F470894
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 631 | 297 | 631 | 246 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100110702|Ga0070714_1001107022 |
| Length | 243 |
| Sequence | MSETNTGAPPAHIAIIMDGNGRWAKSRGLMRHAGHKAGLDTARAIIEHCAERKVGVLTLFTFSSENWQRPETEVGLLMELFLVALGKDVRDLHKNGIRVRFIGDRAAFSPKLQGGMAEAETLTARNPRMLLNIAVGYGGRWDILDAARRLAAQGKLETADETALGAAMALGDGPDPDLFIRTGGEKRISNFLLWNLAYTELYFTDTLWPDFGKSQLDEAIIWFQARQRRFGKTGEQMEDRERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 151 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 194 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 202 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 210 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 211 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 212 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 213 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 214 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 216 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 217 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 218 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 219 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 220 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 221 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 222 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 223 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 226 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 292 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 295 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.48 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.79 |
| Nodule | 0 |
| Rhizoplane | 2.38 |
| Rhizosphere | 94.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10117779 | 3300005293 | Bacteria | 2336 |
| 2 | Ga0065707_10083272 | 3300005295 | Bacteria | 9720 |
| 3 | Ga0065707_10085402 | 3300005295 | Bacteria | 6181 |
| 4 | Ga0070676_10001863 | 3300005328 | Bacteria | 10736 |
| 5 | Ga0070676_10212112 | 3300005328 | Bacteria | 1275 |
| 6 | Ga0070683_100347404 | 3300005329 | Bacteria | 1413 |
| 7 | Ga0070690_100001101 | 3300005330 | Bacteria | 13893 |
| 8 | Ga0070690_100027355 | 3300005330 | Bacteria | 3525 |
| 9 | Ga0070690_100140187 | 3300005330 | Bacteria | 1641 |
| 10 | Ga0070670_100003676 | 3300005331 | Bacteria | 12785 |
| 11 | Ga0070670_100060245 | 3300005331 | Bacteria | 3259 |
| 12 | Ga0070670_100258838 | 3300005331 | Bacteria | 1517 |
| 13 | Ga0070670_100344443 | 3300005331 | Bacteria | 1309 |
| 14 | Ga0070677_10027683 | 3300005333 | Bacteria | 2136 |
| 15 | Ga0070666_10181299 | 3300005335 | Bacteria | 1477 |
| 16 | Ga0070680_100049944 | 3300005336 | Bacteria | 3411 |
| 17 | Ga0070682_100076899 | 3300005337 | Bacteria | 2150 |
| 18 | Ga0070682_100128779 | 3300005337 | Bacteria | 1710 |
| 19 | Ga0070689_100003117 | 3300005340 | Bacteria | 10950 |
| 20 | Ga0070689_100014601 | 3300005340 | Bacteria | 5710 |
| 21 | Ga0070689_100022584 | 3300005340 | Bacteria | 4699 |
| 22 | Ga0070689_100240999 | 3300005340 | Bacteria | 1489 |
| 23 | Ga0070689_100312810 | 3300005340 | Bacteria | 1310 |
| 24 | Ga0070691_10195240 | 3300005341 | Bacteria | 1061 |
| 25 | Ga0070687_100002410 | 3300005343 | Bacteria | 6987 |
| 26 | Ga0070661_100140217 | 3300005344 | Bacteria | 1821 |
| 27 | Ga0070668_100011367 | 3300005347 | Bacteria | 6631 |
| 28 | Ga0070669_100010367 | 3300005353 | Bacteria | 6619 |
| 29 | Ga0070669_100060857 | 3300005353 | Bacteria | 2774 |
| 30 | Ga0070669_100176074 | 3300005353 | Bacteria | 1671 |
| 31 | Ga0070675_100002544 | 3300005354 | Bacteria | 13645 |
| 32 | Ga0070675_100008341 | 3300005354 | Bacteria | 8040 |
| 33 | Ga0070675_100203523 | 3300005354 | Bacteria | 1718 |
| 34 | Ga0070671_100061485 | 3300005355 | Bacteria | 3128 |
| 35 | Ga0070671_100665646 | 3300005355 | Bacteria | 902 |
| 36 | Ga0070674_100000687 | 3300005356 | Bacteria | 17126 |
| 37 | Ga0070674_100072370 | 3300005356 | Bacteria | 2441 |
| 38 | Ga0070674_100268553 | 3300005356 | Bacteria | 1347 |
| 39 | Ga0070673_100009396 | 3300005364 | Bacteria | 6563 |
| 40 | Ga0070673_100016833 | 3300005364 | Bacteria | 5183 |
| 41 | Ga0070673_100039789 | 3300005364 | Bacteria | 3602 |
| 42 | Ga0070688_100125584 | 3300005365 | Bacteria | 1724 |
| 43 | Ga0070688_100219988 | 3300005365 | Bacteria | 1338 |
| 44 | Ga0070688_100244949 | 3300005365 | Bacteria | 1274 |
| 45 | Ga0070667_100022124 | 3300005367 | Bacteria | 5273 |
| 46 | Ga0070667_100043527 | 3300005367 | Bacteria | 3768 |
| 47 | Ga0070667_100548850 | 3300005367 | Bacteria | 1062 |
| 48 | Ga0070714_100110702 | 3300005435 | Bacteria | 2431 |
| 49 | Ga0070713_100210102 | 3300005436 | Bacteria | 1761 |
| 50 | Ga0070701_10038359 | 3300005438 | Bacteria | 2424 |
| 51 | Ga0070701_10056323 | 3300005438 | Bacteria | 2056 |
| 52 | Ga0070711_100004271 | 3300005439 | Bacteria | 8404 |
| 53 | Ga0070711_100121670 | 3300005439 | Bacteria | 1931 |
| 54 | Ga0070711_100121996 | 3300005439 | Bacteria | 1929 |
| 55 | Ga0070705_100002488 | 3300005440 | Bacteria | 9262 |
| 56 | Ga0070705_100032948 | 3300005440 | Bacteria | 2884 |
| 57 | Ga0070700_100084892 | 3300005441 | Bacteria | 2053 |
| 58 | Ga0070700_100149940 | 3300005441 | Bacteria | 1594 |
| 59 | Ga0070694_100047554 | 3300005444 | Bacteria | 2884 |
| 60 | Ga0070694_100068407 | 3300005444 | Bacteria | 2441 |
| 61 | Ga0070694_100148749 | 3300005444 | Bacteria | 1708 |
| 62 | Ga0070678_100047671 | 3300005456 | Bacteria | 3081 |
| 63 | Ga0070678_100491796 | 3300005456 | Bacteria | 1081 |
| 64 | Ga0070678_100491858 | 3300005456 | Bacteria | 1081 |
| 65 | Ga0070662_100002548 | 3300005457 | Bacteria | 11222 |
| 66 | Ga0070662_100023946 | 3300005457 | Bacteria | 4201 |
| 67 | Ga0070662_100100118 | 3300005457 | Bacteria | 2192 |
| 68 | Ga0070681_10003522 | 3300005458 | Bacteria | 14664 |
| 69 | Ga0070681_10023343 | 3300005458 | Bacteria | 6219 |
| 70 | Ga0070681_10043647 | 3300005458 | Bacteria | 4490 |
| 71 | Ga0070681_10235398 | 3300005458 | Bacteria | 1745 |
| 72 | Ga0068867_100010102 | 3300005459 | Bacteria | 6652 |
| 73 | Ga0068867_100020743 | 3300005459 | Bacteria | 4684 |
| 74 | Ga0070685_10017277 | 3300005466 | Bacteria | 3859 |
| 75 | Ga0070685_10029825 | 3300005466 | Bacteria | 3034 |
| 76 | Ga0070679_100006962 | 3300005530 | Bacteria | 10552 |
| 77 | Ga0070679_100588829 | 3300005530 | Bacteria | 1056 |
| 78 | Ga0070679_100747898 | 3300005530 | Bacteria | 920 |
| 79 | Ga0070684_100015392 | 3300005535 | Bacteria | 6230 |
| 80 | Ga0070684_100104912 | 3300005535 | Bacteria | 2529 |
| 81 | Ga0068853_100390032 | 3300005539 | Bacteria | 1302 |
| 82 | Ga0070672_100001677 | 3300005543 | Bacteria | 13800 |
| 83 | Ga0070672_100021856 | 3300005543 | Bacteria | 4688 |
| 84 | Ga0070672_100183081 | 3300005543 | Bacteria | 1746 |
| 85 | Ga0070672_100487604 | 3300005543 | Bacteria | 1065 |
| 86 | Ga0070686_100003731 | 3300005544 | Bacteria | 8370 |
| 87 | Ga0070686_100015999 | 3300005544 | Bacteria | 4357 |
| 88 | Ga0070686_100042530 | 3300005544 | Bacteria | 2846 |
| 89 | Ga0070686_100052475 | 3300005544 | Bacteria | 2600 |
| 90 | Ga0070695_100190601 | 3300005545 | Bacteria | 1459 |
| 91 | Ga0070695_100218703 | 3300005545 | Bacteria | 1371 |
| 92 | Ga0070696_100000163 | 3300005546 | Bacteria | 37742 |
| 93 | Ga0070696_100198437 | 3300005546 | Bacteria | 1497 |
| 94 | Ga0070665_100006360 | 3300005548 | Bacteria | 12045 |
| 95 | Ga0070665_100040029 | 3300005548 | Bacteria | 4712 |
| 96 | Ga0070665_100211971 | 3300005548 | Bacteria | 1938 |
| 97 | Ga0070665_100499298 | 3300005548 | Bacteria | 1228 |
| 98 | Ga0070704_100096067 | 3300005549 | Bacteria | 2221 |
| 99 | Ga0068855_100003333 | 3300005563 | Bacteria | 19649 |
| 100 | Ga0068855_100016755 | 3300005563 | Bacteria | 8814 |
| 101 | Ga0068855_101097448 | 3300005563 | Bacteria | 832 |
| 102 | Ga0070664_100005455 | 3300005564 | Bacteria | 10212 |
| 103 | Ga0070664_100039620 | 3300005564 | Bacteria | 3971 |
| 104 | Ga0070664_100180879 | 3300005564 | Bacteria | 1874 |
| 105 | Ga0068857_100233738 | 3300005577 | Bacteria | 1682 |
| 106 | Ga0068856_100108153 | 3300005614 | Bacteria | 2777 |
| 107 | Ga0070702_100011363 | 3300005615 | Bacteria | 4427 |
| 108 | Ga0068859_100011511 | 3300005617 | Bacteria | 8893 |
| 109 | Ga0068859_100021941 | 3300005617 | Bacteria | 6402 |
| 110 | Ga0068859_100281646 | 3300005617 | Bacteria | 1755 |
| 111 | Ga0068859_100381571 | 3300005617 | Bacteria | 1505 |
| 112 | Ga0068864_100002045 | 3300005618 | Bacteria | 16656 |
| 113 | Ga0068864_100002439 | 3300005618 | Bacteria | 15376 |
| 114 | Ga0068864_100180420 | 3300005618 | Bacteria | 1930 |
| 115 | Ga0068866_10034628 | 3300005718 | Bacteria | 2461 |
| 116 | Ga0068866_10038460 | 3300005718 | Bacteria | 2356 |
| 117 | Ga0068861_100003473 | 3300005719 | Bacteria | 10458 |
| 118 | Ga0068861_100005236 | 3300005719 | Bacteria | 8741 |
| 119 | Ga0068861_100008857 | 3300005719 | Bacteria | 6935 |
| 120 | Ga0068861_100017281 | 3300005719 | Bacteria | 5117 |
| 121 | Ga0068861_100033104 | 3300005719 | Bacteria | 3811 |
| 122 | Ga0068861_100033975 | 3300005719 | Bacteria | 3767 |
| 123 | Ga0068861_100371092 | 3300005719 | Bacteria | 1261 |
| 124 | Ga0068870_10002942 | 3300005840 | Bacteria | 7178 |
| 125 | Ga0068870_10026255 | 3300005840 | Bacteria | 2902 |
| 126 | Ga0068870_10082443 | 3300005840 | Bacteria | 1781 |
| 127 | Ga0068863_100002890 | 3300005841 | Bacteria | 17011 |
| 128 | Ga0068863_100004762 | 3300005841 | Bacteria | 13370 |
| 129 | Ga0068863_100433948 | 3300005841 | Bacteria | 1288 |
| 130 | Ga0068858_100012146 | 3300005842 | Bacteria | 8120 |
| 131 | Ga0068858_100019368 | 3300005842 | Bacteria | 6363 |
| 132 | Ga0068858_100752229 | 3300005842 | Bacteria | 950 |
| 133 | Ga0068860_100093912 | 3300005843 | Bacteria | 2859 |
| 134 | Ga0068860_100142094 | 3300005843 | Bacteria | 2308 |
| 135 | Ga0068862_100001400 | 3300005844 | Bacteria | 22361 |
| 136 | Ga0068862_100002538 | 3300005844 | Bacteria | 16147 |
| 137 | Ga0068862_100008962 | 3300005844 | Bacteria | 8283 |
| 138 | Ga0068862_100050879 | 3300005844 | Bacteria | 3542 |
| 139 | Ga0068862_100119052 | 3300005844 | Bacteria | 2326 |
| 140 | Ga0070712_100321671 | 3300006175 | Bacteria | 1258 |
| 141 | Ga0097621_100011072 | 3300006237 | Bacteria | 6632 |
| 142 | Ga0097621_100041180 | 3300006237 | Bacteria | 3717 |
| 143 | Ga0097621_100350440 | 3300006237 | Bacteria | 1313 |
| 144 | Ga0068871_100008181 | 3300006358 | Bacteria | 7512 |
| 145 | Ga0068871_100227687 | 3300006358 | Bacteria | 1617 |
| 146 | Ga0068871_100247607 | 3300006358 | Bacteria | 1551 |
| 147 | Ga0075428_100003524 | 3300006844 | Bacteria | 17140 |
| 148 | Ga0075428_100010558 | 3300006844 | Bacteria | 10266 |
| 149 | Ga0075428_100057971 | 3300006844 | Bacteria | 4240 |
| 150 | Ga0075428_100223805 | 3300006844 | Bacteria | 2031 |
| 151 | Ga0075430_100004165 | 3300006846 | Bacteria | 12204 |
| 152 | Ga0075430_100058924 | 3300006846 | Bacteria | 3228 |
| 153 | Ga0075430_100129044 | 3300006846 | Bacteria | 2107 |
| 154 | Ga0075430_100188277 | 3300006846 | Bacteria | 1716 |
| 155 | Ga0075430_100266004 | 3300006846 | Bacteria | 1420 |
| 156 | Ga0075430_100543041 | 3300006846 | Bacteria | 959 |
| 157 | Ga0075431_100000318 | 3300006847 | Bacteria | 37976 |
| 158 | Ga0075431_100006075 | 3300006847 | Bacteria | 11973 |
| 159 | Ga0075431_100019257 | 3300006847 | Bacteria | 6957 |
| 160 | Ga0075431_100081593 | 3300006847 | Bacteria | 3339 |
| 161 | Ga0075431_100138436 | 3300006847 | Bacteria | 2509 |
| 162 | Ga0075434_100270477 | 3300006871 | Bacteria | 1719 |
| 163 | Ga0075429_100001918 | 3300006880 | Bacteria | 17254 |
| 164 | Ga0068865_100005610 | 3300006881 | Bacteria | 7615 |
| 165 | Ga0068865_100369982 | 3300006881 | Bacteria | 1166 |
| 166 | Ga0097620_100011511 | 3300006931 | Bacteria | 8893 |
| 167 | Ga0097620_100021941 | 3300006931 | Bacteria | 6402 |
| 168 | Ga0097620_100281650 | 3300006931 | Bacteria | 1755 |
| 169 | Ga0097620_100381570 | 3300006931 | Bacteria | 1505 |
| 170 | Ga0075435_100056574 | 3300007076 | Bacteria | 3171 |
| 171 | Ga0099795_10000075 | 3300007788 | Bacteria | 17387 |
| 172 | Ga0105250_10000005 | 3300009092 | Bacteria | 422580 |
| 173 | Ga0105240_10000096 | 3300009093 | Bacteria | 179543 |
| 174 | Ga0105240_10010627 | 3300009093 | Bacteria | 12932 |
| 175 | Ga0105240_10054925 | 3300009093 | Bacteria | 4989 |
| 176 | Ga0111539_10023643 | 3300009094 | Bacteria | 7551 |
| 177 | Ga0111539_10030953 | 3300009094 | Bacteria | 6502 |
| 178 | Ga0111539_10093018 | 3300009094 | Bacteria | 3542 |
| 179 | Ga0111539_10122978 | 3300009094 | Bacteria | 3041 |
| 180 | Ga0111539_10374914 | 3300009094 | Bacteria | 1656 |
| 181 | Ga0111539_10546423 | 3300009094 | Bacteria | 1349 |
| 182 | Ga0111539_10640436 | 3300009094 | Bacteria | 1238 |
| 183 | Ga0105245_10009466 | 3300009098 | Bacteria | 8498 |
| 184 | Ga0105247_10024700 | 3300009101 | Bacteria | 3623 |
| 185 | Ga0105247_10152924 | 3300009101 | Bacteria | 1522 |
| 186 | Ga0114129_10022191 | 3300009147 | Bacteria | 9012 |
| 187 | Ga0114129_10047662 | 3300009147 | Bacteria | 6021 |
| 188 | Ga0114129_10727062 | 3300009147 | Bacteria | 1273 |
| 189 | Ga0105243_10223885 | 3300009148 | Bacteria | 1664 |
| 190 | Ga0105243_10556013 | 3300009148 | Bacteria | 1097 |
| 191 | Ga0105241_10428336 | 3300009174 | Bacteria | 1166 |
| 192 | Ga0105248_10000927 | 3300009177 | Bacteria | 32633 |
| 193 | Ga0105248_10002211 | 3300009177 | Bacteria | 21553 |
| 194 | Ga0105248_10334862 | 3300009177 | Bacteria | 1704 |
| 195 | Ga0105238_10109519 | 3300009551 | Bacteria | 2743 |
| 196 | Ga0105249_10042397 | 3300009553 | Bacteria | 4138 |
| 197 | Ga0105249_10155934 | 3300009553 | Bacteria | 2202 |
| 198 | Ga0105249_10223321 | 3300009553 | Bacteria | 1855 |
| 199 | Ga0105030_101632 | 3300009987 | Bacteria | 1976 |
| 200 | Ga0099796_10000041 | 3300010159 | Bacteria | 26122 |
| 201 | Ga0099796_10024361 | 3300010159 | Bacteria | 1899 |
| 202 | Ga0105246_10256532 | 3300011119 | Bacteria | 1391 |
| 203 | Ga0157370_10234748 | 3300013104 | Bacteria | 1697 |
| 204 | Ga0157369_10047434 | 3300013105 | Bacteria | 4664 |
| 205 | Ga0157374_10002219 | 3300013296 | Bacteria | 16376 |
| 206 | Ga0157374_10804867 | 3300013296 | Bacteria | 956 |
| 207 | Ga0163162_10005133 | 3300013306 | Bacteria | 12619 |
| 208 | Ga0163162_10125957 | 3300013306 | Bacteria | 2668 |
| 209 | Ga0157372_10151956 | 3300013307 | Bacteria | 2673 |
| 210 | Ga0157375_10029153 | 3300013308 | Bacteria | 5186 |
| 211 | Ga0157514_118433 | 3300013874 | Bacteria | 1568 |
| 212 | Ga0163163_10021084 | 3300014325 | Bacteria | 6147 |
| 213 | Ga0163163_10035034 | 3300014325 | Bacteria | 4866 |
| 214 | Ga0157380_10001526 | 3300014326 | Bacteria | 15211 |
| 215 | Ga0157380_10007906 | 3300014326 | Bacteria | 7569 |
| 216 | Ga0157380_10023810 | 3300014326 | Bacteria | 4625 |
| 217 | Ga0157380_10094297 | 3300014326 | Bacteria | 2477 |
| 218 | Ga0157380_10291200 | 3300014326 | Bacteria | 1499 |
| 219 | Ga0157380_10492781 | 3300014326 | Bacteria | 1188 |
| 220 | Ga0157377_10008214 | 3300014745 | Bacteria | 5079 |
| 221 | Ga0157377_10392112 | 3300014745 | Bacteria | 943 |
| 222 | Ga0157379_10000311 | 3300014968 | Bacteria | 38664 |
| 223 | Ga0157379_10016987 | 3300014968 | Bacteria | 6405 |
| 224 | Ga0157379_10208717 | 3300014968 | Bacteria | 1767 |
| 225 | Ga0157379_10216275 | 3300014968 | Bacteria | 1736 |
| 226 | Ga0157379_10833643 | 3300014968 | Bacteria | 872 |
| 227 | Ga0157376_10283152 | 3300014969 | Bacteria | 1562 |
| 228 | Ga0157376_10292418 | 3300014969 | Bacteria | 1539 |
| 229 | Ga0163161_10385288 | 3300017792 | Bacteria | 1121 |
| 230 | Ga0163161_10633028 | 3300017792 | Bacteria | 885 |
| 231 | Ga0207696_1000470 | 3300025711 | Bacteria | 34731 |
| 232 | Ga0207682_10015058 | 3300025893 | Bacteria | 3011 |
| 233 | Ga0207682_10159148 | 3300025893 | Bacteria | 1022 |
| 234 | Ga0207692_10290823 | 3300025898 | Bacteria | 991 |
| 235 | Ga0207642_10027689 | 3300025899 | Bacteria | 2323 |
| 236 | Ga0207688_10124247 | 3300025901 | Bacteria | 1508 |
| 237 | Ga0207699_10137464 | 3300025906 | Bacteria | 1602 |
| 238 | Ga0207645_10000328 | 3300025907 | Bacteria | 39622 |
| 239 | Ga0207645_10017215 | 3300025907 | Bacteria | 4774 |
| 240 | Ga0207645_10238821 | 3300025907 | Bacteria | 1200 |
| 241 | Ga0207643_10005288 | 3300025908 | Bacteria | 6907 |
| 242 | Ga0207643_10032712 | 3300025908 | Bacteria | 2906 |
| 243 | Ga0207643_10088849 | 3300025908 | Bacteria | 1799 |
| 244 | Ga0207654_10271841 | 3300025911 | Bacteria | 1143 |
| 245 | Ga0207707_10004072 | 3300025912 | Bacteria | 12941 |
| 246 | Ga0207707_10006250 | 3300025912 | Bacteria | 10400 |
| 247 | Ga0207707_10008989 | 3300025912 | Bacteria | 8677 |
| 248 | Ga0207707_10049560 | 3300025912 | Bacteria | 3659 |
| 249 | Ga0207695_10000836 | 3300025913 | Bacteria | 56759 |
| 250 | Ga0207695_10009041 | 3300025913 | Bacteria | 12383 |
| 251 | Ga0207695_10055015 | 3300025913 | Bacteria | 4150 |
| 252 | Ga0207663_10048278 | 3300025916 | Bacteria | 2634 |
| 253 | Ga0207663_10131190 | 3300025916 | Bacteria | 1732 |
| 254 | Ga0207663_10276455 | 3300025916 | Bacteria | 1246 |
| 255 | Ga0207660_10013421 | 3300025917 | Bacteria | 5369 |
| 256 | Ga0207660_10127806 | 3300025917 | Bacteria | 1931 |
| 257 | Ga0207660_10595125 | 3300025917 | Bacteria | 901 |
| 258 | Ga0207662_10018456 | 3300025918 | Bacteria | 3959 |
| 259 | Ga0207649_10106185 | 3300025920 | Bacteria | 1867 |
| 260 | Ga0207652_10001982 | 3300025921 | Bacteria | 17714 |
| 261 | Ga0207652_10065733 | 3300025921 | Bacteria | 3141 |
| 262 | Ga0207652_10221539 | 3300025921 | Bacteria | 1705 |
| 263 | Ga0207681_10011754 | 3300025923 | Bacteria | 5383 |
| 264 | Ga0207681_10050016 | 3300025923 | Bacteria | 2827 |
| 265 | Ga0207681_10383458 | 3300025923 | Bacteria | 1132 |
| 266 | Ga0207681_10533130 | 3300025923 | Bacteria | 964 |
| 267 | Ga0207694_10225623 | 3300025924 | Bacteria | 1529 |
| 268 | Ga0207650_10022398 | 3300025925 | Bacteria | 4471 |
| 269 | Ga0207650_10061558 | 3300025925 | Bacteria | 2802 |
| 270 | Ga0207650_10062171 | 3300025925 | Bacteria | 2789 |
| 271 | Ga0207659_10028250 | 3300025926 | Bacteria | 3810 |
| 272 | Ga0207659_10064429 | 3300025926 | Bacteria | 2652 |
| 273 | Ga0207659_10111164 | 3300025926 | Bacteria | 2083 |
| 274 | Ga0207687_10287716 | 3300025927 | Bacteria | 1320 |
| 275 | Ga0207664_10032053 | 3300025929 | Bacteria | 4026 |
| 276 | Ga0207690_10078328 | 3300025932 | Bacteria | 2300 |
| 277 | Ga0207706_10000476 | 3300025933 | Bacteria | 42949 |
| 278 | Ga0207706_10171654 | 3300025933 | Bacteria | 1905 |
| 279 | Ga0207706_10174679 | 3300025933 | Bacteria | 1887 |
| 280 | Ga0207670_10014599 | 3300025936 | Bacteria | 4670 |
| 281 | Ga0207669_10020431 | 3300025937 | Bacteria | 3473 |
| 282 | Ga0207669_10062244 | 3300025937 | Bacteria | 2297 |
| 283 | Ga0207669_10435504 | 3300025937 | Bacteria | 1035 |
| 284 | Ga0207704_10019354 | 3300025938 | Bacteria | 3573 |
| 285 | Ga0207704_10173070 | 3300025938 | Bacteria | 1551 |
| 286 | Ga0207704_10370082 | 3300025938 | Bacteria | 1122 |
| 287 | Ga0207691_10013230 | 3300025940 | Bacteria | 7903 |
| 288 | Ga0207691_10026146 | 3300025940 | Bacteria | 5477 |
| 289 | Ga0207691_10098260 | 3300025940 | Bacteria | 2615 |
| 290 | Ga0207691_10562969 | 3300025940 | Bacteria | 966 |
| 291 | Ga0207711_10559056 | 3300025941 | Bacteria | 1067 |
| 292 | Ga0207689_10006698 | 3300025942 | Bacteria | 10164 |
| 293 | Ga0207689_10101721 | 3300025942 | Bacteria | 2360 |
| 294 | Ga0207689_10302840 | 3300025942 | Bacteria | 1325 |
| 295 | Ga0207689_10764309 | 3300025942 | Bacteria | 815 |
| 296 | Ga0207661_10588714 | 3300025944 | Bacteria | 1021 |
| 297 | Ga0207679_10085067 | 3300025945 | Bacteria | 2428 |
| 298 | Ga0207679_10133114 | 3300025945 | Bacteria | 1998 |
| 299 | Ga0207667_10000859 | 3300025949 | Bacteria | 39082 |
| 300 | Ga0207667_10008918 | 3300025949 | Bacteria | 11864 |
| 301 | Ga0207667_10030874 | 3300025949 | Bacteria | 5791 |
| 302 | Ga0207651_10006633 | 3300025960 | Bacteria | 6084 |
| 303 | Ga0207651_10042234 | 3300025960 | Bacteria | 3033 |
| 304 | Ga0207651_10235111 | 3300025960 | Bacteria | 1490 |
| 305 | Ga0207712_10008158 | 3300025961 | Bacteria | 6618 |
| 306 | Ga0207712_10135957 | 3300025961 | Bacteria | 1880 |
| 307 | Ga0207712_10343749 | 3300025961 | Bacteria | 1238 |
| 308 | Ga0207668_10054973 | 3300025972 | Bacteria | 2765 |
| 309 | Ga0207668_10059709 | 3300025972 | Bacteria | 2673 |
| 310 | Ga0207640_10102706 | 3300025981 | Bacteria | 2008 |
| 311 | Ga0207640_10249731 | 3300025981 | Bacteria | 1376 |
| 312 | Ga0207658_10080979 | 3300025986 | Bacteria | 2489 |
| 313 | Ga0207658_10125795 | 3300025986 | Bacteria | 2051 |
| 314 | Ga0207677_10038461 | 3300026023 | Bacteria | 3137 |
| 315 | Ga0207677_10051445 | 3300026023 | Bacteria | 2793 |
| 316 | Ga0207703_10008219 | 3300026035 | Bacteria | 8244 |
| 317 | Ga0207703_10157555 | 3300026035 | Bacteria | 1986 |
| 318 | Ga0207639_10333010 | 3300026041 | Bacteria | 1351 |
| 319 | Ga0207639_10483660 | 3300026041 | Bacteria | 1129 |
| 320 | Ga0207708_10009104 | 3300026075 | Bacteria | 7348 |
| 321 | Ga0207708_10017361 | 3300026075 | Bacteria | 5417 |
| 322 | Ga0207708_10174181 | 3300026075 | Bacteria | 1705 |
| 323 | Ga0207708_10362298 | 3300026075 | Bacteria | 1192 |
| 324 | Ga0207641_10009300 | 3300026088 | Bacteria | 8107 |
| 325 | Ga0207641_10142750 | 3300026088 | Bacteria | 2162 |
| 326 | Ga0207641_10408195 | 3300026088 | Bacteria | 1305 |
| 327 | Ga0207648_10000334 | 3300026089 | Bacteria | 51629 |
| 328 | Ga0207648_10012447 | 3300026089 | Bacteria | 7966 |
| 329 | Ga0207648_10164457 | 3300026089 | Bacteria | 1960 |
| 330 | Ga0207648_10561261 | 3300026089 | Bacteria | 1049 |
| 331 | Ga0207676_10004587 | 3300026095 | Bacteria | 9787 |
| 332 | Ga0207676_10013079 | 3300026095 | Bacteria | 5957 |
| 333 | Ga0207676_10038711 | 3300026095 | Bacteria | 3642 |
| 334 | Ga0207674_10061347 | 3300026116 | Bacteria | 3799 |
| 335 | Ga0207675_100000130 | 3300026118 | Bacteria | 63098 |
| 336 | Ga0207675_100010328 | 3300026118 | Bacteria | 8750 |
| 337 | Ga0207675_100023600 | 3300026118 | Bacteria | 5723 |
| 338 | Ga0207675_100026519 | 3300026118 | Bacteria | 5394 |
| 339 | Ga0207675_100039298 | 3300026118 | Bacteria | 4416 |
| 340 | Ga0207675_100114026 | 3300026118 | Bacteria | 2552 |
| 341 | Ga0207675_100310700 | 3300026118 | Bacteria | 1537 |
| 342 | Ga0207675_100390053 | 3300026118 | Bacteria | 1371 |
| 343 | Ga0207675_100563324 | 3300026118 | Bacteria | 1140 |
| 344 | Ga0207683_10052091 | 3300026121 | Bacteria | 3586 |
| 345 | Ga0209179_1001849 | 3300027512 | Bacteria | 2717 |
| 346 | Ga0209983_1009942 | 3300027665 | Bacteria | 1944 |
| 347 | Ga0209971_1003982 | 3300027682 | Bacteria | 3494 |
| 348 | Ga0209998_10000403 | 3300027717 | Bacteria | 12312 |
| 349 | Ga0207428_10015902 | 3300027907 | Bacteria | 6491 |
| 350 | Ga0207428_10068513 | 3300027907 | Bacteria | 2791 |
| 351 | Ga0207428_10145422 | 3300027907 | Bacteria | 1807 |
| 352 | Ga0265354_1000572 | 3300028016 | Bacteria | 6269 |
| 353 | Ga0265355_1006965 | 3300028036 | Bacteria | 891 |
| 354 | Ga0268266_10005164 | 3300028379 | Bacteria | 12303 |
| 355 | Ga0268266_10050681 | 3300028379 | Bacteria | 3562 |
| 356 | Ga0268266_10066917 | 3300028379 | Bacteria | 3108 |
| 357 | Ga0268266_10553333 | 3300028379 | Bacteria | 1103 |
| 358 | Ga0268265_10000229 | 3300028380 | Bacteria | 64020 |
| 359 | Ga0268265_10002881 | 3300028380 | Bacteria | 12635 |
| 360 | Ga0268265_10028437 | 3300028380 | Bacteria | 4002 |
| 361 | Ga0268264_10098251 | 3300028381 | Bacteria | 2539 |
| 362 | Ga0268264_10115597 | 3300028381 | Bacteria | 2357 |
| 363 | Ga0265326_10012593 | 3300028558 | Bacteria | 2484 |
| 364 | Ga0265319_1020919 | 3300028563 | Bacteria | 2413 |
| 365 | Ga0265334_10000092 | 3300028573 | Bacteria | 64246 |
| 366 | Ga0265334_10015782 | 3300028573 | Bacteria | 3134 |
| 367 | Ga0265334_10016134 | 3300028573 | Bacteria | 3090 |
| 368 | Ga0265318_10084899 | 3300028577 | Bacteria | 1167 |
| 369 | Ga0307515_10131960 | 3300028794 | Bacteria | 2744 |
| 370 | Ga0265338_10008550 | 3300028800 | Bacteria | 12393 |
| 371 | Ga0265338_10015759 | 3300028800 | Bacteria | 8278 |
| 372 | Ga0265338_10045487 | 3300028800 | Bacteria | 4035 |
| 373 | Ga0265770_1000679 | 3300030878 | Bacteria | 4744 |
| 374 | Ga0265760_10004101 | 3300031090 | Bacteria | 4196 |
| 375 | Ga0265330_10047808 | 3300031235 | Bacteria | 1882 |
| 376 | Ga0265332_10003170 | 3300031238 | Bacteria | 8005 |
| 377 | Ga0265328_10018951 | 3300031239 | Bacteria | 2647 |
| 378 | Ga0265320_10021292 | 3300031240 | Bacteria | 3492 |
| 379 | Ga0265320_10185802 | 3300031240 | Bacteria | 931 |
| 380 | Ga0265325_10026302 | 3300031241 | Bacteria | 3152 |
| 381 | Ga0265340_10007598 | 3300031247 | Bacteria | 5882 |
| 382 | Ga0265340_10056382 | 3300031247 | Bacteria | 1890 |
| 383 | Ga0265340_10058181 | 3300031247 | Bacteria | 1856 |
| 384 | Ga0265339_10011854 | 3300031249 | Bacteria | 5348 |
| 385 | Ga0265339_10072542 | 3300031249 | Bacteria | 1832 |
| 386 | Ga0265331_10003689 | 3300031250 | Bacteria | 9747 |
| 387 | Ga0307513_10464445 | 3300031456 | Bacteria | 988 |
| 388 | Ga0265313_10000109 | 3300031595 | Bacteria | 83136 |
| 389 | Ga0265313_10011088 | 3300031595 | Bacteria | 5622 |
| 390 | Ga0265313_10144393 | 3300031595 | Bacteria | 1021 |
| 391 | Ga0307508_10320885 | 3300031616 | Bacteria | 1141 |
| 392 | Ga0316575_10035455 | 3300031665 | Bacteria | 1962 |
| 393 | Ga0316575_10052829 | 3300031665 | Bacteria | 1618 |
| 394 | Ga0316575_10054900 | 3300031665 | Bacteria | 1586 |
| 395 | Ga0316579_10138386 | 3300031691 | Bacteria | 1174 |
| 396 | Ga0265314_10014543 | 3300031711 | Bacteria | 6290 |
| 397 | Ga0265342_10014672 | 3300031712 | Bacteria | 5192 |
| 398 | Ga0316576_10005175 | 3300031727 | Bacteria | 7925 |
| 399 | Ga0316576_10059980 | 3300031727 | Bacteria | 2786 |
| 400 | Ga0316576_10064162 | 3300031727 | Bacteria | 2697 |
| 401 | Ga0316578_10003227 | 3300031728 | Bacteria | 7400 |
| 402 | Ga0316578_10014130 | 3300031728 | Bacteria | 4255 |
| 403 | Ga0307516_10000209 | 3300031730 | Bacteria | 75193 |
| 404 | Ga0307516_10283452 | 3300031730 | Bacteria | 1338 |
| 405 | Ga0307405_10020726 | 3300031731 | Bacteria | 3679 |
| 406 | Ga0307405_10121336 | 3300031731 | Bacteria | 1789 |
| 407 | Ga0307405_10346776 | 3300031731 | Bacteria | 1144 |
| 408 | Ga0316577_10053267 | 3300031733 | Bacteria | 2258 |
| 409 | Ga0316577_10057610 | 3300031733 | Bacteria | 2169 |
| 410 | Ga0307413_10014541 | 3300031824 | Bacteria | 4002 |
| 411 | Ga0307413_10045868 | 3300031824 | Bacteria | 2595 |
| 412 | Ga0307413_10109949 | 3300031824 | Bacteria | 1843 |
| 413 | Ga0307413_10171043 | 3300031824 | Bacteria | 1538 |
| 414 | Ga0307410_10011726 | 3300031852 | Bacteria | 5029 |
| 415 | Ga0307410_10095215 | 3300031852 | Bacteria | 2123 |
| 416 | Ga0307410_10300063 | 3300031852 | Bacteria | 1267 |
| 417 | Ga0307410_10368400 | 3300031852 | Bacteria | 1153 |
| 418 | Ga0307406_10099368 | 3300031901 | Bacteria | 1978 |
| 419 | Ga0307406_10265474 | 3300031901 | Bacteria | 1301 |
| 420 | Ga0307406_10297744 | 3300031901 | Bacteria | 1238 |
| 421 | Ga0307406_10381964 | 3300031901 | Bacteria | 1111 |
| 422 | Ga0307406_10590603 | 3300031901 | Bacteria | 914 |
| 423 | Ga0307407_10032156 | 3300031903 | Bacteria | 2849 |
| 424 | Ga0307407_10084000 | 3300031903 | Bacteria | 1933 |
| 425 | Ga0307407_10348559 | 3300031903 | Bacteria | 1048 |
| 426 | Ga0307412_10080429 | 3300031911 | Bacteria | 2251 |
| 427 | Ga0307409_100027912 | 3300031995 | Bacteria | 4010 |
| 428 | Ga0307409_100049418 | 3300031995 | Bacteria | 3207 |
| 429 | Ga0307409_100214998 | 3300031995 | Bacteria | 1731 |
| 430 | Ga0307409_100250881 | 3300031995 | Bacteria | 1618 |
| 431 | Ga0307416_100243907 | 3300032002 | Bacteria | 1743 |
| 432 | Ga0307416_100743499 | 3300032002 | Bacteria | 1073 |
| 433 | Ga0307414_10023992 | 3300032004 | Bacteria | 3880 |
| 434 | Ga0307411_10000427 | 3300032005 | Bacteria | 14309 |
| 435 | Ga0307411_10001335 | 3300032005 | Bacteria | 9939 |
| 436 | Ga0307411_10077324 | 3300032005 | Bacteria | 2278 |
| 437 | Ga0307415_100021999 | 3300032126 | Bacteria | 3929 |
| 438 | Ga0316580_10015332 | 3300032139 | Bacteria | 2344 |
| 439 | Ga0316593_10008462 | 3300032168 | Bacteria | 2871 |
| 440 | Ga0373948_0037180 | 3300034817 | Bacteria | 1006 |
| 441 | Ga0373929_0024713 | 3300035085 | Bacteria | 1243 |
| 442 | Ga0373936_0071829 | 3300035113 | Bacteria | 1428 |
| 443 | Ga0373954_0023716 | 3300035118 | Bacteria | 2793 |
| 444 | Ga0373946_0082746 | 3300035171 | Bacteria | 1408 |
| 445 | Ga0373955_0032272 | 3300035172 | Bacteria | 2748 |
| 446 | Ga0373955_0125835 | 3300035172 | Bacteria | 1493 |
| 447 | Ga0373962_0101982 | 3300035242 | Bacteria | 896 |
| 448 | Ga0316574_0000055 | 3300035398 | Bacteria | 29301 |
| 449 | Ga0316574_0038361 | 3300035398 | Bacteria | 2940 |
| 450 | Ga0316574_0140099 | 3300035398 | Bacteria | 1558 |
| 451 | Ga0316574_0159266 | 3300035398 | Bacteria | 1454 |
| 452 | Ga0316574_0309412 | 3300035398 | Bacteria | 1004 |
| 453 | Ga0373935_0215091 | 3300035692 | Bacteria | 1333 |
| 454 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 455 | Ga0373933_0109635 | 3300035724 | Bacteria | 1721 |
| 456 | Ga0373933_0123745 | 3300035724 | Bacteria | 1621 |
| 457 | Ga0373937_0026263 | 3300036401 | Bacteria | 5262 |
| 458 | Ga0373937_0065893 | 3300036401 | Bacteria | 3335 |
| 459 | Ga0316582_0043131 | 3300036647 | Bacteria | 2829 |
| 460 | Ga0316582_0248873 | 3300036647 | Bacteria | 1218 |
| 461 | Ga0316584_0001792 | 3300036712 | Bacteria | 13245 |
| 462 | Ga0316584_0020680 | 3300036712 | Bacteria | 4775 |
| 463 | Ga0316584_0031574 | 3300036712 | Bacteria | 3916 |
| 464 | Ga0316584_0109519 | 3300036712 | Bacteria | 2067 |
| 465 | Ga0400490_56804 | 3300038726 | Bacteria | 19256 |
| 466 | Ga0400491_15621 | 3300038727 | Bacteria | 2809 |
| 467 | Ga0400486_24254 | 3300038742 | Bacteria | 1761 |
| 468 | Ga0400483_073268 | 3300039062 | Bacteria | 11164 |
| 469 | Ga0400483_223374 | 3300039062 | Bacteria | 5286 |
| 470 | Ga0400489_95956 | 3300039093 | Bacteria | 1352 |
| 471 | Ga0451797_1154171 | 3300041453 | Bacteria | 1100 |
| 472 | Ga0451841_0568682 | 3300041498 | Bacteria | 3503 |
| 473 | Ga0451849_1496435 | 3300041505 | Bacteria | 771 |
| 474 | Ga0451853_1522387 | 3300041512 | Bacteria | 2064 |
| 475 | Ga0439433_0030933 | 3300041999 | Bacteria | 1224 |
| 476 | Ga0439443_000230 | 3300042003 | Bacteria | 4312 |
| 477 | Ga0450923_003145 | 3300042125 | Bacteria | 2456 |
| 478 | Ga0450896_000315 | 3300042133 | Bacteria | 4592 |
| 479 | Ga0450896_009501 | 3300042133 | Bacteria | 1354 |
| 480 | Ga0439446_0002211 | 3300042156 | Bacteria | 4641 |
| 481 | Ga0439446_0007461 | 3300042156 | Bacteria | 2876 |
| 482 | Ga0450908_002638 | 3300042184 | Bacteria | 3517 |
| 483 | Ga0439434_0037539 | 3300042435 | Bacteria | 1483 |
| 484 | Ga0439435_0007606 | 3300042436 | Bacteria | 2486 |
| 485 | Ga0450918_003576 | 3300042531 | Bacteria | 2883 |
| 486 | Ga0450918_031512 | 3300042531 | Bacteria | 937 |
| 487 | Ga0451577_0131818 | 3300042876 | Bacteria | 2242 |
| 488 | Ga0453684_0115260 | 3300044712 | Bacteria | 3256 |
| 489 | Ga0466957_0330333 | 3300044842 | Bacteria | 1030 |
| 490 | Ga0451576_0046301 | 3300045051 | Bacteria | 4580 |
| 491 | Ga0451576_0047403 | 3300045051 | Bacteria | 4518 |
| 492 | Ga0451576_0071884 | 3300045051 | Bacteria | 3600 |
| 493 | Ga0451576_0390807 | 3300045051 | Bacteria | 1458 |
| 494 | Ga0495638_0003871 | 3300046460 | Bacteria | 11606 |
| 495 | Ga0495638_0010678 | 3300046460 | Bacteria | 6359 |
| 496 | Ga0495638_0078316 | 3300046460 | Bacteria | 2011 |
| 497 | Ga0495650_0013982 | 3300046471 | Bacteria | 4210 |
| 498 | Ga0495630_0083281 | 3300046517 | Bacteria | 2415 |
| 499 | Ga0495644_0023198 | 3300046523 | Bacteria | 2362 |
| 500 | Ga0495645_0164257 | 3300046543 | Bacteria | 1533 |
| 501 | Ga0495633_0015655 | 3300046558 | Bacteria | 3932 |
| 502 | Ga0495656_0040102 | 3300046615 | Bacteria | 1950 |
| 503 | Ga0495656_0081373 | 3300046615 | Bacteria | 1462 |
| 504 | Ga0495634_0382260 | 3300046642 | Bacteria | 839 |
| 505 | Ga0495611_0097475 | 3300046648 | Bacteria | 1363 |
| 506 | Ga0495625_0003242 | 3300046660 | Bacteria | 16463 |
| 507 | Ga0495625_0347281 | 3300046660 | Bacteria | 939 |
| 508 | Ga0495659_0104326 | 3300046664 | Bacteria | 1101 |
| 509 | Ga0495647_0001520 | 3300046681 | Bacteria | 7162 |
| 510 | Ga0495647_0044078 | 3300046681 | Bacteria | 1710 |
| 511 | Ga0495649_0006638 | 3300046694 | Bacteria | 7190 |
| 512 | Ga0495672_0027190 | 3300047320 | Bacteria | 3638 |
| 513 | Ga0495680_0104882 | 3300047322 | Bacteria | 2102 |
| 514 | Ga0495686_0141037 | 3300047472 | Bacteria | 1422 |
| 515 | Ga0495615_0030875 | 3300048090 | Bacteria | 1282 |
| 516 | Ga0496100_0076223 | 3300048903 | Bacteria | 2251 |
| 517 | Ga0496104_0044072 | 3300048907 | Bacteria | 4192 |
| 518 | Ga0496104_0395272 | 3300048907 | Bacteria | 1295 |
| 519 | Ga0496105_0000714 | 3300048908 | Bacteria | 22482 |
| 520 | Ga0496105_0360477 | 3300048908 | Bacteria | 1160 |
| 521 | Ga0496108_0058195 | 3300048911 | Bacteria | 3248 |
| 522 | Ga0496109_0052934 | 3300048912 | Bacteria | 3701 |
| 523 | Ga0496109_0346883 | 3300048912 | Bacteria | 1402 |
| 524 | Ga0496110_0079484 | 3300048913 | Bacteria | 2920 |
| 525 | Ga0496112_0132206 | 3300048915 | Bacteria | 2466 |
| 526 | Ga0496113_0039378 | 3300048916 | Bacteria | 3479 |
| 527 | Ga0496114_0017738 | 3300048917 | Bacteria | 5752 |
| 528 | Ga0496114_0186884 | 3300048917 | Bacteria | 1811 |
| 529 | Ga0496115_0011549 | 3300048918 | Bacteria | 6620 |
| 530 | Ga0496121_0010107 | 3300048924 | Bacteria | 10702 |
| 531 | Ga0501036_0033090 | 3300049572 | Bacteria | 4372 |
| 532 | Ga0501036_0305315 | 3300049572 | Bacteria | 1331 |
| 533 | Ga0501037_0057197 | 3300049573 | Bacteria | 2848 |
| 534 | Ga0501037_0402148 | 3300049573 | Bacteria | 939 |
| 535 | Ga0501038_0067011 | 3300049574 | Bacteria | 3055 |
| 536 | Ga0501038_0289698 | 3300049574 | Bacteria | 1287 |
| 537 | Ga0501039_0007266 | 3300049575 | Bacteria | 8438 |
| 538 | Ga0501039_0029119 | 3300049575 | Bacteria | 4253 |
| 539 | Ga0501039_0041474 | 3300049575 | Bacteria | 3555 |
| 540 | Ga0501040_0008032 | 3300049576 | Bacteria | 6854 |
| 541 | Ga0501040_0013250 | 3300049576 | Bacteria | 5422 |
| 542 | Ga0501041_0053200 | 3300049577 | Bacteria | 2469 |
| 543 | Ga0501041_0096510 | 3300049577 | Bacteria | 1827 |
| 544 | Ga0501041_0148002 | 3300049577 | Bacteria | 1465 |
| 545 | Ga0501042_0060549 | 3300049578 | Bacteria | 2704 |
| 546 | Ga0501042_0073896 | 3300049578 | Bacteria | 2439 |
| 547 | Ga0501042_0126208 | 3300049578 | Bacteria | 1843 |
| 548 | Ga0501042_0126968 | 3300049578 | Bacteria | 1837 |
| 549 | Ga0501042_0206754 | 3300049578 | Bacteria | 1415 |
| 550 | Ga0501046_0348008 | 3300049580 | Bacteria | 1076 |
| 551 | Ga0501046_0594327 | 3300049580 | Bacteria | 786 |
| 552 | Ga0501047_0162605 | 3300049581 | Bacteria | 2104 |
| 553 | Ga0501048_0001704 | 3300049582 | Bacteria | 16763 |
| 554 | Ga0501048_0117355 | 3300049582 | Bacteria | 1880 |
| 555 | Ga0501048_0122853 | 3300049582 | Bacteria | 1835 |
| 556 | Ga0501067_0003850 | 3300049583 | Bacteria | 8287 |
| 557 | Ga0501068_0008035 | 3300049584 | Bacteria | 5850 |
| 558 | Ga0501071_0030458 | 3300049587 | Bacteria | 3817 |
| 559 | Ga0501071_0050826 | 3300049587 | Bacteria | 2986 |
| 560 | Ga0501071_0066577 | 3300049587 | Bacteria | 2618 |
| 561 | Ga0501072_0000598 | 3300049588 | Bacteria | 26005 |
| 562 | Ga0501072_0007104 | 3300049588 | Bacteria | 8497 |
| 563 | Ga0501072_0103081 | 3300049588 | Bacteria | 2268 |
| 564 | Ga0501072_0165707 | 3300049588 | Bacteria | 1763 |
| 565 | Ga0501072_0472696 | 3300049588 | Bacteria | 992 |
| 566 | Ga0501073_0000567 | 3300049589 | Bacteria | 26062 |
| 567 | Ga0501073_0116930 | 3300049589 | Bacteria | 1848 |
| 568 | Ga0501073_0243290 | 3300049589 | Bacteria | 1242 |
| 569 | Ga0501075_0000499 | 3300049591 | Bacteria | 23531 |
| 570 | Ga0501075_0006057 | 3300049591 | Bacteria | 8296 |
| 571 | Ga0501075_0031316 | 3300049591 | Bacteria | 3947 |
| 572 | Ga0501075_0042693 | 3300049591 | Bacteria | 3400 |
| 573 | Ga0501075_0047461 | 3300049591 | Bacteria | 3227 |
| 574 | Ga0501075_0266732 | 3300049591 | Bacteria | 1305 |
| 575 | Ga0501076_0014690 | 3300049592 | Bacteria | 5903 |
| 576 | Ga0501076_0262353 | 3300049592 | Bacteria | 1414 |
| 577 | Ga0501076_0329513 | 3300049592 | Bacteria | 1252 |
| 578 | Ga0501076_0472553 | 3300049592 | Bacteria | 1033 |
| 579 | Ga0501077_0007565 | 3300049593 | Bacteria | 6703 |
| 580 | Ga0501077_0017655 | 3300049593 | Bacteria | 4506 |
| 581 | Ga0501077_0296747 | 3300049593 | Bacteria | 1029 |
| 582 | Ga0501079_0000225 | 3300049741 | Bacteria | 33701 |
| 583 | Ga0501079_0025899 | 3300049741 | Bacteria | 4499 |
| 584 | Ga0501079_0062714 | 3300049741 | Bacteria | 2867 |
| 585 | Ga0501079_0129787 | 3300049741 | Bacteria | 1961 |
| 586 | Ga0501079_0158952 | 3300049741 | Bacteria | 1761 |
| 587 | Ga0501079_0583072 | 3300049741 | Bacteria | 880 |
| 588 | Ga0501080_0004604 | 3300049742 | Bacteria | 12291 |
| 589 | Ga0501080_0035821 | 3300049742 | Bacteria | 4632 |
| 590 | Ga0501080_0058724 | 3300049742 | Bacteria | 3581 |
| 591 | Ga0501080_0127488 | 3300049742 | Bacteria | 2356 |
| 592 | Ga0501081_0001700 | 3300049743 | Bacteria | 13649 |
| 593 | Ga0501081_0027392 | 3300049743 | Bacteria | 3845 |
| 594 | Ga0501081_0029850 | 3300049743 | Bacteria | 3686 |
| 595 | Ga0501081_0069355 | 3300049743 | Bacteria | 2456 |
| 596 | Ga0501083_0200083 | 3300049744 | Bacteria | 1303 |
| 597 | Ga0501083_0267217 | 3300049744 | Bacteria | 1113 |
| 598 | Ga0501035_0029886 | 3300049822 | Bacteria | 4969 |
| 599 | Ga0501035_0244502 | 3300049822 | Bacteria | 1525 |
| 600 | Ga0501045_0024714 | 3300049824 | Bacteria | 4314 |
| 601 | Ga0501045_0028931 | 3300049824 | Bacteria | 4000 |
| 602 | Ga0501045_0036634 | 3300049824 | Bacteria | 3563 |
| 603 | nmdc:mga05p37_8696_c1 | 3300050507 | Bacteria | 11997 |
| 604 | nmdc:mga0qj67_8382_c1 | 3300050509 | Bacteria | 7664 |
| 605 | nmdc:mga0qj67_96736_c1 | 3300050509 | Bacteria | 2377 |
| 606 | nmdc:mga06r32_14131_c1 | 3300050510 | Bacteria | 7241 |
| 607 | nmdc:mga06r32_31753_c1 | 3300050510 | Bacteria | 4963 |
| 608 | nmdc:mga08y16_16105_c1 | 3300050511 | Bacteria | 7863 |
| 609 | nmdc:mga08y16_377577_c1 | 3300050511 | Bacteria | 1453 |
| 610 | nmdc:mga0n895_450208_c1 | 3300050512 | Bacteria | 1300 |
| 611 | nmdc:mga0n895_60682_c1 | 3300050512 | Bacteria | 3732 |
| 612 | nmdc:mga0rr50_85913_c1 | 3300050513 | Bacteria | 2439 |
| 613 | nmdc:mga0a205_9400_c1 | 3300050515 | Bacteria | 8935 |
| 614 | Ga0495601_0053948 | 3300053077 | Bacteria | 2542 |
| 615 | Ga0500652_008335 | 3300053131 | Bacteria | 3449 |
| 616 | Ga0500658_0034955 | 3300053134 | Bacteria | 1987 |
| 617 | Ga0500616_0034541 | 3300053153 | Bacteria | 2754 |
| 618 | Ga0500616_0139332 | 3300053153 | Bacteria | 1136 |
| 619 | Ga0500637_0000552 | 3300053178 | Bacteria | 14665 |
| 620 | Ga0501084_0001080 | 3300054114 | Bacteria | 21231 |
| 621 | Ga0501084_0244853 | 3300054114 | Bacteria | 1513 |
| 622 | Ga0501082_0001398 | 3300060353 | Bacteria | 21254 |
| 623 | Ga0501082_0009770 | 3300060353 | Bacteria | 8264 |
| 624 | Ga0501082_0035083 | 3300060353 | Bacteria | 4323 |
| 625 | Ga0501082_0099965 | 3300060353 | Bacteria | 2508 |
| 626 | Ga0501082_0142641 | 3300060353 | Bacteria | 2079 |
| 627 | Ga0530510_0007188 | 3300061734 | Bacteria | 7748 |
| 628 | Ga0530510_0027223 | 3300061734 | Bacteria | 4097 |
| 629 | Ga0530510_0061263 | 3300061734 | Bacteria | 2724 |
| 630 | Ga0530510_0186046 | 3300061734 | Bacteria | 1541 |
| 631 | Ga0530510_0258970 | 3300061734 | Bacteria | 1297 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_100076899 | Ga0070682_1000768993 | 225 |
| 2 | 3300005354 | Ga0070675_100008341 | Ga0070675_1000083415 | 225 |
| 3 | 3300009094 | Ga0111539_10546423 | Ga0111539_105464232 | 225 |
| 4 | 3300031903 | Ga0307407_10348559 | Ga0307407_103485592 | 225 |
| 5 | 3300046615 | Ga0495656_0040102 | Ga0495656_0040102_97_798 | 225 |
| 6 | 3300048090 | Ga0495615_0030875 | Ga0495615_0030875_347_1048 | 225 |
| 7 | 3300005355 | Ga0070671_100665646 | Ga0070671_1006656461 | 227 |
| 8 | 3300005456 | Ga0070678_100491796 | Ga0070678_1004917962 | 227 |
| 9 | 3300005548 | Ga0070665_100006360 | Ga0070665_10000636010 | 227 |
| 10 | 3300025942 | Ga0207689_10101721 | Ga0207689_101017212 | 227 |
| 11 | 3300028379 | Ga0268266_10005164 | Ga0268266_100051643 | 227 |
| 12 | 3300031731 | Ga0307405_10121336 | Ga0307405_101213362 | 227 |
| 13 | 3300031824 | Ga0307413_10014541 | Ga0307413_100145412 | 227 |
| 14 | 3300031901 | Ga0307406_10381964 | Ga0307406_103819642 | 227 |
| 15 | 3300031995 | Ga0307409_100049418 | Ga0307409_1000494184 | 227 |
| 16 | 3300032005 | Ga0307411_10001335 | Ga0307411_100013355 | 227 |
| 17 | 3300005459 | Ga0068867_100020743 | Ga0068867_1000207433 | 229 |
| 18 | 3300005563 | Ga0068855_100016755 | Ga0068855_1000167557 | 229 |
| 19 | 3300005564 | Ga0070664_100180879 | Ga0070664_1001808792 | 229 |
| 20 | 3300005840 | Ga0068870_10082443 | Ga0068870_100824432 | 229 |
| 21 | 3300005844 | Ga0068862_100008962 | Ga0068862_1000089625 | 229 |
| 22 | 3300006846 | Ga0075430_100266004 | Ga0075430_1002660042 | 229 |
| 23 | 3300006847 | Ga0075431_100000318 | Ga0075431_1000003185 | 229 |
| 24 | 3300009093 | Ga0105240_10010627 | Ga0105240_100106277 | 229 |
| 25 | 3300009094 | Ga0111539_10023643 | Ga0111539_100236434 | 229 |
| 26 | 3300009094 | Ga0111539_10640436 | Ga0111539_106404363 | 229 |
| 27 | 3300009147 | Ga0114129_10047662 | Ga0114129_100476625 | 229 |
| 28 | 3300009147 | Ga0114129_10727062 | Ga0114129_107270622 | 229 |
| 29 | 3300009551 | Ga0105238_10109519 | Ga0105238_101095193 | 229 |
| 30 | 3300009553 | Ga0105249_10155934 | Ga0105249_101559342 | 229 |
| 31 | 3300013104 | Ga0157370_10234748 | Ga0157370_102347482 | 229 |
| 32 | 3300013105 | Ga0157369_10047434 | Ga0157369_100474344 | 229 |
| 33 | 3300013307 | Ga0157372_10151956 | Ga0157372_101519563 | 229 |
| 34 | 3300014326 | Ga0157380_10023810 | Ga0157380_100238102 | 229 |
| 35 | 3300014326 | Ga0157380_10094297 | Ga0157380_100942973 | 229 |
| 36 | 3300025908 | Ga0207643_10088849 | Ga0207643_100888492 | 229 |
| 37 | 3300025912 | Ga0207707_10004072 | Ga0207707_100040724 | 229 |
| 38 | 3300025912 | Ga0207707_10008989 | Ga0207707_100089892 | 229 |
| 39 | 3300025913 | Ga0207695_10009041 | Ga0207695_1000904112 | 229 |
| 40 | 3300025917 | Ga0207660_10013421 | Ga0207660_100134213 | 229 |
| 41 | 3300025917 | Ga0207660_10127806 | Ga0207660_101278062 | 229 |
| 42 | 3300025917 | Ga0207660_10595125 | Ga0207660_105951251 | 229 |
| 43 | 3300025921 | Ga0207652_10001982 | Ga0207652_100019824 | 229 |
| 44 | 3300025921 | Ga0207652_10065733 | Ga0207652_100657333 | 229 |
| 45 | 3300025945 | Ga0207679_10133114 | Ga0207679_101331142 | 229 |
| 46 | 3300025949 | Ga0207667_10000859 | Ga0207667_1000085918 | 229 |
| 47 | 3300025949 | Ga0207667_10030874 | Ga0207667_100308745 | 229 |
| 48 | 3300026075 | Ga0207708_10009104 | Ga0207708_100091046 | 229 |
| 49 | 3300030878 | Ga0265770_1000679 | Ga0265770_10006795 | 229 |
| 50 | 3300031691 | Ga0316579_10138386 | Ga0316579_101383862 | 229 |
| 51 | 3300031995 | Ga0307409_100214998 | Ga0307409_1002149983 | 229 |
| 52 | 3300032168 | Ga0316593_10008462 | Ga0316593_100084623 | 229 |
| 53 | 3300035398 | Ga0316574_0140099 | Ga0316574_0140099_379_1074 | 229 |
| 54 | 3300035724 | Ga0373933_0109635 | Ga0373933_0109635_104_796 | 229 |
| 55 | 3300036712 | Ga0316584_0020680 | Ga0316584_0020680_1693_2388 | 229 |
| 56 | 3300038726 | Ga0400490_56804 | Ga0400490_56804_8664_9371 | 229 |
| 57 | 3300038727 | Ga0400491_15621 | Ga0400491_15621_1429_2136 | 229 |
| 58 | 3300038742 | Ga0400486_24254 | Ga0400486_24254_530_1237 | 229 |
| 59 | 3300039093 | Ga0400489_95956 | Ga0400489_95956_574_1281 | 229 |
| 60 | 3300046642 | Ga0495634_0382260 | Ga0495634_0382260_89_793 | 229 |
| 61 | 3300046681 | Ga0495647_0044078 | Ga0495647_0044078_29_727 | 229 |
| 62 | 3300010159 | Ga0099796_10000041 | Ga0099796_100000415 | 232 |
| 63 | 3300045051 | Ga0451576_0046301 | Ga0451576_0046301_331_1032 | 233 |
| 64 | 3300049572 | Ga0501036_0033090 | Ga0501036_0033090_525_1226 | 233 |
| 65 | 3300049572 | Ga0501036_0305315 | Ga0501036_0305315_466_1167 | 233 |
| 66 | 3300049575 | Ga0501039_0029119 | Ga0501039_0029119_1940_2641 | 233 |
| 67 | 3300049576 | Ga0501040_0008032 | Ga0501040_0008032_3632_4333 | 233 |
| 68 | 3300049577 | Ga0501041_0096510 | Ga0501041_0096510_614_1315 | 233 |
| 69 | 3300049582 | Ga0501048_0117355 | Ga0501048_0117355_185_886 | 233 |
| 70 | 3300049587 | Ga0501071_0050826 | Ga0501071_0050826_898_1599 | 233 |
| 71 | 3300049587 | Ga0501071_0066577 | Ga0501071_0066577_611_1312 | 233 |
| 72 | 3300049588 | Ga0501072_0007104 | Ga0501072_0007104_6496_7197 | 233 |
| 73 | 3300049588 | Ga0501072_0103081 | Ga0501072_0103081_1392_2093 | 233 |
| 74 | 3300049588 | Ga0501072_0165707 | Ga0501072_0165707_1026_1727 | 233 |
| 75 | 3300049589 | Ga0501073_0243290 | Ga0501073_0243290_514_1215 | 233 |
| 76 | 3300049591 | Ga0501075_0042693 | Ga0501075_0042693_172_873 | 233 |
| 77 | 3300049591 | Ga0501075_0047461 | Ga0501075_0047461_979_1680 | 233 |
| 78 | 3300049592 | Ga0501076_0262353 | Ga0501076_0262353_602_1303 | 233 |
| 79 | 3300049592 | Ga0501076_0472553 | Ga0501076_0472553_287_988 | 233 |
| 80 | 3300049593 | Ga0501077_0296747 | Ga0501077_0296747_182_883 | 233 |
| 81 | 3300049741 | Ga0501079_0062714 | Ga0501079_0062714_318_1019 | 233 |
| 82 | 3300049741 | Ga0501079_0158952 | Ga0501079_0158952_410_1111 | 233 |
| 83 | 3300049742 | Ga0501080_0127488 | Ga0501080_0127488_321_1022 | 233 |
| 84 | 3300049743 | Ga0501081_0069355 | Ga0501081_0069355_1406_2107 | 233 |
| 85 | 3300049822 | Ga0501035_0244502 | Ga0501035_0244502_228_929 | 233 |
| 86 | 3300053178 | Ga0500637_0000552 | Ga0500637_0000552_376_1077 | 233 |
| 87 | 3300054114 | Ga0501084_0244853 | Ga0501084_0244853_651_1352 | 233 |
| 88 | 3300060353 | Ga0501082_0099965 | Ga0501082_0099965_642_1343 | 233 |
| 89 | 3300061734 | Ga0530510_0061263 | Ga0530510_0061263_633_1334 | 233 |
| 90 | 3300061734 | Ga0530510_0186046 | Ga0530510_0186046_83_784 | 233 |
| 91 | 3300005328 | Ga0070676_10212112 | Ga0070676_102121122 | 234 |
| 92 | 3300005364 | Ga0070673_100009396 | Ga0070673_1000093965 | 234 |
| 93 | 3300031456 | Ga0307513_10464445 | Ga0307513_104644451 | 234 |
| 94 | 3300031824 | Ga0307413_10171043 | Ga0307413_101710432 | 234 |
| 95 | 3300031852 | Ga0307410_10368400 | Ga0307410_103684002 | 234 |
| 96 | 3300005331 | Ga0070670_100258838 | Ga0070670_1002588382 | 236 |
| 97 | 3300005340 | Ga0070689_100312810 | Ga0070689_1003128102 | 236 |
| 98 | 3300005365 | Ga0070688_100219988 | Ga0070688_1002199882 | 236 |
| 99 | 3300005544 | Ga0070686_100042530 | Ga0070686_1000425302 | 236 |
| 100 | 3300005842 | Ga0068858_100752229 | Ga0068858_1007522292 | 236 |
| 101 | 3300025933 | Ga0207706_10174679 | Ga0207706_101746792 | 236 |
| 102 | 3300026035 | Ga0207703_10157555 | Ga0207703_101575552 | 236 |
| 103 | 3300005295 | Ga0065707_10085402 | Ga0065707_100854024 | 237 |
| 104 | 3300005367 | Ga0070667_100548850 | Ga0070667_1005488502 | 237 |
| 105 | 3300009093 | Ga0105240_10054925 | Ga0105240_100549253 | 237 |
| 106 | 3300025949 | Ga0207667_10008918 | Ga0207667_100089185 | 237 |
| 107 | 3300036647 | Ga0316582_0248873 | Ga0316582_0248873_315_1100 | 237 |
| 108 | 3300041453 | Ga0451797_1154171 | Ga0451797_1154171_131_847 | 237 |
| 109 | 3300047320 | Ga0495672_0027190 | Ga0495672_0027190_476_1189 | 237 |
| 110 | 3300048924 | Ga0496121_0010107 | Ga0496121_0010107_6756_7472 | 237 |
| 111 | 3300049580 | Ga0501046_0348008 | Ga0501046_0348008_12_725 | 237 |
| 112 | 3300049580 | Ga0501046_0594327 | Ga0501046_0594327_18_731 | 237 |
| 113 | 3300049581 | Ga0501047_0162605 | Ga0501047_0162605_229_942 | 237 |
| 114 | 3300050509 | nmdc:mga0qj67_96736_c1 | nmdc:mga0qj67_96736_c1_1387_2103 | 237 |
| 115 | 3300005328 | Ga0070676_10001863 | Ga0070676_100018635 | 238 |
| 116 | 3300005435 | Ga0070714_100110702 | Ga0070714_1001107022 | 238 |
| 117 | 3300005548 | Ga0070665_100211971 | Ga0070665_1002119713 | 238 |
| 118 | 3300005548 | Ga0070665_100499298 | Ga0070665_1004992982 | 238 |
| 119 | 3300005719 | Ga0068861_100017281 | Ga0068861_1000172815 | 238 |
| 120 | 3300009094 | Ga0111539_10374914 | Ga0111539_103749142 | 238 |
| 121 | 3300009177 | Ga0105248_10334862 | Ga0105248_103348622 | 238 |
| 122 | 3300014326 | Ga0157380_10007906 | Ga0157380_100079063 | 238 |
| 123 | 3300014326 | Ga0157380_10291200 | Ga0157380_102912002 | 238 |
| 124 | 3300025929 | Ga0207664_10032053 | Ga0207664_100320533 | 238 |
| 125 | 3300025942 | Ga0207689_10302840 | Ga0207689_103028402 | 238 |
| 126 | 3300025981 | Ga0207640_10249731 | Ga0207640_102497312 | 238 |
| 127 | 3300026089 | Ga0207648_10164457 | Ga0207648_101644572 | 238 |
| 128 | 3300026089 | Ga0207648_10561261 | Ga0207648_105612612 | 238 |
| 129 | 3300026118 | Ga0207675_100023600 | Ga0207675_1000236004 | 238 |
| 130 | 3300028379 | Ga0268266_10050681 | Ga0268266_100506814 | 238 |
| 131 | 3300028573 | Ga0265334_10015782 | Ga0265334_100157822 | 238 |
| 132 | 3300028794 | Ga0307515_10131960 | Ga0307515_101319601 | 238 |
| 133 | 3300028800 | Ga0265338_10008550 | Ga0265338_100085505 | 238 |
| 134 | 3300031235 | Ga0265330_10047808 | Ga0265330_100478082 | 238 |
| 135 | 3300031595 | Ga0265313_10011088 | Ga0265313_100110883 | 238 |
| 136 | 3300031852 | Ga0307410_10011726 | Ga0307410_100117264 | 238 |
| 137 | 3300031901 | Ga0307406_10265474 | Ga0307406_102654742 | 238 |
| 138 | 3300031903 | Ga0307407_10032156 | Ga0307407_100321564 | 238 |
| 139 | 3300031995 | Ga0307409_100027912 | Ga0307409_1000279124 | 238 |
| 140 | 3300032005 | Ga0307411_10000427 | Ga0307411_100004273 | 238 |
| 141 | 3300041505 | Ga0451849_1496435 | Ga0451849_1496435_23_745 | 238 |
| 142 | 3300042156 | Ga0439446_0002211 | Ga0439446_0002211_2724_3443 | 238 |
| 143 | 3300042435 | Ga0439434_0037539 | Ga0439434_0037539_357_1076 | 238 |
| 144 | 3300042531 | Ga0450918_031512 | Ga0450918_031512_76_795 | 238 |
| 145 | 3300050511 | nmdc:mga08y16_377577_c1 | nmdc:mga08y16_377577_c1_146_889 | 238 |
| 146 | 3300053153 | Ga0500616_0034541 | Ga0500616_0034541_1336_2055 | 238 |
| 147 | 3300005436 | Ga0070713_100210102 | Ga0070713_1002101022 | 239 |
| 148 | 3300005439 | Ga0070711_100004271 | Ga0070711_1000042717 | 239 |
| 149 | 3300005458 | Ga0070681_10003522 | Ga0070681_1000352213 | 239 |
| 150 | 3300005458 | Ga0070681_10043647 | Ga0070681_100436473 | 239 |
| 151 | 3300005546 | Ga0070696_100000163 | Ga0070696_1000001632 | 239 |
| 152 | 3300007788 | Ga0099795_10000075 | Ga0099795_1000007512 | 239 |
| 153 | 3300009148 | Ga0105243_10556013 | Ga0105243_105560131 | 239 |
| 154 | 3300010159 | Ga0099796_10024361 | Ga0099796_100243613 | 239 |
| 155 | 3300025912 | Ga0207707_10006250 | Ga0207707_100062508 | 239 |
| 156 | 3300025912 | Ga0207707_10049560 | Ga0207707_100495603 | 239 |
| 157 | 3300025913 | Ga0207695_10055015 | Ga0207695_100550155 | 239 |
| 158 | 3300025916 | Ga0207663_10131190 | Ga0207663_101311902 | 239 |
| 159 | 3300025921 | Ga0207652_10221539 | Ga0207652_102215393 | 239 |
| 160 | 3300025944 | Ga0207661_10588714 | Ga0207661_105887142 | 239 |
| 161 | 3300026118 | Ga0207675_100310700 | Ga0207675_1003107002 | 239 |
| 162 | 3300027512 | Ga0209179_1001849 | Ga0209179_10018494 | 239 |
| 163 | 3300028016 | Ga0265354_1000572 | Ga0265354_10005722 | 239 |
| 164 | 3300028036 | Ga0265355_1006965 | Ga0265355_10069651 | 239 |
| 165 | 3300031090 | Ga0265760_10004101 | Ga0265760_100041015 | 239 |
| 166 | 3300031249 | Ga0265339_10072542 | Ga0265339_100725422 | 239 |
| 167 | 3300031595 | Ga0265313_10144393 | Ga0265313_101443931 | 239 |
| 168 | 3300035113 | Ga0373936_0071829 | Ga0373936_0071829_548_1279 | 239 |
| 169 | 3300035172 | Ga0373955_0125835 | Ga0373955_0125835_522_1253 | 239 |
| 170 | 3300035692 | Ga0373935_0215091 | Ga0373935_0215091_344_1075 | 239 |
| 171 | 3300048903 | Ga0496100_0076223 | Ga0496100_0076223_1221_1952 | 239 |
| 172 | 3300048908 | Ga0496105_0000714 | Ga0496105_0000714_7961_8692 | 239 |
| 173 | 3300048917 | Ga0496114_0017738 | Ga0496114_0017738_2057_2788 | 239 |
| 174 | 3300048918 | Ga0496115_0011549 | Ga0496115_0011549_3689_4420 | 239 |
| 175 | 3300005330 | Ga0070690_100027355 | Ga0070690_1000273554 | 240 |
| 176 | 3300005340 | Ga0070689_100022584 | Ga0070689_1000225842 | 240 |
| 177 | 3300005341 | Ga0070691_10195240 | Ga0070691_101952402 | 240 |
| 178 | 3300005365 | Ga0070688_100125584 | Ga0070688_1001255842 | 240 |
| 179 | 3300005438 | Ga0070701_10038359 | Ga0070701_100383593 | 240 |
| 180 | 3300005440 | Ga0070705_100032948 | Ga0070705_1000329482 | 240 |
| 181 | 3300005444 | Ga0070694_100068407 | Ga0070694_1000684072 | 240 |
| 182 | 3300005539 | Ga0068853_100390032 | Ga0068853_1003900322 | 240 |
| 183 | 3300005544 | Ga0070686_100015999 | Ga0070686_1000159992 | 240 |
| 184 | 3300005546 | Ga0070696_100198437 | Ga0070696_1001984372 | 240 |
| 185 | 3300005549 | Ga0070704_100096067 | Ga0070704_1000960672 | 240 |
| 186 | 3300005615 | Ga0070702_100011363 | Ga0070702_1000113633 | 240 |
| 187 | 3300005617 | Ga0068859_100281646 | Ga0068859_1002816462 | 240 |
| 188 | 3300005719 | Ga0068861_100033104 | Ga0068861_1000331042 | 240 |
| 189 | 3300005841 | Ga0068863_100433948 | Ga0068863_1004339482 | 240 |
| 190 | 3300005843 | Ga0068860_100142094 | Ga0068860_1001420943 | 240 |
| 191 | 3300006237 | Ga0097621_100350440 | Ga0097621_1003504402 | 240 |
| 192 | 3300006358 | Ga0068871_100008181 | Ga0068871_1000081817 | 240 |
| 193 | 3300006931 | Ga0097620_100281650 | Ga0097620_1002816502 | 240 |
| 194 | 3300014968 | Ga0157379_10833643 | Ga0157379_108336431 | 240 |
| 195 | 3300014969 | Ga0157376_10283152 | Ga0157376_102831522 | 240 |
| 196 | 3300017792 | Ga0163161_10385288 | Ga0163161_103852882 | 240 |
| 197 | 3300026041 | Ga0207639_10483660 | Ga0207639_104836602 | 240 |
| 198 | 3300026088 | Ga0207641_10408195 | Ga0207641_104081952 | 240 |
| 199 | 3300026118 | Ga0207675_100039298 | Ga0207675_1000392984 | 240 |
| 200 | 3300028381 | Ga0268264_10115597 | Ga0268264_101155972 | 240 |
| 201 | 3300028800 | Ga0265338_10045487 | Ga0265338_100454875 | 240 |
| 202 | 3300031240 | Ga0265320_10185802 | Ga0265320_101858022 | 240 |
| 203 | 3300031247 | Ga0265340_10007598 | Ga0265340_100075982 | 240 |
| 204 | 3300031247 | Ga0265340_10058181 | Ga0265340_100581812 | 240 |
| 205 | 3300048907 | Ga0496104_0395272 | Ga0496104_0395272_388_1134 | 240 |
| 206 | 3300049573 | Ga0501037_0402148 | Ga0501037_0402148_164_913 | 240 |
| 207 | 3300005719 | Ga0068861_100005236 | Ga0068861_1000052363 | 241 |
| 208 | 3300006846 | Ga0075430_100058924 | Ga0075430_1000589242 | 241 |
| 209 | 3300026118 | Ga0207675_100010328 | Ga0207675_1000103287 | 241 |
| 210 | 3300031616 | Ga0307508_10320885 | Ga0307508_103208851 | 241 |
| 211 | 3300031730 | Ga0307516_10000209 | Ga0307516_1000020942 | 241 |
| 212 | 3300035171 | Ga0373946_0082746 | Ga0373946_0082746_280_1017 | 241 |
| 213 | 3300036712 | Ga0316584_0109519 | Ga0316584_0109519_493_1233 | 241 |
| 214 | 3300046460 | Ga0495638_0010678 | Ga0495638_0010678_3499_4227 | 241 |
| 215 | 3300046523 | Ga0495644_0023198 | Ga0495644_0023198_1343_2074 | 241 |
| 216 | 3300046543 | Ga0495645_0164257 | Ga0495645_0164257_106_837 | 241 |
| 217 | 3300046558 | Ga0495633_0015655 | Ga0495633_0015655_2832_3563 | 241 |
| 218 | 3300046615 | Ga0495656_0081373 | Ga0495656_0081373_487_1218 | 241 |
| 219 | 3300046660 | Ga0495625_0003242 | Ga0495625_0003242_6509_7237 | 241 |
| 220 | 3300046681 | Ga0495647_0001520 | Ga0495647_0001520_1706_2437 | 241 |
| 221 | 3300005353 | Ga0070669_100060857 | Ga0070669_1000608571 | 242 |
| 222 | 3300005840 | Ga0068870_10026255 | Ga0068870_100262552 | 242 |
| 223 | 3300014326 | Ga0157380_10492781 | Ga0157380_104927812 | 242 |
| 224 | 3300025893 | Ga0207682_10015058 | Ga0207682_100150583 | 242 |
| 225 | 3300025906 | Ga0207699_10137464 | Ga0207699_101374642 | 242 |
| 226 | 3300025908 | Ga0207643_10032712 | Ga0207643_100327122 | 242 |
| 227 | 3300025923 | Ga0207681_10533130 | Ga0207681_105331302 | 242 |
| 228 | 3300025926 | Ga0207659_10111164 | Ga0207659_101111643 | 242 |
| 229 | 3300025937 | Ga0207669_10020431 | Ga0207669_100204313 | 242 |
| 230 | 3300025940 | Ga0207691_10098260 | Ga0207691_100982603 | 242 |
| 231 | 3300025960 | Ga0207651_10042234 | Ga0207651_100422344 | 242 |
| 232 | 3300025986 | Ga0207658_10080979 | Ga0207658_100809792 | 242 |
| 233 | 3300026075 | Ga0207708_10017361 | Ga0207708_100173615 | 242 |
| 234 | 3300026095 | Ga0207676_10038711 | Ga0207676_100387114 | 242 |
| 235 | 3300026118 | Ga0207675_100390053 | Ga0207675_1003900532 | 242 |
| 236 | 3300031665 | Ga0316575_10035455 | Ga0316575_100354552 | 242 |
| 237 | 3300035118 | Ga0373954_0023716 | Ga0373954_0023716_582_1325 | 242 |
| 238 | 3300035398 | Ga0316574_0309412 | Ga0316574_0309412_151_900 | 242 |
| 239 | 3300035724 | Ga0373933_0123745 | Ga0373933_0123745_782_1525 | 242 |
| 240 | 3300046460 | Ga0495638_0003871 | Ga0495638_0003871_8021_8788 | 242 |
| 241 | 3300046517 | Ga0495630_0083281 | Ga0495630_0083281_385_1140 | 242 |
| 242 | 3300046694 | Ga0495649_0006638 | Ga0495649_0006638_3150_3917 | 242 |
| 243 | 3300005353 | Ga0070669_100010367 | Ga0070669_1000103675 | 243 |
| 244 | 3300005356 | Ga0070674_100000687 | Ga0070674_10000068712 | 243 |
| 245 | 3300005439 | Ga0070711_100121670 | Ga0070711_1001216702 | 243 |
| 246 | 3300005457 | Ga0070662_100002548 | Ga0070662_1000025482 | 243 |
| 247 | 3300005543 | Ga0070672_100001677 | Ga0070672_1000016774 | 243 |
| 248 | 3300005545 | Ga0070695_100218703 | Ga0070695_1002187032 | 243 |
| 249 | 3300005718 | Ga0068866_10034628 | Ga0068866_100346284 | 243 |
| 250 | 3300005719 | Ga0068861_100003473 | Ga0068861_1000034739 | 243 |
| 251 | 3300006175 | Ga0070712_100321671 | Ga0070712_1003216712 | 243 |
| 252 | 3300006846 | Ga0075430_100543041 | Ga0075430_1005430411 | 243 |
| 253 | 3300006847 | Ga0075431_100138436 | Ga0075431_1001384362 | 243 |
| 254 | 3300006881 | Ga0068865_100005610 | Ga0068865_1000056102 | 243 |
| 255 | 3300025898 | Ga0207692_10290823 | Ga0207692_102908232 | 243 |
| 256 | 3300025899 | Ga0207642_10027689 | Ga0207642_100276892 | 243 |
| 257 | 3300025907 | Ga0207645_10000328 | Ga0207645_1000032814 | 243 |
| 258 | 3300025916 | Ga0207663_10048278 | Ga0207663_100482783 | 243 |
| 259 | 3300025923 | Ga0207681_10011754 | Ga0207681_100117543 | 243 |
| 260 | 3300025933 | Ga0207706_10000476 | Ga0207706_1000047630 | 243 |
| 261 | 3300025937 | Ga0207669_10062244 | Ga0207669_100622443 | 243 |
| 262 | 3300025938 | Ga0207704_10019354 | Ga0207704_100193544 | 243 |
| 263 | 3300025940 | Ga0207691_10013230 | Ga0207691_100132305 | 243 |
| 264 | 3300025961 | Ga0207712_10135957 | Ga0207712_101359572 | 243 |
| 265 | 3300026089 | Ga0207648_10000334 | Ga0207648_1000033444 | 243 |
| 266 | 3300026118 | Ga0207675_100000130 | Ga0207675_10000013013 | 243 |
| 267 | 3300027665 | Ga0209983_1009942 | Ga0209983_10099422 | 243 |
| 268 | 3300027682 | Ga0209971_1003982 | Ga0209971_10039824 | 243 |
| 269 | 3300027717 | Ga0209998_10000403 | Ga0209998_1000040312 | 243 |
| 270 | 3300028558 | Ga0265326_10012593 | Ga0265326_100125932 | 243 |
| 271 | 3300028563 | Ga0265319_1020919 | Ga0265319_10209193 | 243 |
| 272 | 3300028573 | Ga0265334_10000092 | Ga0265334_1000009219 | 243 |
| 273 | 3300028573 | Ga0265334_10016134 | Ga0265334_100161344 | 243 |
| 274 | 3300028577 | Ga0265318_10084899 | Ga0265318_100848992 | 243 |
| 275 | 3300028800 | Ga0265338_10015759 | Ga0265338_100157593 | 243 |
| 276 | 3300031238 | Ga0265332_10003170 | Ga0265332_100031702 | 243 |
| 277 | 3300031239 | Ga0265328_10018951 | Ga0265328_100189512 | 243 |
| 278 | 3300031240 | Ga0265320_10021292 | Ga0265320_100212924 | 243 |
| 279 | 3300031241 | Ga0265325_10026302 | Ga0265325_100263024 | 243 |
| 280 | 3300031247 | Ga0265340_10056382 | Ga0265340_100563822 | 243 |
| 281 | 3300031249 | Ga0265339_10011854 | Ga0265339_100118542 | 243 |
| 282 | 3300031250 | Ga0265331_10003689 | Ga0265331_100036892 | 243 |
| 283 | 3300031595 | Ga0265313_10000109 | Ga0265313_1000010917 | 243 |
| 284 | 3300031665 | Ga0316575_10054900 | Ga0316575_100549003 | 243 |
| 285 | 3300031711 | Ga0265314_10014543 | Ga0265314_100145433 | 243 |
| 286 | 3300031712 | Ga0265342_10014672 | Ga0265342_100146723 | 243 |
| 287 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_33123_33875 | 243 |
| 288 | 3300005295 | Ga0065707_10083272 | Ga0065707_100832727 | 244 |
| 289 | 3300005344 | Ga0070661_100140217 | Ga0070661_1001402172 | 244 |
| 290 | 3300005438 | Ga0070701_10056323 | Ga0070701_100563232 | 244 |
| 291 | 3300005441 | Ga0070700_100084892 | Ga0070700_1000848923 | 244 |
| 292 | 3300009092 | Ga0105250_10000005 | Ga0105250_10000005139 | 244 |
| 293 | 3300014968 | Ga0157379_10000311 | Ga0157379_1000031134 | 244 |
| 294 | 3300025711 | Ga0207696_1000470 | Ga0207696_100047021 | 244 |
| 295 | 3300025907 | Ga0207645_10238821 | Ga0207645_102388212 | 244 |
| 296 | 3300025920 | Ga0207649_10106185 | Ga0207649_101061852 | 244 |
| 297 | 3300025925 | Ga0207650_10062171 | Ga0207650_100621712 | 244 |
| 298 | 3300031731 | Ga0307405_10346776 | Ga0307405_103467762 | 244 |
| 299 | 3300031824 | Ga0307413_10045868 | Ga0307413_100458682 | 244 |
| 300 | 3300036401 | Ga0373937_0065893 | Ga0373937_0065893_2239_2985 | 244 |
| 301 | 3300041498 | Ga0451841_0568682 | Ga0451841_0568682_1229_1981 | 244 |
| 302 | 3300041512 | Ga0451853_1522387 | Ga0451853_1522387_1021_1773 | 244 |
| 303 | 3300046660 | Ga0495625_0347281 | Ga0495625_0347281_21_758 | 244 |
| 304 | 3300047472 | Ga0495686_0141037 | Ga0495686_0141037_384_1127 | 244 |
| 305 | 3300049574 | Ga0501038_0067011 | Ga0501038_0067011_831_1598 | 244 |
| 306 | 3300049575 | Ga0501039_0007266 | Ga0501039_0007266_6478_7245 | 244 |
| 307 | 3300049576 | Ga0501040_0013250 | Ga0501040_0013250_1797_2564 | 244 |
| 308 | 3300049577 | Ga0501041_0148002 | Ga0501041_0148002_552_1319 | 244 |
| 309 | 3300049578 | Ga0501042_0206754 | Ga0501042_0206754_147_914 | 244 |
| 310 | 3300049582 | Ga0501048_0001704 | Ga0501048_0001704_7720_8487 | 244 |
| 311 | 3300049584 | Ga0501068_0008035 | Ga0501068_0008035_3931_4698 | 244 |
| 312 | 3300049588 | Ga0501072_0000598 | Ga0501072_0000598_24057_24824 | 244 |
| 313 | 3300049591 | Ga0501075_0000499 | Ga0501075_0000499_21582_22349 | 244 |
| 314 | 3300049592 | Ga0501076_0014690 | Ga0501076_0014690_3000_3767 | 244 |
| 315 | 3300049592 | Ga0501076_0329513 | Ga0501076_0329513_124_867 | 244 |
| 316 | 3300049593 | Ga0501077_0017655 | Ga0501077_0017655_3007_3774 | 244 |
| 317 | 3300049741 | Ga0501079_0000225 | Ga0501079_0000225_8733_9500 | 244 |
| 318 | 3300049742 | Ga0501080_0004604 | Ga0501080_0004604_10793_11560 | 244 |
| 319 | 3300049743 | Ga0501081_0029850 | Ga0501081_0029850_1653_2420 | 244 |
| 320 | 3300049824 | Ga0501045_0024714 | Ga0501045_0024714_436_1179 | 244 |
| 321 | 3300054114 | Ga0501084_0001080 | Ga0501084_0001080_18613_19380 | 244 |
| 322 | 3300060353 | Ga0501082_0001398 | Ga0501082_0001398_17248_18015 | 244 |
| 323 | 3300061734 | Ga0530510_0007188 | Ga0530510_0007188_1182_1949 | 244 |
| 324 | 3300005617 | Ga0068859_100381571 | Ga0068859_1003815712 | 245 |
| 325 | 3300006844 | Ga0075428_100003524 | Ga0075428_10000352416 | 245 |
| 326 | 3300006881 | Ga0068865_100369982 | Ga0068865_1003699822 | 245 |
| 327 | 3300006931 | Ga0097620_100381570 | Ga0097620_1003815702 | 245 |
| 328 | 3300007076 | Ga0075435_100056574 | Ga0075435_1000565743 | 245 |
| 329 | 3300009094 | Ga0111539_10030953 | Ga0111539_100309534 | 245 |
| 330 | 3300009987 | Ga0105030_101632 | Ga0105030_1016323 | 245 |
| 331 | 3300013874 | Ga0157514_118433 | Ga0157514_1184332 | 245 |
| 332 | 3300014326 | Ga0157380_10001526 | Ga0157380_100015262 | 245 |
| 333 | 3300017792 | Ga0163161_10633028 | Ga0163161_106330281 | 245 |
| 334 | 3300025926 | Ga0207659_10064429 | Ga0207659_100644292 | 245 |
| 335 | 3300027907 | Ga0207428_10015902 | Ga0207428_100159024 | 245 |
| 336 | 3300031727 | Ga0316576_10059980 | Ga0316576_100599802 | 245 |
| 337 | 3300031728 | Ga0316578_10014130 | Ga0316578_100141304 | 245 |
| 338 | 3300031730 | Ga0307516_10283452 | Ga0307516_102834521 | 245 |
| 339 | 3300031731 | Ga0307405_10020726 | Ga0307405_100207262 | 245 |
| 340 | 3300031733 | Ga0316577_10057610 | Ga0316577_100576103 | 245 |
| 341 | 3300031852 | Ga0307410_10095215 | Ga0307410_100952153 | 245 |
| 342 | 3300031901 | Ga0307406_10297744 | Ga0307406_102977442 | 245 |
| 343 | 3300031903 | Ga0307407_10084000 | Ga0307407_100840002 | 245 |
| 344 | 3300031995 | Ga0307409_100250881 | Ga0307409_1002508811 | 245 |
| 345 | 3300032002 | Ga0307416_100743499 | Ga0307416_1007434992 | 245 |
| 346 | 3300032004 | Ga0307414_10023992 | Ga0307414_100239924 | 245 |
| 347 | 3300032005 | Ga0307411_10077324 | Ga0307411_100773242 | 245 |
| 348 | 3300032126 | Ga0307415_100021999 | Ga0307415_1000219994 | 245 |
| 349 | 3300035398 | Ga0316574_0159266 | Ga0316574_0159266_484_1233 | 245 |
| 350 | 3300036647 | Ga0316582_0043131 | Ga0316582_0043131_682_1449 | 245 |
| 351 | 3300036712 | Ga0316584_0001792 | Ga0316584_0001792_11445_12212 | 245 |
| 352 | 3300041999 | Ga0439433_0030933 | Ga0439433_0030933_414_1166 | 245 |
| 353 | 3300042003 | Ga0439443_000230 | Ga0439443_000230_1395_2147 | 245 |
| 354 | 3300042125 | Ga0450923_003145 | Ga0450923_003145_822_1574 | 245 |
| 355 | 3300042133 | Ga0450896_000315 | Ga0450896_000315_603_1355 | 245 |
| 356 | 3300042133 | Ga0450896_009501 | Ga0450896_009501_447_1199 | 245 |
| 357 | 3300042156 | Ga0439446_0007461 | Ga0439446_0007461_892_1644 | 245 |
| 358 | 3300042184 | Ga0450908_002638 | Ga0450908_002638_1289_2041 | 245 |
| 359 | 3300042436 | Ga0439435_0007606 | Ga0439435_0007606_622_1374 | 245 |
| 360 | 3300042531 | Ga0450918_003576 | Ga0450918_003576_1106_1858 | 245 |
| 361 | 3300046460 | Ga0495638_0078316 | Ga0495638_0078316_840_1580 | 245 |
| 362 | 3300046648 | Ga0495611_0097475 | Ga0495611_0097475_52_792 | 245 |
| 363 | 3300049573 | Ga0501037_0057197 | Ga0501037_0057197_1280_2032 | 245 |
| 364 | 3300049574 | Ga0501038_0289698 | Ga0501038_0289698_157_909 | 245 |
| 365 | 3300049575 | Ga0501039_0041474 | Ga0501039_0041474_2105_2857 | 245 |
| 366 | 3300049577 | Ga0501041_0053200 | Ga0501041_0053200_1645_2397 | 245 |
| 367 | 3300049578 | Ga0501042_0060549 | Ga0501042_0060549_1325_2077 | 245 |
| 368 | 3300049578 | Ga0501042_0073896 | Ga0501042_0073896_1211_1963 | 245 |
| 369 | 3300049578 | Ga0501042_0126968 | Ga0501042_0126968_994_1746 | 245 |
| 370 | 3300049582 | Ga0501048_0122853 | Ga0501048_0122853_16_768 | 245 |
| 371 | 3300049583 | Ga0501067_0003850 | Ga0501067_0003850_24_776 | 245 |
| 372 | 3300049588 | Ga0501072_0472696 | Ga0501072_0472696_16_768 | 245 |
| 373 | 3300049589 | Ga0501073_0000567 | Ga0501073_0000567_15941_16693 | 245 |
| 374 | 3300049589 | Ga0501073_0116930 | Ga0501073_0116930_693_1445 | 245 |
| 375 | 3300049591 | Ga0501075_0006057 | Ga0501075_0006057_6596_7348 | 245 |
| 376 | 3300049591 | Ga0501075_0031316 | Ga0501075_0031316_1723_2475 | 245 |
| 377 | 3300049591 | Ga0501075_0266732 | Ga0501075_0266732_400_1152 | 245 |
| 378 | 3300049593 | Ga0501077_0007565 | Ga0501077_0007565_3458_4210 | 245 |
| 379 | 3300049741 | Ga0501079_0025899 | Ga0501079_0025899_1965_2717 | 245 |
| 380 | 3300049741 | Ga0501079_0129787 | Ga0501079_0129787_678_1430 | 245 |
| 381 | 3300049742 | Ga0501080_0035821 | Ga0501080_0035821_2855_3607 | 245 |
| 382 | 3300049742 | Ga0501080_0058724 | Ga0501080_0058724_1491_2243 | 245 |
| 383 | 3300049743 | Ga0501081_0001700 | Ga0501081_0001700_3934_4686 | 245 |
| 384 | 3300049743 | Ga0501081_0027392 | Ga0501081_0027392_500_1252 | 245 |
| 385 | 3300049744 | Ga0501083_0200083 | Ga0501083_0200083_347_1099 | 245 |
| 386 | 3300049822 | Ga0501035_0029886 | Ga0501035_0029886_2873_3625 | 245 |
| 387 | 3300049824 | Ga0501045_0028931 | Ga0501045_0028931_1061_1813 | 245 |
| 388 | 3300050511 | nmdc:mga08y16_16105_c1 | nmdc:mga08y16_16105_c1_6386_7138 | 245 |
| 389 | 3300050512 | nmdc:mga0n895_60682_c1 | nmdc:mga0n895_60682_c1_1397_2149 | 245 |
| 390 | 3300050513 | nmdc:mga0rr50_85913_c1 | nmdc:mga0rr50_85913_c1_793_1545 | 245 |
| 391 | 3300050515 | nmdc:mga0a205_9400_c1 | nmdc:mga0a205_9400_c1_4483_5235 | 245 |
| 392 | 3300053131 | Ga0500652_008335 | Ga0500652_008335_1384_2133 | 245 |
| 393 | 3300053134 | Ga0500658_0034955 | Ga0500658_0034955_642_1391 | 245 |
| 394 | 3300053153 | Ga0500616_0139332 | Ga0500616_0139332_365_1114 | 245 |
| 395 | 3300060353 | Ga0501082_0009770 | Ga0501082_0009770_6190_6942 | 245 |
| 396 | 3300060353 | Ga0501082_0035083 | Ga0501082_0035083_2645_3397 | 245 |
| 397 | 3300060353 | Ga0501082_0142641 | Ga0501082_0142641_1283_2035 | 245 |
| 398 | 3300061734 | Ga0530510_0027223 | Ga0530510_0027223_2297_3049 | 245 |
| 399 | 3300061734 | Ga0530510_0258970 | Ga0530510_0258970_147_899 | 245 |
| 400 | 3300005293 | Ga0065715_10117779 | Ga0065715_101177792 | 246 |
| 401 | 3300005329 | Ga0070683_100347404 | Ga0070683_1003474041 | 246 |
| 402 | 3300005330 | Ga0070690_100001101 | Ga0070690_10000110112 | 246 |
| 403 | 3300005330 | Ga0070690_100140187 | Ga0070690_1001401872 | 246 |
| 404 | 3300005331 | Ga0070670_100003676 | Ga0070670_1000036767 | 246 |
| 405 | 3300005331 | Ga0070670_100060245 | Ga0070670_1000602453 | 246 |
| 406 | 3300005331 | Ga0070670_100344443 | Ga0070670_1003444431 | 246 |
| 407 | 3300005333 | Ga0070677_10027683 | Ga0070677_100276832 | 246 |
| 408 | 3300005335 | Ga0070666_10181299 | Ga0070666_101812992 | 246 |
| 409 | 3300005336 | Ga0070680_100049944 | Ga0070680_1000499442 | 246 |
| 410 | 3300005337 | Ga0070682_100128779 | Ga0070682_1001287792 | 246 |
| 411 | 3300005340 | Ga0070689_100003117 | Ga0070689_1000031177 | 246 |
| 412 | 3300005340 | Ga0070689_100014601 | Ga0070689_1000146016 | 246 |
| 413 | 3300005340 | Ga0070689_100240999 | Ga0070689_1002409992 | 246 |
| 414 | 3300005343 | Ga0070687_100002410 | Ga0070687_1000024105 | 246 |
| 415 | 3300005347 | Ga0070668_100011367 | Ga0070668_1000113672 | 246 |
| 416 | 3300005353 | Ga0070669_100176074 | Ga0070669_1001760743 | 246 |
| 417 | 3300005354 | Ga0070675_100002544 | Ga0070675_10000254413 | 246 |
| 418 | 3300005354 | Ga0070675_100203523 | Ga0070675_1002035232 | 246 |
| 419 | 3300005355 | Ga0070671_100061485 | Ga0070671_1000614853 | 246 |
| 420 | 3300005356 | Ga0070674_100072370 | Ga0070674_1000723701 | 246 |
| 421 | 3300005356 | Ga0070674_100268553 | Ga0070674_1002685531 | 246 |
| 422 | 3300005364 | Ga0070673_100016833 | Ga0070673_1000168334 | 246 |
| 423 | 3300005364 | Ga0070673_100039789 | Ga0070673_1000397894 | 246 |
| 424 | 3300005365 | Ga0070688_100244949 | Ga0070688_1002449492 | 246 |
| 425 | 3300005367 | Ga0070667_100022124 | Ga0070667_1000221242 | 246 |
| 426 | 3300005367 | Ga0070667_100043527 | Ga0070667_1000435273 | 246 |
| 427 | 3300005439 | Ga0070711_100121996 | Ga0070711_1001219962 | 246 |
| 428 | 3300005440 | Ga0070705_100002488 | Ga0070705_1000024887 | 246 |
| 429 | 3300005441 | Ga0070700_100149940 | Ga0070700_1001499403 | 246 |
| 430 | 3300005444 | Ga0070694_100047554 | Ga0070694_1000475542 | 246 |
| 431 | 3300005444 | Ga0070694_100148749 | Ga0070694_1001487491 | 246 |
| 432 | 3300005456 | Ga0070678_100047671 | Ga0070678_1000476712 | 246 |
| 433 | 3300005456 | Ga0070678_100491858 | Ga0070678_1004918582 | 246 |
| 434 | 3300005457 | Ga0070662_100023946 | Ga0070662_1000239463 | 246 |
| 435 | 3300005457 | Ga0070662_100100118 | Ga0070662_1001001183 | 246 |
| 436 | 3300005458 | Ga0070681_10023343 | Ga0070681_100233434 | 246 |
| 437 | 3300005458 | Ga0070681_10235398 | Ga0070681_102353982 | 246 |
| 438 | 3300005459 | Ga0068867_100010102 | Ga0068867_1000101024 | 246 |
| 439 | 3300005466 | Ga0070685_10017277 | Ga0070685_100172772 | 246 |
| 440 | 3300005466 | Ga0070685_10029825 | Ga0070685_100298253 | 246 |
| 441 | 3300005530 | Ga0070679_100006962 | Ga0070679_1000069627 | 246 |
| 442 | 3300005530 | Ga0070679_100588829 | Ga0070679_1005888292 | 246 |
| 443 | 3300005530 | Ga0070679_100747898 | Ga0070679_1007478981 | 246 |
| 444 | 3300005535 | Ga0070684_100015392 | Ga0070684_1000153924 | 246 |
| 445 | 3300005535 | Ga0070684_100104912 | Ga0070684_1001049122 | 246 |
| 446 | 3300005543 | Ga0070672_100021856 | Ga0070672_1000218565 | 246 |
| 447 | 3300005543 | Ga0070672_100183081 | Ga0070672_1001830812 | 246 |
| 448 | 3300005543 | Ga0070672_100487604 | Ga0070672_1004876041 | 246 |
| 449 | 3300005544 | Ga0070686_100003731 | Ga0070686_1000037314 | 246 |
| 450 | 3300005544 | Ga0070686_100052475 | Ga0070686_1000524752 | 246 |
| 451 | 3300005545 | Ga0070695_100190601 | Ga0070695_1001906012 | 246 |
| 452 | 3300005548 | Ga0070665_100040029 | Ga0070665_1000400293 | 246 |
| 453 | 3300005563 | Ga0068855_100003333 | Ga0068855_1000033337 | 246 |
| 454 | 3300005563 | Ga0068855_101097448 | Ga0068855_1010974481 | 246 |
| 455 | 3300005564 | Ga0070664_100005455 | Ga0070664_1000054555 | 246 |
| 456 | 3300005564 | Ga0070664_100039620 | Ga0070664_1000396204 | 246 |
| 457 | 3300005577 | Ga0068857_100233738 | Ga0068857_1002337382 | 246 |
| 458 | 3300005614 | Ga0068856_100108153 | Ga0068856_1001081533 | 246 |
| 459 | 3300005617 | Ga0068859_100011511 | Ga0068859_1000115117 | 246 |
| 460 | 3300005617 | Ga0068859_100021941 | Ga0068859_1000219417 | 246 |
| 461 | 3300005618 | Ga0068864_100002045 | Ga0068864_1000020455 | 246 |
| 462 | 3300005618 | Ga0068864_100002439 | Ga0068864_1000024394 | 246 |
| 463 | 3300005618 | Ga0068864_100180420 | Ga0068864_1001804202 | 246 |
| 464 | 3300005718 | Ga0068866_10038460 | Ga0068866_100384602 | 246 |
| 465 | 3300005719 | Ga0068861_100008857 | Ga0068861_1000088575 | 246 |
| 466 | 3300005719 | Ga0068861_100033975 | Ga0068861_1000339753 | 246 |
| 467 | 3300005719 | Ga0068861_100371092 | Ga0068861_1003710922 | 246 |
| 468 | 3300005840 | Ga0068870_10002942 | Ga0068870_100029423 | 246 |
| 469 | 3300005841 | Ga0068863_100002890 | Ga0068863_1000028905 | 246 |
| 470 | 3300005841 | Ga0068863_100004762 | Ga0068863_10000476212 | 246 |
| 471 | 3300005842 | Ga0068858_100012146 | Ga0068858_1000121467 | 246 |
| 472 | 3300005842 | Ga0068858_100019368 | Ga0068858_1000193683 | 246 |
| 473 | 3300005843 | Ga0068860_100093912 | Ga0068860_1000939122 | 246 |
| 474 | 3300005844 | Ga0068862_100001400 | Ga0068862_10000140018 | 246 |
| 475 | 3300005844 | Ga0068862_100002538 | Ga0068862_1000025383 | 246 |
| 476 | 3300005844 | Ga0068862_100050879 | Ga0068862_1000508796 | 246 |
| 477 | 3300005844 | Ga0068862_100119052 | Ga0068862_1001190522 | 246 |
| 478 | 3300006237 | Ga0097621_100011072 | Ga0097621_1000110725 | 246 |
| 479 | 3300006237 | Ga0097621_100041180 | Ga0097621_1000411805 | 246 |
| 480 | 3300006358 | Ga0068871_100227687 | Ga0068871_1002276872 | 246 |
| 481 | 3300006358 | Ga0068871_100247607 | Ga0068871_1002476072 | 246 |
| 482 | 3300006844 | Ga0075428_100010558 | Ga0075428_1000105588 | 246 |
| 483 | 3300006844 | Ga0075428_100057971 | Ga0075428_1000579714 | 246 |
| 484 | 3300006844 | Ga0075428_100223805 | Ga0075428_1002238052 | 246 |
| 485 | 3300006846 | Ga0075430_100004165 | Ga0075430_1000041658 | 246 |
| 486 | 3300006846 | Ga0075430_100129044 | Ga0075430_1001290443 | 246 |
| 487 | 3300006846 | Ga0075430_100188277 | Ga0075430_1001882772 | 246 |
| 488 | 3300006847 | Ga0075431_100006075 | Ga0075431_1000060758 | 246 |
| 489 | 3300006847 | Ga0075431_100019257 | Ga0075431_1000192574 | 246 |
| 490 | 3300006847 | Ga0075431_100081593 | Ga0075431_1000815933 | 246 |
| 491 | 3300006871 | Ga0075434_100270477 | Ga0075434_1002704773 | 246 |
| 492 | 3300006880 | Ga0075429_100001918 | Ga0075429_10000191812 | 246 |
| 493 | 3300006931 | Ga0097620_100011511 | Ga0097620_1000115117 | 246 |
| 494 | 3300006931 | Ga0097620_100021941 | Ga0097620_1000219417 | 246 |
| 495 | 3300009093 | Ga0105240_10000096 | Ga0105240_10000096118 | 246 |
| 496 | 3300009094 | Ga0111539_10093018 | Ga0111539_100930183 | 246 |
| 497 | 3300009094 | Ga0111539_10122978 | Ga0111539_101229783 | 246 |
| 498 | 3300009098 | Ga0105245_10009466 | Ga0105245_100094663 | 246 |
| 499 | 3300009101 | Ga0105247_10024700 | Ga0105247_100247004 | 246 |
| 500 | 3300009101 | Ga0105247_10152924 | Ga0105247_101529241 | 246 |
| 501 | 3300009147 | Ga0114129_10022191 | Ga0114129_100221915 | 246 |
| 502 | 3300009148 | Ga0105243_10223885 | Ga0105243_102238852 | 246 |
| 503 | 3300009174 | Ga0105241_10428336 | Ga0105241_104283362 | 246 |
| 504 | 3300009177 | Ga0105248_10000927 | Ga0105248_1000092718 | 246 |
| 505 | 3300009177 | Ga0105248_10002211 | Ga0105248_1000221112 | 246 |
| 506 | 3300009553 | Ga0105249_10042397 | Ga0105249_100423974 | 246 |
| 507 | 3300009553 | Ga0105249_10223321 | Ga0105249_102233213 | 246 |
| 508 | 3300011119 | Ga0105246_10256532 | Ga0105246_102565322 | 246 |
| 509 | 3300013296 | Ga0157374_10002219 | Ga0157374_100022199 | 246 |
| 510 | 3300013296 | Ga0157374_10804867 | Ga0157374_108048672 | 246 |
| 511 | 3300013306 | Ga0163162_10005133 | Ga0163162_100051332 | 246 |
| 512 | 3300013306 | Ga0163162_10125957 | Ga0163162_101259572 | 246 |
| 513 | 3300013308 | Ga0157375_10029153 | Ga0157375_100291534 | 246 |
| 514 | 3300014325 | Ga0163163_10021084 | Ga0163163_100210843 | 246 |
| 515 | 3300014325 | Ga0163163_10035034 | Ga0163163_100350344 | 246 |
| 516 | 3300014745 | Ga0157377_10008214 | Ga0157377_100082144 | 246 |
| 517 | 3300014745 | Ga0157377_10392112 | Ga0157377_103921122 | 246 |
| 518 | 3300014968 | Ga0157379_10016987 | Ga0157379_100169872 | 246 |
| 519 | 3300014968 | Ga0157379_10208717 | Ga0157379_102087172 | 246 |
| 520 | 3300014968 | Ga0157379_10216275 | Ga0157379_102162753 | 246 |
| 521 | 3300014969 | Ga0157376_10292418 | Ga0157376_102924182 | 246 |
| 522 | 3300025893 | Ga0207682_10159148 | Ga0207682_101591481 | 246 |
| 523 | 3300025901 | Ga0207688_10124247 | Ga0207688_101242472 | 246 |
| 524 | 3300025907 | Ga0207645_10017215 | Ga0207645_100172155 | 246 |
| 525 | 3300025908 | Ga0207643_10005288 | Ga0207643_100052885 | 246 |
| 526 | 3300025911 | Ga0207654_10271841 | Ga0207654_102718412 | 246 |
| 527 | 3300025913 | Ga0207695_10000836 | Ga0207695_1000083652 | 246 |
| 528 | 3300025916 | Ga0207663_10276455 | Ga0207663_102764552 | 246 |
| 529 | 3300025918 | Ga0207662_10018456 | Ga0207662_100184563 | 246 |
| 530 | 3300025923 | Ga0207681_10050016 | Ga0207681_100500163 | 246 |
| 531 | 3300025923 | Ga0207681_10383458 | Ga0207681_103834582 | 246 |
| 532 | 3300025924 | Ga0207694_10225623 | Ga0207694_102256231 | 246 |
| 533 | 3300025925 | Ga0207650_10022398 | Ga0207650_100223984 | 246 |
| 534 | 3300025925 | Ga0207650_10061558 | Ga0207650_100615582 | 246 |
| 535 | 3300025926 | Ga0207659_10028250 | Ga0207659_100282503 | 246 |
| 536 | 3300025927 | Ga0207687_10287716 | Ga0207687_102877162 | 246 |
| 537 | 3300025932 | Ga0207690_10078328 | Ga0207690_100783283 | 246 |
| 538 | 3300025933 | Ga0207706_10171654 | Ga0207706_101716542 | 246 |
| 539 | 3300025936 | Ga0207670_10014599 | Ga0207670_100145995 | 246 |
| 540 | 3300025937 | Ga0207669_10435504 | Ga0207669_104355042 | 246 |
| 541 | 3300025938 | Ga0207704_10173070 | Ga0207704_101730702 | 246 |
| 542 | 3300025938 | Ga0207704_10370082 | Ga0207704_103700822 | 246 |
| 543 | 3300025940 | Ga0207691_10026146 | Ga0207691_100261465 | 246 |
| 544 | 3300025940 | Ga0207691_10562969 | Ga0207691_105629692 | 246 |
| 545 | 3300025941 | Ga0207711_10559056 | Ga0207711_105590562 | 246 |
| 546 | 3300025942 | Ga0207689_10006698 | Ga0207689_1000669810 | 246 |
| 547 | 3300025942 | Ga0207689_10764309 | Ga0207689_107643091 | 246 |
| 548 | 3300025945 | Ga0207679_10085067 | Ga0207679_100850672 | 246 |
| 549 | 3300025960 | Ga0207651_10006633 | Ga0207651_100066336 | 246 |
| 550 | 3300025960 | Ga0207651_10235111 | Ga0207651_102351112 | 246 |
| 551 | 3300025961 | Ga0207712_10008158 | Ga0207712_100081587 | 246 |
| 552 | 3300025961 | Ga0207712_10343749 | Ga0207712_103437492 | 246 |
| 553 | 3300025972 | Ga0207668_10054973 | Ga0207668_100549732 | 246 |
| 554 | 3300025972 | Ga0207668_10059709 | Ga0207668_100597094 | 246 |
| 555 | 3300025981 | Ga0207640_10102706 | Ga0207640_101027063 | 246 |
| 556 | 3300025986 | Ga0207658_10125795 | Ga0207658_101257953 | 246 |
| 557 | 3300026023 | Ga0207677_10038461 | Ga0207677_100384614 | 246 |
| 558 | 3300026023 | Ga0207677_10051445 | Ga0207677_100514453 | 246 |
| 559 | 3300026035 | Ga0207703_10008219 | Ga0207703_100082194 | 246 |
| 560 | 3300026041 | Ga0207639_10333010 | Ga0207639_103330102 | 246 |
| 561 | 3300026075 | Ga0207708_10174181 | Ga0207708_101741813 | 246 |
| 562 | 3300026075 | Ga0207708_10362298 | Ga0207708_103622982 | 246 |
| 563 | 3300026088 | Ga0207641_10009300 | Ga0207641_100093005 | 246 |
| 564 | 3300026088 | Ga0207641_10142750 | Ga0207641_101427503 | 246 |
| 565 | 3300026089 | Ga0207648_10012447 | Ga0207648_100124475 | 246 |
| 566 | 3300026095 | Ga0207676_10004587 | Ga0207676_100045874 | 246 |
| 567 | 3300026095 | Ga0207676_10013079 | Ga0207676_100130792 | 246 |
| 568 | 3300026116 | Ga0207674_10061347 | Ga0207674_100613473 | 246 |
| 569 | 3300026118 | Ga0207675_100026519 | Ga0207675_1000265195 | 246 |
| 570 | 3300026118 | Ga0207675_100114026 | Ga0207675_1001140263 | 246 |
| 571 | 3300026118 | Ga0207675_100563324 | Ga0207675_1005633241 | 246 |
| 572 | 3300026121 | Ga0207683_10052091 | Ga0207683_100520912 | 246 |
| 573 | 3300027907 | Ga0207428_10068513 | Ga0207428_100685133 | 246 |
| 574 | 3300027907 | Ga0207428_10145422 | Ga0207428_101454222 | 246 |
| 575 | 3300028379 | Ga0268266_10066917 | Ga0268266_100669173 | 246 |
| 576 | 3300028379 | Ga0268266_10553333 | Ga0268266_105533332 | 246 |
| 577 | 3300028380 | Ga0268265_10000229 | Ga0268265_1000022910 | 246 |
| 578 | 3300028380 | Ga0268265_10002881 | Ga0268265_100028815 | 246 |
| 579 | 3300028380 | Ga0268265_10028437 | Ga0268265_100284372 | 246 |
| 580 | 3300028381 | Ga0268264_10098251 | Ga0268264_100982513 | 246 |
| 581 | 3300031665 | Ga0316575_10052829 | Ga0316575_100528293 | 246 |
| 582 | 3300031727 | Ga0316576_10005175 | Ga0316576_100051755 | 246 |
| 583 | 3300031727 | Ga0316576_10064162 | Ga0316576_100641621 | 246 |
| 584 | 3300031728 | Ga0316578_10003227 | Ga0316578_100032272 | 246 |
| 585 | 3300031733 | Ga0316577_10053267 | Ga0316577_100532674 | 246 |
| 586 | 3300031824 | Ga0307413_10109949 | Ga0307413_101099493 | 246 |
| 587 | 3300031852 | Ga0307410_10300063 | Ga0307410_103000632 | 246 |
| 588 | 3300031901 | Ga0307406_10099368 | Ga0307406_100993682 | 246 |
| 589 | 3300031901 | Ga0307406_10590603 | Ga0307406_105906031 | 246 |
| 590 | 3300031911 | Ga0307412_10080429 | Ga0307412_100804293 | 246 |
| 591 | 3300032002 | Ga0307416_100243907 | Ga0307416_1002439072 | 246 |
| 592 | 3300032139 | Ga0316580_10015332 | Ga0316580_100153323 | 246 |
| 593 | 3300034817 | Ga0373948_0037180 | Ga0373948_0037180_140_880 | 246 |
| 594 | 3300035085 | Ga0373929_0024713 | Ga0373929_0024713_377_1117 | 246 |
| 595 | 3300035172 | Ga0373955_0032272 | Ga0373955_0032272_1751_2506 | 246 |
| 596 | 3300035242 | Ga0373962_0101982 | Ga0373962_0101982_90_830 | 246 |
| 597 | 3300035398 | Ga0316574_0000055 | Ga0316574_0000055_12047_12790 | 246 |
| 598 | 3300035398 | Ga0316574_0038361 | Ga0316574_0038361_1933_2676 | 246 |
| 599 | 3300036401 | Ga0373937_0026263 | Ga0373937_0026263_3436_4191 | 246 |
| 600 | 3300036712 | Ga0316584_0031574 | Ga0316584_0031574_355_1098 | 246 |
| 601 | 3300039062 | Ga0400483_073268 | Ga0400483_073268_2566_3333 | 246 |
| 602 | 3300039062 | Ga0400483_223374 | Ga0400483_223374_762_1529 | 246 |
| 603 | 3300042876 | Ga0451577_0131818 | Ga0451577_0131818_34_780 | 246 |
| 604 | 3300044712 | Ga0453684_0115260 | Ga0453684_0115260_1353_2141 | 246 |
| 605 | 3300044842 | Ga0466957_0330333 | Ga0466957_0330333_267_1019 | 246 |
| 606 | 3300045051 | Ga0451576_0047403 | Ga0451576_0047403_3060_3815 | 246 |
| 607 | 3300045051 | Ga0451576_0071884 | Ga0451576_0071884_159_899 | 246 |
| 608 | 3300045051 | Ga0451576_0390807 | Ga0451576_0390807_480_1226 | 246 |
| 609 | 3300046471 | Ga0495650_0013982 | Ga0495650_0013982_1739_2485 | 246 |
| 610 | 3300046664 | Ga0495659_0104326 | Ga0495659_0104326_99_848 | 246 |
| 611 | 3300047322 | Ga0495680_0104882 | Ga0495680_0104882_486_1244 | 246 |
| 612 | 3300048907 | Ga0496104_0044072 | Ga0496104_0044072_3096_3851 | 246 |
| 613 | 3300048908 | Ga0496105_0360477 | Ga0496105_0360477_65_805 | 246 |
| 614 | 3300048911 | Ga0496108_0058195 | Ga0496108_0058195_1450_2190 | 246 |
| 615 | 3300048912 | Ga0496109_0052934 | Ga0496109_0052934_2716_3456 | 246 |
| 616 | 3300048912 | Ga0496109_0346883 | Ga0496109_0346883_58_813 | 246 |
| 617 | 3300048913 | Ga0496110_0079484 | Ga0496110_0079484_116_856 | 246 |
| 618 | 3300048915 | Ga0496112_0132206 | Ga0496112_0132206_769_1524 | 246 |
| 619 | 3300048916 | Ga0496113_0039378 | Ga0496113_0039378_1369_2109 | 246 |
| 620 | 3300048917 | Ga0496114_0186884 | Ga0496114_0186884_216_956 | 246 |
| 621 | 3300049578 | Ga0501042_0126208 | Ga0501042_0126208_674_1417 | 246 |
| 622 | 3300049587 | Ga0501071_0030458 | Ga0501071_0030458_2269_3012 | 246 |
| 623 | 3300049741 | Ga0501079_0583072 | Ga0501079_0583072_18_761 | 246 |
| 624 | 3300049744 | Ga0501083_0267217 | Ga0501083_0267217_64_807 | 246 |
| 625 | 3300049824 | Ga0501045_0036634 | Ga0501045_0036634_384_1127 | 246 |
| 626 | 3300050507 | nmdc:mga05p37_8696_c1 | nmdc:mga05p37_8696_c1_3249_3989 | 246 |
| 627 | 3300050509 | nmdc:mga0qj67_8382_c1 | nmdc:mga0qj67_8382_c1_5269_6009 | 246 |
| 628 | 3300050510 | nmdc:mga06r32_14131_c1 | nmdc:mga06r32_14131_c1_3239_3979 | 246 |
| 629 | 3300050510 | nmdc:mga06r32_31753_c1 | nmdc:mga06r32_31753_c1_629_1369 | 246 |
| 630 | 3300050512 | nmdc:mga0n895_450208_c1 | nmdc:mga0n895_450208_c1_454_1194 | 246 |
| 631 | 3300053077 | Ga0495601_0053948 | Ga0495601_0053948_1748_2503 | 246 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h3a-assembly1.cif.gz_B | structure of e. coli undecaprenyl diphosphate synthase in complex with bph-1330 | 0.9775 | 12 | 232 |
| 5cqj-assembly1.cif.gz_B | crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with clomiphene | 0.9773 | 12 | 232 |
| 4h3c-assembly1.cif.gz_B | structure of e. coli undecaprenyl diphosphate synthase in complex with bph-987 | 0.9757 | 11 | 232 |
| 3sh0-assembly1.cif.gz_A | crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with bph-1065 | 0.9752 | 12 | 232 |
| 3sgx-assembly1.cif.gz_B | crystal structure of e. coli undecaprenyl pyrophosphate synthase in complex with bph-1100 | 0.9718 | 12 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v7uB00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9628 | 12 | 232 | 3.40.1180.10 |
| 2vg2A01 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9555 | 7 | 232 | 3.40.1180.10 |
| 5hc7A00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9469 | 9 | 232 | 3.40.1180.10 |
| 1v7uB00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9457 | 12 | 232 | 3.40.1180.10 |
| af_K7KA63_68_310_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9445 | 5 | 239 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662B016-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.981 | 10 | 215 |
GO:0016094
GO:0045547 GO:0046872 |
| AF-A0A349EDR2-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9803 | 10 | 232 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
| AF-A0A4Q5R3Z9-F1-model_v4 | Isoprenyl transferase | 0.9753 | 10 | 232 |
GO:0016094
GO:0045547 GO:0046872 |
| AF-A0A259LN37-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9752 | 11 | 212 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
| AF-A0A2S6U2I4-F1-model_v4 | Isoprenyl transferase (EC 2.5.1.-) | 0.9741 | 10 | 236 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar