
279 3300031241 Ga0265325_10026302 Ga0265325_100263024 243
280 3300031247 Ga0265340_10056382 Ga0265340_100563822 243
281 3300031249 Ga0265339_10011854 Ga0265339_100118542 243
282 3300031250 Ga0265331_10003689 Ga0265331_100036892 243
283 3300031595 Ga0265313_10000109 Ga0265313_1000010917 243
284 3300031665 Ga0316575_10054900 Ga0316575_100549003 243
285 3300031711 Ga0265314_10014543 Ga0265314_100145433 243
286 3300031712 Ga0265342_10014672 Ga0265342_100146723 243
287 3300035695 Ga0373927_0000003 Ga0373927_0000003_33123_33875 243
288 3300005295 Ga0065707_10083272 Ga0065707_100832727 244
289 3300005344 Ga0070661_100140217 Ga0070661_1001402172 244
290 3300005438 Ga0070701_10056323 Ga0070701_100563232 244
291 3300005441 Ga0070700_100084892 Ga0070700_1000848923 244
292 3300009092 Ga0105250_10000005 Ga0105250_10000005139 244
293 3300014968 Ga0157379_10000311 Ga0157379_1000031134 244
294 3300025711 Ga0207696_1000470 Ga0207696_100047021 244
295 3300025907 Ga0207645_10238821 Ga0207645_102388212 244
296 3300025920 Ga0207649_10106185 Ga0207649_101061852 244
297 3300025925 Ga0207650_10062171 Ga0207650_100621712 244
298 3300031731 Ga0307405_10346776 Ga0307405_103467762 244
299 3300031824 Ga0307413_10045868 Ga0307413_100458682 244
300 3300036401 Ga0373937_0065893 Ga0373937_0065893_2239_2985 244
301 3300041498 Ga0451841_0568682 Ga0451841_0568682_1229_1981 244
302 3300041512 Ga0451853_1522387 Ga0451853_1522387_1021_1773 244
303 3300046660 Ga0495625_0347281 Ga0495625_0347281_21_758 244
304 3300047472 Ga0495686_0141037 Ga0495686_0141037_384_1127 244
305 3300049574 Ga0501038_0067011 Ga0501038_0067011_831_1598 244
306 3300049575 Ga0501039_0007266 Ga0501039_0007266_6478_7245 244
307 3300049576 Ga0501040_0013250 Ga0501040_0013250_1797_2564 244
308 3300049577 Ga0501041_0148002 Ga0501041_0148002_552_1319 244
309 3300049578 Ga0501042_0206754 Ga0501042_0206754_147_914 244
310 3300049582 Ga0501048_0001704 Ga0501048_0001704_7720_8487 244
311 3300049584 Ga0501068_0008035 Ga0501068_0008035_3931_4698 244
312 3300049588 Ga0501072_0000598 Ga0501072_0000598_24057_24824 244
313 3300049591 Ga0501075_0000499 Ga0501075_0000499_21582_22349 244
314 3300049592 Ga0501076_0014690 Ga0501076_0014690_3000_3767 244
315 3300049592 Ga0501076_0329513 Ga0501076_0329513_124_867 244
316 3300049593 Ga0501077_0017655 Ga0501077_0017655_3007_3774 244
317 3300049741 Ga0501079_0000225 Ga0501079_0000225_8733_9500 244
318 3300049742 Ga0501080_0004604 Ga0501080_0004604_10793_11560 244
319 3300049743 Ga0501081_0029850 Ga0501081_0029850_1653_2420 244
320 3300049824 Ga0501045_0024714 Ga0501045_0024714_436_1179 244
321 3300054114 Ga0501084_0001080 Ga0501084_0001080_18613_19380 244
322 3300060353 Ga0501082_0001398 Ga0501082_0001398_17248_18015 244
323 3300061734 Ga0530510_0007188 Ga0530510_0007188_1182_1949 244
324 3300005617 Ga0068859_100381571 Ga0068859_1003815712 245
325 3300006844 Ga0075428_100003524 Ga0075428_10000352416 245
326 3300006881 Ga0068865_100369982 Ga0068865_1003699822 245
327 3300006931 Ga0097620_100381570 Ga0097620_1003815702 245
328 3300007076 Ga0075435_100056574 Ga0075435_1000565743 245
329 3300009094 Ga0111539_10030953 Ga0111539_100309534 245
330 3300009987 Ga0105030_101632 Ga0105030_1016323 245
331 3300013874 Ga0157514_118433 Ga0157514_1184332 245
332 3300014326 Ga0157380_10001526 Ga0157380_100015262 245
333 3300017792 Ga0163161_10633028 Ga0163161_106330281 245
334 3300025926 Ga0207659_10064429 Ga0207659_100644292 245
335 3300027907 Ga0207428_10015902 Ga0207428_100159024 245
336 3300031727 Ga0316576_10059980 Ga0316576_100599802 245
337 3300031728 Ga0316578_10014130 Ga0316578_100141304 245
338 3300031730 Ga0307516_10283452 Ga0307516_102834521 245
339 3300031731 Ga0307405_10020726 Ga0307405_100207262 245
340 3300031733 Ga0316577_10057610 Ga0316577_100576103 245
341 3300031852 Ga0307410_10095215 Ga0307410_100952153 245
342 3300031901 Ga0307406_10297744 Ga0307406_102977442 245
343 3300031903 Ga0307407_10084000 Ga0307407_100840002 245
344 3300031995 Ga0307409_100250881 Ga0307409_1002508811 245
345 3300032002 Ga0307416_100743499 Ga0307416_1007434992 245
346 3300032004 Ga0307414_10023992 Ga0307414_100239924 245
347 3300032005 Ga0307411_10077324 Ga0307411_100773242 245
348 3300032126 Ga0307415_100021999 Ga0307415_1000219994 245
349 3300035398 Ga0316574_0159266 Ga0316574_0159266_484_1233 245
350 3300036647 Ga0316582_0043131 Ga0316582_0043131_682_1449 245
351 3300036712 Ga0316584_0001792 Ga0316584_0001792_11445_12212 245
352 3300041999 Ga0439433_0030933 Ga0439433_0030933_414_1166 245
353 3300042003 Ga0439443_000230 Ga0439443_000230_1395_2147 245
354 3300042125 Ga0450923_003145 Ga0450923_003145_822_1574 245
355 3300042133 Ga0450896_000315 Ga0450896_000315_603_1355 245
356 3300042133 Ga0450896_009501 Ga0450896_009501_447_1199 245
357 3300042156 Ga0439446_0007461 Ga0439446_0007461_892_1644 245
358 3300042184 Ga0450908_002638 Ga0450908_002638_1289_2041 245
359 3300042436 Ga0439435_0007606 Ga0439435_0007606_622_1374 245
360 3300042531 Ga0450918_003576 Ga0450918_003576_1106_1858 245
361 3300046460 Ga0495638_0078316 Ga0495638_0078316_840_1580 245
362 3300046648 Ga0495611_0097475 Ga0495611_0097475_52_792 245
363 3300049573 Ga0501037_0057197 Ga0501037_0057197_1280_2032 245
364 3300049574 Ga0501038_0289698 Ga0501038_0289698_157_909 245
365 3300049575 Ga0501039_0041474 Ga0501039_0041474_2105_2857 245
366 3300049577 Ga0501041_0053200 Ga0501041_0053200_1645_2397 245
367 3300049578 Ga0501042_0060549 Ga0501042_0060549_1325_2077 245
368 3300049578 Ga0501042_0073896 Ga0501042_0073896_1211_1963 245
369 3300049578 Ga0501042_0126968 Ga0501042_0126968_994_1746 245
370 3300049582 Ga0501048_0122853 Ga0501048_0122853_16_768 245
371 3300049583 Ga0501067_0003850 Ga0501067_0003850_24_776 245
372 3300049588 Ga0501072_0472696 Ga0501072_0472696_16_768 245
373 3300049589 Ga0501073_0000567 Ga0501073_0000567_15941_16693 245
374 3300049589 Ga0501073_0116930 Ga0501073_0116930_693_1445 245
375 3300049591 Ga0501075_0006057 Ga0501075_0006057_6596_7348 245
376 3300049591 Ga0501075_0031316 Ga0501075_0031316_1723_2475 245
377 3300049591 Ga0501075_0266732 Ga0501075_0266732_400_1152 245
378 3300049593 Ga0501077_0007565 Ga0501077_0007565_3458_4210 245
379 3300049741 Ga0501079_0025899 Ga0501079_0025899_1965_2717 245
380 3300049741 Ga0501079_0129787 Ga0501079_0129787_678_1430 245
381 3300049742 Ga0501080_0035821 Ga0501080_0035821_2855_3607 245
382 3300049742 Ga0501080_0058724 Ga0501080_0058724_1491_2243 245
383 3300049743 Ga0501081_0001700 Ga0501081_0001700_3934_4686 245
384 3300049743 Ga0501081_0027392 Ga0501081_0027392_500_1252 245
385 3300049744 Ga0501083_0200083 Ga0501083_0200083_347_1099 245
386 3300049822 Ga0501035_0029886 Ga0501035_0029886_2873_3625 245
387 3300049824 Ga0501045_0028931 Ga0501045_0028931_1061_1813 245
388 3300050511 nmdc:mga08y16_16105_c1 nmdc:mga08y16_16105_c1_6386_7138 245
389 3300050512 nmdc:mga0n895_60682_c1 nmdc:mga0n895_60682_c1_1397_2149 245
390 3300050513 nmdc:mga0rr50_85913_c1 nmdc:mga0rr50_85913_c1_793_1545 245
391 3300050515 nmdc:mga0a205_9400_c1 nmdc:mga0a205_9400_c1_4483_5235 245
392 3300053131 Ga0500652_008335 Ga0500652_008335_1384_2133 245
393 3300053134 Ga0500658_0034955 Ga0500658_0034955_642_1391 245
394 3300053153 Ga0500616_0139332 Ga0500616_0139332_365_1114 245
395 3300060353 Ga0501082_0009770 Ga0501082_0009770_6190_6942 245
396 3300060353 Ga0501082_0035083 Ga0501082_0035083_2645_3397 245
397 3300060353 Ga0501082_0142641 Ga0501082_0142641_1283_2035 245
398 3300061734 Ga0530510_0027223 Ga0530510_0027223_2297_3049 245
399 3300061734 Ga0530510_0258970 Ga0530510_0258970_147_899 245
400 3300005293 Ga0065715_10117779 Ga0065715_101177792 246
401 3300005329 Ga0070683_100347404 Ga0070683_1003474041 246
402 3300005330 Ga0070690_100001101 Ga0070690_10000110112 246
403 3300005330 Ga0070690_100140187 Ga0070690_1001401872 246
404 3300005331 Ga0070670_100003676 Ga0070670_1000036767 246
405 3300005331 Ga0070670_100060245 Ga0070670_1000602453 246
406 3300005331 Ga0070670_100344443 Ga0070670_1003444431 246
407 3300005333 Ga0070677_10027683 Ga0070677_100276832 246
408 3300005335 Ga0070666_10181299 Ga0070666_101812992 246
409 3300005336 Ga0070680_100049944 Ga0070680_1000499442 246
410 3300005337 Ga0070682_100128779 Ga0070682_1001287792 246
411 3300005340 Ga0070689_100003117 Ga0070689_1000031177 246
412 3300005340 Ga0070689_100014601 Ga0070689_1000146016 246
413 3300005340 Ga0070689_100240999 Ga0070689_1002409992 246
414 3300005343 Ga0070687_100002410 Ga0070687_1000024105 246
415 3300005347 Ga0070668_100011367 Ga0070668_1000113672 246
416 3300005353 Ga0070669_100176074 Ga0070669_1001760743 246
417 3300005354 Ga0070675_100002544 Ga0070675_10000254413 246
418 3300005354 Ga0070675_100203523 Ga0070675_1002035232 246
419 3300005355 Ga0070671_100061485 Ga0070671_1000614853 246
420 3300005356 Ga0070674_100072370 Ga0070674_1000723701 246
421 3300005356 Ga0070674_100268553 Ga0070674_1002685531 246
422 3300005364 Ga0070673_100016833 Ga0070673_1000168334 246
423 3300005364 Ga0070673_100039789 Ga0070673_1000397894 246
424 3300005365 Ga0070688_100244949 Ga0070688_1002449492 246
425 3300005367 Ga0070667_100022124 Ga0070667_1000221242 246
426 3300005367 Ga0070667_100043527 Ga0070667_1000435273 246
427 3300005439 Ga0070711_100121996 Ga0070711_1001219962 246
428 3300005440 Ga0070705_100002488 Ga0070705_1000024887 246
429 3300005441 Ga0070700_100149940 Ga0070700_1001499403 246
430 3300005444 Ga0070694_100047554 Ga0070694_1000475542 246
431 3300005444 Ga0070694_100148749 Ga0070694_1001487491 246
432 3300005456 Ga0070678_100047671 Ga0070678_1000476712 246
433 3300005456 Ga0070678_100491858 Ga0070678_1004918582 246
434 3300005457 Ga0070662_100023946 Ga0070662_1000239463 246
435 3300005457 Ga0070662_100100118 Ga0070662_1001001183 246
436 3300005458 Ga0070681_10023343 Ga0070681_100233434 246
437 3300005458 Ga0070681_10235398 Ga0070681_102353982 246
438 3300005459 Ga0068867_100010102 Ga0068867_1000101024 246
439 3300005466 Ga0070685_10017277 Ga0070685_100172772 246
440 3300005466 Ga0070685_10029825 Ga0070685_100298253 246
441 3300005530 Ga0070679_100006962 Ga0070679_1000069627 246
442 3300005530 Ga0070679_100588829 Ga0070679_1005888292 246
443 3300005530 Ga0070679_100747898 Ga0070679_1007478981 246
444 3300005535 Ga0070684_100015392 Ga0070684_1000153924 246
445 3300005535 Ga0070684_100104912 Ga0070684_1001049122 246
446 3300005543 Ga0070672_100021856 Ga0070672_1000218565 246
447 3300005543 Ga0070672_100183081 Ga0070672_1001830812 246
448 3300005543 Ga0070672_100487604 Ga0070672_1004876041 246
449 3300005544 Ga0070686_100003731 Ga0070686_1000037314 246
450 3300005544 Ga0070686_100052475 Ga0070686_1000524752 246
451 3300005545 Ga0070695_100190601 Ga0070695_1001906012 246
452 3300005548 Ga0070665_100040029 Ga0070665_1000400293 246
453 3300005563 Ga0068855_100003333 Ga0068855_1000033337 246
454 3300005563 Ga0068855_101097448 Ga0068855_1010974481 246
455 3300005564 Ga0070664_100005455 Ga0070664_1000054555 246
456 3300005564 Ga0070664_100039620 Ga0070664_1000396204 246
457 3300005577 Ga0068857_100233738 Ga0068857_1002337382 246
458 3300005614 Ga0068856_100108153 Ga0068856_1001081533 246
459 3300005617 Ga0068859_100011511 Ga0068859_1000115117 246
460 3300005617 Ga0068859_100021941 Ga0068859_1000219417 246
461 3300005618 Ga0068864_100002045 Ga0068864_1000020455 246
462 3300005618 Ga0068864_100002439 Ga0068864_1000024394 246
463 3300005618 Ga0068864_100180420 Ga0068864_1001804202 246
464 3300005718 Ga0068866_10038460 Ga0068866_100384602 246
465 3300005719 Ga0068861_100008857 Ga0068861_1000088575 246
466 3300005719 Ga0068861_100033975 Ga0068861_1000339753 246
467 3300005719 Ga0068861_100371092 Ga0068861_1003710922 246
468 3300005840 Ga0068870_10002942 Ga0068870_100029423 246
469 3300005841 Ga0068863_100002890 Ga0068863_1000028905 246
470 3300005841 Ga0068863_100004762 Ga0068863_10000476212 246
471 3300005842 Ga0068858_100012146 Ga0068858_1000121467 246
472 3300005842 Ga0068858_100019368 Ga0068858_1000193683 246
473 3300005843 Ga0068860_100093912 Ga0068860_1000939122 246
474 3300005844 Ga0068862_100001400 Ga0068862_10000140018 246
475 3300005844 Ga0068862_100002538 Ga0068862_1000025383 246
476 3300005844 Ga0068862_100050879 Ga0068862_1000508796 246
477 3300005844 Ga0068862_100119052 Ga0068862_1001190522 246
478 3300006237 Ga0097621_100011072 Ga0097621_1000110725 246
479 3300006237 Ga0097621_100041180 Ga0097621_1000411805 246
480 3300006358 Ga0068871_100227687 Ga0068871_1002276872 246
481 3300006358 Ga0068871_100247607 Ga0068871_1002476072 246
482 3300006844 Ga0075428_100010558 Ga0075428_1000105588 246
483 3300006844 Ga0075428_100057971 Ga0075428_1000579714 246
484 3300006844 Ga0075428_100223805 Ga0075428_1002238052 246
485 3300006846 Ga0075430_100004165 Ga0075430_1000041658 246
486 3300006846 Ga0075430_100129044 Ga0075430_1001290443 246
487 3300006846 Ga0075430_100188277 Ga0075430_1001882772 246
488 3300006847 Ga0075431_100006075 Ga0075431_1000060758 246
489 3300006847 Ga0075431_100019257 Ga0075431_1000192574 246
490 3300006847 Ga0075431_100081593 Ga0075431_1000815933 246
491 3300006871 Ga0075434_100270477 Ga0075434_1002704773 246
492 3300006880 Ga0075429_100001918 Ga0075429_10000191812 246
493 3300006931 Ga0097620_100011511 Ga0097620_1000115117 246
494 3300006931 Ga0097620_100021941 Ga0097620_1000219417 246
495 3300009093 Ga0105240_10000096 Ga0105240_10000096118 246
496 3300009094 Ga0111539_10093018 Ga0111539_100930183 246
497 3300009094 Ga0111539_10122978 Ga0111539_101229783 246
498 3300009098 Ga0105245_10009466 Ga0105245_100094663 246
499 3300009101 Ga0105247_10024700 Ga0105247_100247004 246
500 3300009101 Ga0105247_10152924 Ga0105247_101529241 246
501 3300009147 Ga0114129_10022191 Ga0114129_100221915 246
502 3300009148 Ga0105243_10223885 Ga0105243_102238852 246
503 3300009174 Ga0105241_10428336 Ga0105241_104283362 246
504 3300009177 Ga0105248_10000927 Ga0105248_1000092718 246
505 3300009177 Ga0105248_10002211 Ga0105248_1000221112 246
506 3300009553 Ga0105249_10042397 Ga0105249_100423974 246
507 3300009553 Ga0105249_10223321 Ga0105249_102233213 246
508 3300011119 Ga0105246_10256532 Ga0105246_102565322 246
509 3300013296 Ga0157374_10002219 Ga0157374_100022199 246
510 3300013296 Ga0157374_10804867 Ga0157374_108048672 246
511 3300013306 Ga0163162_10005133 Ga0163162_100051332 246
512 3300013306 Ga0163162_10125957 Ga0163162_101259572 246
513 3300013308 Ga0157375_10029153 Ga0157375_100291534 246
514 3300014325 Ga0163163_10021084 Ga0163163_100210843 246
515 3300014325 Ga0163163_10035034 Ga0163163_100350344 246
516 3300014745 Ga0157377_10008214 Ga0157377_100082144 246
517 3300014745 Ga0157377_10392112 Ga0157377_103921122 246
518 3300014968 Ga0157379_10016987 Ga0157379_100169872 246
519 3300014968 Ga0157379_10208717 Ga0157379_102087172 246
520 3300014968 Ga0157379_10216275 Ga0157379_102162753 246
521 3300014969 Ga0157376_10292418 Ga0157376_102924182 246
522 3300025893 Ga0207682_10159148 Ga0207682_101591481 246
523 3300025901 Ga0207688_10124247 Ga0207688_101242472 246
524 3300025907 Ga0207645_10017215 Ga0207645_100172155 246
525 3300025908 Ga0207643_10005288 Ga0207643_100052885 246
526 3300025911 Ga0207654_10271841 Ga0207654_102718412 246
527 3300025913 Ga0207695_10000836 Ga0207695_1000083652 246
528 3300025916 Ga0207663_10276455 Ga0207663_102764552 246
529 3300025918 Ga0207662_10018456 Ga0207662_100184563 246
530 3300025923 Ga0207681_10050016 Ga0207681_100500163 246
531 3300025923 Ga0207681_10383458 Ga0207681_103834582 246
532 3300025924 Ga0207694_10225623 Ga0207694_102256231 246
533 3300025925 Ga0207650_10022398 Ga0207650_100223984 246
534 3300025925 Ga0207650_10061558 Ga0207650_100615582 246
535 3300025926 Ga0207659_10028250 Ga0207659_100282503 246
536 3300025927 Ga0207687_10287716 Ga0207687_102877162 246
537 3300025932 Ga0207690_10078328 Ga0207690_100783283 246
538 3300025933 Ga0207706_10171654 Ga0207706_101716542 246
539 3300025936 Ga0207670_10014599 Ga0207670_100145995 246
540 3300025937 Ga0207669_10435504 Ga0207669_104355042 246
541 3300025938 Ga0207704_10173070 Ga0207704_101730702 246
542 3300025938 Ga0207704_10370082 Ga0207704_103700822 246
543 3300025940 Ga0207691_10026146 Ga0207691_100261465 246
544 3300025940 Ga0207691_10562969 Ga0207691_105629692 246
545 3300025941 Ga0207711_10559056 Ga0207711_105590562 246
546 3300025942 Ga0207689_10006698 Ga0207689_1000669810 246
547 3300025942 Ga0207689_10764309 Ga0207689_107643091 246
548 3300025945 Ga0207679_10085067 Ga0207679_100850672 246
549 3300025960 Ga0207651_10006633 Ga0207651_100066336 246
550 3300025960 Ga0207651_10235111 Ga0207651_102351112 246
551 3300025961 Ga0207712_10008158 Ga0207712_100081587 246
552 3300025961 Ga0207712_10343749 Ga0207712_103437492 246
553 3300025972 Ga0207668_10054973 Ga0207668_100549732 246
554 3300025972 Ga0207668_10059709 Ga0207668_100597094 246
555 3300025981 Ga0207640_10102706 Ga0207640_101027063 246
556 3300025986 Ga0207658_10125795 Ga0207658_101257953 246
557 3300026023 Ga0207677_10038461 Ga0207677_100384614 246
558 3300026023 Ga0207677_10051445 Ga0207677_100514453 246
559 3300026035 Ga0207703_10008219 Ga0207703_100082194 246
560 3300026041 Ga0207639_10333010 Ga0207639_103330102 246
561 3300026075 Ga0207708_10174181 Ga0207708_101741813 246
562 3300026075 Ga0207708_10362298 Ga0207708_103622982 246
563 3300026088 Ga0207641_10009300 Ga0207641_100093005 246
564 3300026088 Ga0207641_10142750 Ga0207641_101427503 246
565 3300026089 Ga0207648_10012447 Ga0207648_100124475 246
566 3300026095 Ga0207676_10004587 Ga0207676_100045874 246
567 3300026095 Ga0207676_10013079 Ga0207676_100130792 246
568 3300026116 Ga0207674_10061347 Ga0207674_100613473 246
569 3300026118 Ga0207675_100026519 Ga0207675_1000265195 246
570 3300026118 Ga0207675_100114026 Ga0207675_1001140263 246
571 3300026118 Ga0207675_100563324 Ga0207675_1005633241 246
572 3300026121 Ga0207683_10052091 Ga0207683_100520912 246
573 3300027907 Ga0207428_10068513 Ga0207428_100685133 246
574 3300027907 Ga0207428_10145422 Ga0207428_101454222 246
575 3300028379 Ga0268266_10066917 Ga0268266_100669173 246
576 3300028379 Ga0268266_10553333 Ga0268266_105533332 246
577 3300028380 Ga0268265_10000229 Ga0268265_1000022910 246
578 3300028380 Ga0268265_10002881 Ga0268265_100028815 246
579 3300028380 Ga0268265_10028437 Ga0268265_100284372 246
580 3300028381 Ga0268264_10098251 Ga0268264_100982513 246
581 3300031665 Ga0316575_10052829 Ga0316575_100528293 246
582 3300031727 Ga0316576_10005175 Ga0316576_100051755 246
583 3300031727 Ga0316576_10064162 Ga0316576_100641621 246
584 3300031728 Ga0316578_10003227 Ga0316578_100032272 246
585 3300031733 Ga0316577_10053267 Ga0316577_100532674 246
586 3300031824 Ga0307413_10109949 Ga0307413_101099493 246
587 3300031852 Ga0307410_10300063 Ga0307410_103000632 246
588 3300031901 Ga0307406_10099368 Ga0307406_100993682 246
589 3300031901 Ga0307406_10590603 Ga0307406_105906031 246
590 3300031911 Ga0307412_10080429 Ga0307412_100804293 246
591 3300032002 Ga0307416_100243907 Ga0307416_1002439072 246
592 3300032139 Ga0316580_10015332 Ga0316580_100153323 246
593 3300034817 Ga0373948_0037180 Ga0373948_0037180_140_880 246
594 3300035085 Ga0373929_0024713 Ga0373929_0024713_377_1117 246
595 3300035172 Ga0373955_0032272 Ga0373955_0032272_1751_2506 246
596 3300035242 Ga0373962_0101982 Ga0373962_0101982_90_830 246
597 3300035398 Ga0316574_0000055 Ga0316574_0000055_12047_12790 246
598 3300035398 Ga0316574_0038361 Ga0316574_0038361_1933_2676 246
599 3300036401 Ga0373937_0026263 Ga0373937_0026263_3436_4191 246
600 3300036712 Ga0316584_0031574 Ga0316584_0031574_355_1098 246
601 3300039062 Ga0400483_073268 Ga0400483_073268_2566_3333 246
602 3300039062 Ga0400483_223374 Ga0400483_223374_762_1529 246
603 3300042876 Ga0451577_0131818 Ga0451577_0131818_34_780 246
604 3300044712 Ga0453684_0115260 Ga0453684_0115260_1353_2141 246
605 3300044842 Ga0466957_0330333 Ga0466957_0330333_267_1019 246
606 3300045051 Ga0451576_0047403 Ga0451576_0047403_3060_3815 246
607 3300045051 Ga0451576_0071884 Ga0451576_0071884_159_899 246
608 3300045051 Ga0451576_0390807 Ga0451576_0390807_480_1226 246
609 3300046471 Ga0495650_0013982 Ga0495650_0013982_1739_2485 246
610 3300046664 Ga0495659_0104326 Ga0495659_0104326_99_848 246
611 3300047322 Ga0495680_0104882 Ga0495680_0104882_486_1244 246
612 3300048907 Ga0496104_0044072 Ga0496104_0044072_3096_3851 246
613 3300048908 Ga0496105_0360477 Ga0496105_0360477_65_805 246
614 3300048911 Ga0496108_0058195 Ga0496108_0058195_1450_2190 246
615 3300048912 Ga0496109_0052934 Ga0496109_0052934_2716_3456 246
616 3300048912 Ga0496109_0346883 Ga0496109_0346883_58_813 246
617 3300048913 Ga0496110_0079484 Ga0496110_0079484_116_856 246
618 3300048915 Ga0496112_0132206 Ga0496112_0132206_769_1524 246
619 3300048916 Ga0496113_0039378 Ga0496113_0039378_1369_2109 246
620 3300048917 Ga0496114_0186884 Ga0496114_0186884_216_956 246
621 3300049578 Ga0501042_0126208 Ga0501042_0126208_674_1417 246
622 3300049587 Ga0501071_0030458 Ga0501071_0030458_2269_3012 246
623 3300049741 Ga0501079_0583072 Ga0501079_0583072_18_761 246
624 3300049744 Ga0501083_0267217 Ga0501083_0267217_64_807 246
625 3300049824 Ga0501045_0036634 Ga0501045_0036634_384_1127 246
626 3300050507 nmdc:mga05p37_8696_c1 nmdc:mga05p37_8696_c1_3249_3989 246
627 3300050509 nmdc:mga0qj67_8382_c1 nmdc:mga0qj67_8382_c1_5269_6009 246
628 3300050510 nmdc:mga06r32_14131_c1 nmdc:mga06r32_14131_c1_3239_3979 246
629 3300050510 nmdc:mga06r32_31753_c1 nmdc:mga06r32_31753_c1_629_1369 246
630 3300050512 nmdc:mga0n895_450208_c1 nmdc:mga0n895_450208_c1_454_1194 246
631 3300053077 Ga0495601_0053948 Ga0495601_0053948_1748_2503 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

16

231

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h3a-assembly1.cif.gz_B structure of e. coli undecaprenyl diphosphate synthase in complex with bph-1330 0.9775 12 232
5cqj-assembly1.cif.gz_B crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with clomiphene 0.9773 12 232
4h3c-assembly1.cif.gz_B structure of e. coli undecaprenyl diphosphate synthase in complex with bph-987 0.9757 11 232
3sh0-assembly1.cif.gz_A crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with bph-1065 0.9752 12 232
3sgx-assembly1.cif.gz_B crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with bph-1100 0.9718 12 229
ID Description Score Start End Superfamily
1v7uB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9628 12 232 3.40.1180.10
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9555 7 232 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9469 9 232 3.40.1180.10
1v7uB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9457 12 232 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9445 5 239 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A662B016-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.981 10 215 GO:0016094
GO:0045547
GO:0046872
AF-A0A349EDR2-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9803 10 232 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A4Q5R3Z9-F1-model_v4 Isoprenyl transferase 0.9753 10 232 GO:0016094
GO:0045547
GO:0046872
AF-A0A259LN37-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9752 11 212 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A2S6U2I4-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9741 10 236 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547

Feature Viewer

pLDDT pTM Quality
87.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map