F470978

General Info

Members Datasets Scaffolds Average Seq Length
632 226 632 143

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100771445|Ga0068853_1007714453
Length 165
Sequence MRSFHLSATPIDAGAQRVSLEDPAAGACVTFEGWVRNHNAARQVTRLDYQAYGPLAEEEGAAILEEARSKFGLRAARCVHRTGALAIGDMAVWVGVSADHRDAAFAACRWIIDEVKRRVPIWKNEHYADGESGWLHPDNTPVTSGPVTSEHVARGTQVGAGNDSR

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
147 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 4.27
Rhizosphere 89.4
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10040047 3300002077 Bacteria 878
2 Ga0070658_10264427 3300005327 Bacteria 1461
3 Ga0070676_10019016 3300005328 Bacteria 3816
4 Ga0070676_10216840 3300005328 Bacteria 1262
5 Ga0070683_100772639 3300005329 Bacteria 920
6 Ga0070690_100171030 3300005330 Bacteria 1495
7 Ga0070670_100117766 3300005331 Bacteria 2291
8 Ga0070670_100778762 3300005331 Bacteria 863
9 Ga0070670_101770555 3300005331 Bacteria 569
10 Ga0070666_10000119 3300005335 Bacteria 54440
11 Ga0070666_10000349 3300005335 Bacteria 28972
12 Ga0070666_10016973 3300005335 Bacteria 4662
13 Ga0070666_10335289 3300005335 Bacteria 1080
14 Ga0070666_10473874 3300005335 Bacteria 906
15 Ga0070666_10939868 3300005335 Bacteria 640
16 Ga0070680_101039786 3300005336 Bacteria 707
17 Ga0068868_100010069 3300005338 Bacteria 6831
18 Ga0068868_100386165 3300005338 Bacteria 1206
19 Ga0070660_100649504 3300005339 Bacteria 883
20 Ga0070689_102055365 3300005340 Bacteria 523
21 Ga0070661_100013089 3300005344 Bacteria 5820
22 Ga0070661_100176189 3300005344 Bacteria 1625
23 Ga0070661_100500292 3300005344 Bacteria 973
24 Ga0070668_100028934 3300005347 Bacteria 4206
25 Ga0070668_100120413 3300005347 Bacteria 2097
26 Ga0070668_100186138 3300005347 Bacteria 1698
27 Ga0070675_100295745 3300005354 Bacteria 1425
28 Ga0070671_100051395 3300005355 Bacteria 3428
29 Ga0070671_100374348 3300005355 Bacteria 1216
30 Ga0070671_101269771 3300005355 Bacteria 649
31 Ga0070673_100015600 3300005364 Bacteria 5343
32 Ga0070688_100134226 3300005365 Bacteria 1674
33 Ga0070667_100031478 3300005367 Bacteria 4423
34 Ga0070667_100102637 3300005367 Bacteria 2471
35 Ga0070667_100115376 3300005367 Bacteria 2332
36 Ga0070667_100156717 3300005367 Bacteria 2003
37 Ga0070667_100189315 3300005367 Bacteria 1822
38 Ga0070667_100225722 3300005367 Bacteria 1668
39 Ga0070667_100290116 3300005367 Bacteria 1471
40 Ga0070667_100851623 3300005367 Bacteria 847
41 Ga0070713_100351369 3300005436 Bacteria 1368
42 Ga0070711_100015700 3300005439 Bacteria 4795
43 Ga0070711_100270518 3300005439 Bacteria 1340
44 Ga0070663_100006777 3300005455 Bacteria 6921
45 Ga0070663_100223056 3300005455 Bacteria 1481
46 Ga0070663_100225362 3300005455 Unclassified 1474
47 Ga0070678_100445127 3300005456 Bacteria 1134
48 Ga0070662_100010885 3300005457 Bacteria 5992
49 Ga0070681_10927509 3300005458 Bacteria 789
50 Ga0068867_100248422 3300005459 Bacteria 1446
51 Ga0068867_100305189 3300005459 Bacteria 1314
52 Ga0070685_10136070 3300005466 Bacteria 1542
53 Ga0070679_100172504 3300005530 Bacteria 2135
54 Ga0070679_100630703 3300005530 Bacteria 1015
55 Ga0068853_100000780 3300005539 Bacteria 22115
56 Ga0068853_100006385 3300005539 Bacteria 9364
57 Ga0068853_100006658 3300005539 Bacteria 9201
58 Ga0068853_100120840 3300005539 Bacteria 2336
59 Ga0068853_100146493 3300005539 Bacteria 2122
60 Ga0068853_100166268 3300005539 Bacteria 1993
61 Ga0068853_100331420 3300005539 Bacteria 1412
62 Ga0068853_100470620 3300005539 Bacteria 1184
63 Ga0068853_100479646 3300005539 Bacteria 1172
64 Ga0068853_100771445 3300005539 Bacteria 920
65 Ga0070672_100010568 3300005543 Bacteria 6408
66 Ga0070672_100620666 3300005543 Bacteria 943
67 Ga0070693_100007096 3300005547 Bacteria 5459
68 Ga0070665_100000227 3300005548 Bacteria 93439
69 Ga0070665_100000512 3300005548 Bacteria 55689
70 Ga0070665_100036031 3300005548 Bacteria 4978
71 Ga0070665_100063679 3300005548 Bacteria 3697
72 Ga0070665_100084118 3300005548 Bacteria 3187
73 Ga0070665_100112844 3300005548 Bacteria 2721
74 Ga0070665_100309634 3300005548 Bacteria 1583
75 Ga0070665_100969719 3300005548 Bacteria 863
76 Ga0068855_100003175 3300005563 Bacteria 20120
77 Ga0068855_100038218 3300005563 Bacteria 5704
78 Ga0068855_100227779 3300005563 Bacteria 2088
79 Ga0068855_100421281 3300005563 Bacteria 1460
80 Ga0068855_100565509 3300005563 Bacteria 1229
81 Ga0068855_101036172 3300005563 Bacteria 860
82 Ga0068855_101178444 3300005563 Bacteria 797
83 Ga0068855_101232019 3300005563 Bacteria 777
84 Ga0070664_100146055 3300005564 Bacteria 2086
85 Ga0070664_100861316 3300005564 Bacteria 849
86 Ga0068857_100147783 3300005577 Bacteria 2127
87 Ga0068857_100201074 3300005577 Bacteria 1816
88 Ga0068857_100708434 3300005577 Bacteria 957
89 Ga0068854_100072895 3300005578 Bacteria 2515
90 Ga0068854_100184914 3300005578 Bacteria 1630
91 Ga0068856_100001386 3300005614 Bacteria 25486
92 Ga0068856_100078952 3300005614 Bacteria 3263
93 Ga0068856_100128449 3300005614 Bacteria 2538
94 Ga0068856_100396781 3300005614 Bacteria 1399
95 Ga0068852_100013277 3300005616 Bacteria 6299
96 Ga0068852_100015325 3300005616 Bacteria 5938
97 Ga0068852_100080239 3300005616 Bacteria 2892
98 Ga0068852_100120763 3300005616 Bacteria 2399
99 Ga0068852_100216254 3300005616 Bacteria 1820
100 Ga0068852_100432359 3300005616 Bacteria 1300
101 Ga0068852_100587844 3300005616 Bacteria 1117
102 Ga0068859_100000109 3300005617 Bacteria 77572
103 Ga0068859_100076536 3300005617 Bacteria 3387
104 Ga0068859_100268523 3300005617 Bacteria 1798
105 Ga0068859_101809479 3300005617 Bacteria 674
106 Ga0068864_100028578 3300005618 Bacteria 4715
107 Ga0068864_100049105 3300005618 Bacteria 3629
108 Ga0068864_100133393 3300005618 Bacteria 2234
109 Ga0068864_101759409 3300005618 Bacteria 625
110 Ga0068851_10009662 3300005834 Bacteria 4491
111 Ga0068851_10020920 3300005834 Bacteria 3173
112 Ga0068851_10066470 3300005834 Bacteria 1858
113 Ga0068863_100000329 3300005841 Bacteria 48080
114 Ga0068863_100058294 3300005841 Bacteria 3655
115 Ga0068863_100503415 3300005841 Bacteria 1193
116 Ga0068863_101020061 3300005841 Bacteria 830
117 Ga0068858_100001840 3300005842 Bacteria 21631
118 Ga0068858_100071384 3300005842 Bacteria 3221
119 Ga0068858_100434723 3300005842 Bacteria 1263
120 Ga0068858_100507820 3300005842 Bacteria 1165
121 Ga0068858_101108390 3300005842 Unclassified 777
122 Ga0068860_100009878 3300005843 Bacteria 9461
123 Ga0068860_100024054 3300005843 Bacteria 5889
124 Ga0068860_100049216 3300005843 Bacteria 4015
125 Ga0068860_100436822 3300005843 Bacteria 1300
126 Ga0068860_100472504 3300005843 Bacteria 1249
127 Ga0068862_100000197 3300005844 Bacteria 66711
128 Ga0068862_100494678 3300005844 Bacteria 1160
129 Ga0068862_101731417 3300005844 Bacteria 634
130 Ga0081455_10222393 3300005937 Bacteria 1398
131 Ga0081540_1001888 3300005983 Bacteria 17539
132 Ga0075365_10002175 3300006038 Bacteria 9439
133 Ga0075364_10144886 3300006051 Bacteria 1599
134 Ga0070712_101311980 3300006175 Bacteria 631
135 Ga0097621_100152206 3300006237 Bacteria 1984
136 Ga0097621_100155084 3300006237 Bacteria 1965
137 Ga0097621_100174362 3300006237 Bacteria 1855
138 Ga0097621_100382807 3300006237 Bacteria 1257
139 Ga0097621_101266920 3300006237 Bacteria 696
140 Ga0068871_100115700 3300006358 Bacteria 2260
141 Ga0068871_100485633 3300006358 Bacteria 1112
142 Ga0068871_100514902 3300006358 Bacteria 1080
143 Ga0068871_101369434 3300006358 Bacteria 666
144 Ga0068865_100031333 3300006881 Bacteria 3545
145 Ga0068865_100216035 3300006881 Bacteria 1497
146 Ga0097620_100000109 3300006931 Bacteria 77572
147 Ga0097620_100076536 3300006931 Bacteria 3387
148 Ga0097620_100268507 3300006931 Bacteria 1798
149 Ga0097620_101809499 3300006931 Bacteria 674
150 Ga0105240_10001318 3300009093 Bacteria 42836
151 Ga0105240_10007745 3300009093 Bacteria 15536
152 Ga0105240_10063857 3300009093 Bacteria 4578
153 Ga0105240_11064413 3300009093 Bacteria 862
154 Ga0105245_10402190 3300009098 Bacteria 1369
155 Ga0105245_11097591 3300009098 Bacteria 842
156 Ga0105247_10088136 3300009101 Bacteria 1966
157 Ga0105241_10005014 3300009174 Bacteria 9776
158 Ga0105241_10180394 3300009174 Bacteria 1751
159 Ga0105241_10453262 3300009174 Bacteria 1135
160 Ga0105241_11494287 3300009174 Bacteria 650
161 Ga0105241_11519314 3300009174 Bacteria 645
162 Ga0105242_10430422 3300009176 Bacteria 1239
163 Ga0105248_10002580 3300009177 Bacteria 20127
164 Ga0105248_10039905 3300009177 Bacteria 5263
165 Ga0105248_10317496 3300009177 Bacteria 1755
166 Ga0105248_10380703 3300009177 Bacteria 1589
167 Ga0105248_10897954 3300009177 Bacteria 1000
168 Ga0105248_10969583 3300009177 Bacteria 960
169 Ga0105248_11099768 3300009177 Bacteria 898
170 Ga0105237_10003173 3300009545 Bacteria 19725
171 Ga0105237_10012009 3300009545 Bacteria 9149
172 Ga0105237_10018912 3300009545 Bacteria 7122
173 Ga0105237_10039315 3300009545 Bacteria 4776
174 Ga0105237_10243815 3300009545 Bacteria 1798
175 Ga0105237_10346802 3300009545 Bacteria 1489
176 Ga0105237_10632068 3300009545 Bacteria 1077
177 Ga0105237_10772758 3300009545 Bacteria 967
178 Ga0105237_10961848 3300009545 Bacteria 861
179 Ga0105237_11402985 3300009545 Bacteria 705
180 Ga0105238_10002383 3300009551 Bacteria 18847
181 Ga0105238_10018113 3300009551 Bacteria 7161
182 Ga0105238_10019466 3300009551 Bacteria 6912
183 Ga0105238_10039009 3300009551 Bacteria 4819
184 Ga0105238_10085564 3300009551 Bacteria 3140
185 Ga0105238_10458956 3300009551 Bacteria 1272
186 Ga0105249_10001401 3300009553 Bacteria 21100
187 Ga0105249_10060344 3300009553 Bacteria 3479
188 Ga0105249_11189397 3300009553 Bacteria 833
189 Ga0105239_10012446 3300010375 Bacteria 9477
190 Ga0105239_10019475 3300010375 Bacteria 7491
191 Ga0105239_10022173 3300010375 Bacteria 6999
192 Ga0105239_10047656 3300010375 Bacteria 4696
193 Ga0105239_10068918 3300010375 Bacteria 3887
194 Ga0105239_10111889 3300010375 Bacteria 3027
195 Ga0105239_10186519 3300010375 Bacteria 2321
196 Ga0105239_10278808 3300010375 Bacteria 1881
197 Ga0105239_11250084 3300010375 Bacteria 856
198 Ga0105239_13023043 3300010375 Bacteria 548
199 Ga0157373_10209896 3300013100 Bacteria 1373
200 Ga0157373_10559833 3300013100 Bacteria 830
201 Ga0157371_10775078 3300013102 Bacteria 721
202 Ga0157370_10015119 3300013104 Bacteria 7863
203 Ga0157370_10352429 3300013104 Bacteria 1357
204 Ga0157370_10975593 3300013104 Bacteria 768
205 Ga0157370_11204624 3300013104 Bacteria 683
206 Ga0157369_10010996 3300013105 Bacteria 10302
207 Ga0157369_10135752 3300013105 Bacteria 2605
208 Ga0157369_10249307 3300013105 Bacteria 1853
209 Ga0157374_10110511 3300013296 Bacteria 2643
210 Ga0157374_10121405 3300013296 Bacteria 2522
211 Ga0157378_10051445 3300013297 Bacteria 3666
212 Ga0157378_10440002 3300013297 Bacteria 1292
213 Ga0157372_10001701 3300013307 Bacteria 23836
214 Ga0157372_10030618 3300013307 Bacteria 5888
215 Ga0157372_10041801 3300013307 Bacteria 5068
216 Ga0157375_10609213 3300013308 Bacteria 1251
217 Ga0157375_11103678 3300013308 Bacteria 929
218 Ga0157375_12136552 3300013308 Bacteria 667
219 Ga0163163_10000233 3300014325 Bacteria 57369
220 Ga0163163_10001571 3300014325 Bacteria 19244
221 Ga0163163_10035944 3300014325 Bacteria 4809
222 Ga0163163_10235688 3300014325 Bacteria 1879
223 Ga0157379_10003082 3300014968 Bacteria 14095
224 Ga0157376_10051666 3300014969 Bacteria 3414
225 Ga0157376_10058312 3300014969 Bacteria 3233
226 Ga0157376_10064239 3300014969 Bacteria 3095
227 Ga0157376_10614582 3300014969 Bacteria 1083
228 Ga0157376_10845045 3300014969 Bacteria 930
229 Ga0209233_1002219 3300025261 Bacteria 7285
230 Ga0209051_1009216 3300025303 Bacteria 5110
231 Ga0207656_10035638 3300025321 Bacteria 2085
232 Ga0207656_10042969 3300025321 Bacteria 1926
233 Ga0207656_10174782 3300025321 Bacteria 1028
234 Ga0207680_10000709 3300025903 Bacteria 15637
235 Ga0207680_10020535 3300025903 Bacteria 3558
236 Ga0207647_10004386 3300025904 Bacteria 10466
237 Ga0207647_10035304 3300025904 Bacteria 3187
238 Ga0207699_11030694 3300025906 Bacteria 609
239 Ga0207645_10187858 3300025907 Bacteria 1357
240 Ga0207645_10366558 3300025907 Bacteria 965
241 Ga0207643_10557322 3300025908 Bacteria 736
242 Ga0207705_10356106 3300025909 Bacteria 1128
243 Ga0207705_10430214 3300025909 Bacteria 1022
244 Ga0207705_10652007 3300025909 Bacteria 819
245 Ga0207654_10119440 3300025911 Bacteria 1653
246 Ga0207654_10177109 3300025911 Bacteria 1389
247 Ga0207654_10262052 3300025911 Bacteria 1163
248 Ga0207654_10647681 3300025911 Bacteria 756
249 Ga0207654_10710164 3300025911 Bacteria 722
250 Ga0207695_10000007 3300025913 Bacteria 1092551
251 Ga0207695_10000295 3300025913 Bacteria 123533
252 Ga0207695_10043274 3300025913 Bacteria 4800
253 Ga0207695_10047016 3300025913 Bacteria 4570
254 Ga0207695_10123730 3300025913 Bacteria 2552
255 Ga0207695_11010871 3300025913 Bacteria 711
256 Ga0207671_10004185 3300025914 Bacteria 13935
257 Ga0207671_10021844 3300025914 Bacteria 4849
258 Ga0207671_10050124 3300025914 Bacteria 3091
259 Ga0207671_10128033 3300025914 Bacteria 1947
260 Ga0207671_10130905 3300025914 Bacteria 1925
261 Ga0207671_10140396 3300025914 Bacteria 1861
262 Ga0207693_10198330 3300025915 Bacteria 1578
263 Ga0207662_10220781 3300025918 Bacteria 1234
264 Ga0207657_10030009 3300025919 Bacteria 4940
265 Ga0207649_10015154 3300025920 Bacteria 4328
266 Ga0207649_10051222 3300025920 Bacteria 2556
267 Ga0207649_10167226 3300025920 Bacteria 1528
268 Ga0207649_10484789 3300025920 Bacteria 938
269 Ga0207681_10090945 3300025923 Bacteria 2179
270 Ga0207694_10007420 3300025924 Bacteria 8314
271 Ga0207694_10048426 3300025924 Bacteria 3289
272 Ga0207694_10110655 3300025924 Bacteria 2185
273 Ga0207694_10398910 3300025924 Bacteria 1144
274 Ga0207694_10667339 3300025924 Bacteria 876
275 Ga0207650_10088317 3300025925 Bacteria 2364
276 Ga0207687_10194899 3300025927 Bacteria 1579
277 Ga0207700_10968406 3300025928 Bacteria 761
278 Ga0207644_10546040 3300025931 Bacteria 959
279 Ga0207644_10882842 3300025931 Bacteria 749
280 Ga0207644_10893169 3300025931 Bacteria 745
281 Ga0207690_11546661 3300025932 Bacteria 554
282 Ga0207706_10001116 3300025933 Bacteria 27311
283 Ga0207670_11700916 3300025936 Bacteria 537
284 Ga0207691_10012163 3300025940 Bacteria 8250
285 Ga0207691_10053612 3300025940 Bacteria 3682
286 Ga0207711_10001830 3300025941 Bacteria 19386
287 Ga0207711_10198563 3300025941 Bacteria 1830
288 Ga0207711_10551726 3300025941 Bacteria 1075
289 Ga0207711_10642405 3300025941 Bacteria 990
290 Ga0207711_10712189 3300025941 Bacteria 936
291 Ga0207689_10086188 3300025942 Bacteria 2581
292 Ga0207689_11018872 3300025942 Bacteria 698
293 Ga0207689_11124497 3300025942 Bacteria 662
294 Ga0207679_10101059 3300025945 Bacteria 2255
295 Ga0207679_10409668 3300025945 Bacteria 1194
296 Ga0207667_10018943 3300025949 Bacteria 7697
297 Ga0207667_10024555 3300025949 Bacteria 6614
298 Ga0207667_10117688 3300025949 Bacteria 2739
299 Ga0207667_10174314 3300025949 Bacteria 2210
300 Ga0207667_10278772 3300025949 Bacteria 1708
301 Ga0207667_10303184 3300025949 Bacteria 1632
302 Ga0207667_10872609 3300025949 Bacteria 893
303 Ga0207712_10000267 3300025961 Bacteria 50698
304 Ga0207712_10000302 3300025961 Bacteria 46123
305 Ga0207668_10016283 3300025972 Bacteria 4637
306 Ga0207668_10302137 3300025972 Bacteria 1321
307 Ga0207640_10004856 3300025981 Bacteria 7301
308 Ga0207640_10017540 3300025981 Bacteria 4192
309 Ga0207640_10461634 3300025981 Bacteria 1049
310 Ga0207658_10000166 3300025986 Bacteria 70441
311 Ga0207658_10003668 3300025986 Bacteria 10827
312 Ga0207658_10152420 3300025986 Bacteria 1885
313 Ga0207658_10319039 3300025986 Bacteria 1344
314 Ga0207658_10876066 3300025986 Unclassified 817
315 Ga0207677_10070758 3300026023 Bacteria 2460
316 Ga0207703_10000456 3300026035 Bacteria 43004
317 Ga0207703_10119793 3300026035 Bacteria 2258
318 Ga0207703_10333465 3300026035 Bacteria 1392
319 Ga0207703_10717164 3300026035 Bacteria 952
320 Ga0207639_10000319 3300026041 Bacteria 33729
321 Ga0207639_10002703 3300026041 Bacteria 11898
322 Ga0207639_10004122 3300026041 Bacteria 9797
323 Ga0207639_10008534 3300026041 Bacteria 7031
324 Ga0207639_10061957 3300026041 Bacteria 2891
325 Ga0207639_10121823 3300026041 Bacteria 2144
326 Ga0207639_10149076 3300026041 Bacteria 1957
327 Ga0207639_10227842 3300026041 Bacteria 1613
328 Ga0207639_10277026 3300026041 Bacteria 1474
329 Ga0207639_10314916 3300026041 Bacteria 1387
330 Ga0207678_10004648 3300026067 Bacteria 12330
331 Ga0207678_10019973 3300026067 Bacteria 5888
332 Ga0207678_10021725 3300026067 Bacteria 5629
333 Ga0207678_10049240 3300026067 Bacteria 3642
334 Ga0207702_10004222 3300026078 Bacteria 12833
335 Ga0207702_10033998 3300026078 Bacteria 4260
336 Ga0207702_10123545 3300026078 Bacteria 2320
337 Ga0207702_10607839 3300026078 Bacteria 1073
338 Ga0207641_10012486 3300026088 Bacteria 6962
339 Ga0207641_10029249 3300026088 Bacteria 4555
340 Ga0207641_10055794 3300026088 Bacteria 3355
341 Ga0207641_10131186 3300026088 Bacteria 2251
342 Ga0207641_10310344 3300026088 Bacteria 1493
343 Ga0207641_11091070 3300026088 Bacteria 797
344 Ga0207641_11173730 3300026088 Bacteria 767
345 Ga0207648_10054124 3300026089 Bacteria 3506
346 Ga0207648_10382181 3300026089 Bacteria 1273
347 Ga0207676_10014463 3300026095 Bacteria 5680
348 Ga0207676_10050668 3300026095 Bacteria 3238
349 Ga0207676_10168226 3300026095 Bacteria 1907
350 Ga0207676_10208578 3300026095 Bacteria 1732
351 Ga0207676_11331863 3300026095 Bacteria 713
352 Ga0207674_10003529 3300026116 Bacteria 19091
353 Ga0207674_10022832 3300026116 Bacteria 6713
354 Ga0207674_10092525 3300026116 Bacteria 3013
355 Ga0207674_10325803 3300026116 Bacteria 1486
356 Ga0207674_10703012 3300026116 Bacteria 976
357 Ga0207674_11744558 3300026116 Bacteria 590
358 Ga0207683_10050995 3300026121 Bacteria 3625
359 Ga0207698_10021084 3300026142 Bacteria 4499
360 Ga0207698_10056613 3300026142 Bacteria 3028
361 Ga0207698_10112971 3300026142 Bacteria 2281
362 Ga0207698_10298123 3300026142 Bacteria 1499
363 Ga0207698_10814766 3300026142 Bacteria 937
364 Ga0207698_11305856 3300026142 Bacteria 740
365 Ga0268266_10000001 3300028379 Bacteria 4040580
366 Ga0268266_10000006 3300028379 Bacteria 1410021
367 Ga0268266_10024713 3300028379 Bacteria 5112
368 Ga0268266_10060519 3300028379 Bacteria 3265
369 Ga0268266_10141130 3300028379 Bacteria 2162
370 Ga0268266_10141156 3300028379 Bacteria 2162
371 Ga0268266_10338979 3300028379 Bacteria 1411
372 Ga0268266_10375934 3300028379 Bacteria 1339
373 Ga0268266_11200672 3300028379 Bacteria 733
374 Ga0268265_10000153 3300028380 Bacteria 84364
375 Ga0268265_10019820 3300028380 Bacteria 4684
376 Ga0268264_10005234 3300028381 Bacteria 10980
377 Ga0268264_10008335 3300028381 Bacteria 8615
378 Ga0268264_10225514 3300028381 Bacteria 1727
379 Ga0268264_11521977 3300028381 Bacteria 680
380 Ga0307517_10177528 3300028786 Bacteria 1383
381 Ga0307509_10127177 3300031507 Bacteria 2512
382 Ga0307508_10049195 3300031616 Bacteria 3754
383 Ga0307516_10047197 3300031730 Bacteria 4245
384 Ga0307413_10210349 3300031824 Bacteria 1412
385 Ga0307410_10090736 3300031852 Bacteria 2168
386 Ga0307407_10593592 3300031903 Bacteria 824
387 Ga0307507_10082586 3300033179 Bacteria 2816
388 Ga0373948_0034279 3300034817 Bacteria 1037
389 Ga0373959_0010244 3300034820 Bacteria 1635
390 Ga0373928_0039412 3300035084 Bacteria 1079
391 Ga0373929_0011053 3300035085 Bacteria 1695
392 Ga0373940_0040143 3300035088 Bacteria 1283
393 Ga0373940_0221117 3300035088 Bacteria 629
394 Ga0373939_0027738 3300035114 Bacteria 1606
395 Ga0373941_0067501 3300035115 Bacteria 1179
396 Ga0373931_0322736 3300035691 Bacteria 959
397 Ga0395899_0097343 3300037312 Bacteria 2127
398 Ga0395900_0056989 3300037418 Bacteria 4022
399 Ga0395905_0000630 3300037471 Bacteria 47216
400 Ga0395901_0816971 3300038443 Bacteria 920
401 Ga0436365_0129859 3300039437 Bacteria 1463
402 Ga0451800_1677929 3300041459 Bacteria 561
403 Ga0451807_1245602 3300041486 Bacteria 796
404 Ga0451807_1271362 3300041486 Bacteria 3466
405 Ga0451833_0279494 3300041491 Bacteria 1302
406 Ga0451837_0499961 3300041494 Bacteria 512
407 Ga0451849_1464641 3300041505 Bacteria 506
408 Ga0451853_0300632 3300041512 Bacteria 855
409 Ga0439448_0016086 3300042005 Bacteria 2273
410 Ga0453683_0124980 3300044673 Bacteria 1620
411 Ga0466957_0337028 3300044842 Bacteria 1021
412 Ga0466967_1166120 3300045976 Bacteria 768
413 Ga0495629_0403400 3300046459 Bacteria 929
414 Ga0495580_0578272 3300046472 Bacteria 744
415 Ga0495622_0114266 3300046557 Bacteria 1235
416 Ga0495668_0269800 3300046616 Bacteria 932
417 Ga0495657_0847925 3300046675 Bacteria 521
418 Ga0495613_0462248 3300046689 Bacteria 859
419 Ga0495649_0236628 3300046694 Bacteria 941
420 Ga0495636_0210896 3300047318 Bacteria 889
421 Ga0495686_0343984 3300047472 Bacteria 812
422 Ga0496100_0048609 3300048903 Bacteria 2739
423 Ga0496101_0122087 3300048904 Bacteria 1970
424 Ga0496102_0073671 3300048905 Bacteria 3138
425 Ga0496102_0823504 3300048905 Bacteria 850
426 Ga0496104_0072055 3300048907 Bacteria 3285
427 Ga0496104_0269143 3300048907 Bacteria 1616
428 Ga0496105_0138319 3300048908 Bacteria 2005
429 Ga0496106_0130130 3300048909 Bacteria 1973
430 Ga0496106_0235658 3300048909 Bacteria 1462
431 Ga0496108_0001062 3300048911 Bacteria 21438
432 Ga0496108_0019892 3300048911 Bacteria 5514
433 Ga0496109_0002437 3300048912 Bacteria 15578
434 Ga0496109_0013140 3300048912 Bacteria 7165
435 Ga0496110_0135621 3300048913 Bacteria 2224
436 Ga0496110_0393357 3300048913 Bacteria 1263
437 Ga0496111_0023417 3300048914 Bacteria 4335
438 Ga0496112_0000975 3300048915 Bacteria 20872
439 Ga0496112_0002481 3300048915 Bacteria 14887
440 Ga0496113_0000793 3300048916 Bacteria 16390
441 Ga0496113_0075700 3300048916 Bacteria 2569
442 Ga0496114_0031369 3300048917 Bacteria 4374
443 Ga0496114_0296975 3300048917 Bacteria 1426
444 Ga0496115_0000065 3300048918 Bacteria 98148
445 Ga0496115_0358365 3300048918 Bacteria 1189
446 Ga0496117_0033772 3300048920 Bacteria 3864
447 Ga0496117_0059216 3300048920 Bacteria 2647
448 Ga0496117_0079841 3300048920 Bacteria 2154
449 Ga0496117_0478076 3300048920 Bacteria 609
450 Ga0496118_0000177 3300048921 Bacteria 114183
451 Ga0496118_0000479 3300048921 Bacteria 66255
452 Ga0496118_0018596 3300048921 Bacteria 6257
453 Ga0496118_0027212 3300048921 Bacteria 4846
454 Ga0496120_0336749 3300048923 Bacteria 681
455 Ga0496121_0371565 3300048924 Bacteria 946
456 Ga0496122_0000374 3300048925 Bacteria 96140
457 Ga0496123_0007035 3300048926 Bacteria 10710
458 Ga0496126_0000185 3300048929 Bacteria 140051
459 Ga0496126_0461016 3300048929 Bacteria 1021
460 Ga0501031_0012252 3300049568 Bacteria 5588
461 Ga0501031_0178683 3300049568 Bacteria 1386
462 Ga0501031_0258905 3300049568 Bacteria 1131
463 Ga0501032_0004319 3300049569 Bacteria 10739
464 Ga0501032_0005979 3300049569 Bacteria 8979
465 Ga0501032_0085984 3300049569 Bacteria 2090
466 Ga0501032_0120774 3300049569 Bacteria 1732
467 Ga0501032_0557900 3300049569 Bacteria 730
468 Ga0501032_0740633 3300049569 Bacteria 622
469 Ga0501033_0000467 3300049570 Bacteria 38314
470 Ga0501033_0005181 3300049570 Bacteria 10360
471 Ga0501034_0000451 3300049571 Bacteria 68012
472 Ga0501034_0004236 3300049571 Bacteria 16008
473 Ga0501034_0005990 3300049571 Bacteria 13153
474 Ga0501034_0006042 3300049571 Bacteria 13082
475 Ga0501034_0017038 3300049571 Bacteria 7450
476 Ga0501034_0293123 3300049571 Bacteria 1564
477 Ga0501034_0723123 3300049571 Bacteria 893
478 Ga0501036_0014568 3300049572 Bacteria 6548
479 Ga0501036_1339987 3300049572 Bacteria 581
480 Ga0501037_0001453 3300049573 Bacteria 17408
481 Ga0501037_0004750 3300049573 Bacteria 9878
482 Ga0501037_0010494 3300049573 Bacteria 6804
483 Ga0501037_0051449 3300049573 Bacteria 3013
484 Ga0501037_0309975 3300049573 Bacteria 1094
485 Ga0501038_0000372 3300049574 Bacteria 38621
486 Ga0501038_0025620 3300049574 Bacteria 5255
487 Ga0501038_0051469 3300049574 Bacteria 3553
488 Ga0501038_0189614 3300049574 Bacteria 1655
489 Ga0501038_0529344 3300049574 Bacteria 899
490 Ga0501039_0002224 3300049575 Bacteria 14352
491 Ga0501039_0014628 3300049575 Bacteria 6006
492 Ga0501039_0034690 3300049575 Bacteria 3892
493 Ga0501039_1269971 3300049575 Bacteria 568
494 Ga0501040_0007714 3300049576 Bacteria 6963
495 Ga0501040_0910302 3300049576 Bacteria 637
496 Ga0501042_0051008 3300049578 Bacteria 2952
497 Ga0501042_0237023 3300049578 Bacteria 1316
498 Ga0501042_0418720 3300049578 Bacteria 971
499 Ga0501043_0003119 3300049579 Bacteria 13748
500 Ga0501043_0008243 3300049579 Bacteria 8212
501 Ga0501043_0032273 3300049579 Bacteria 4117
502 Ga0501043_0051927 3300049579 Bacteria 3221
503 Ga0501043_0109431 3300049579 Bacteria 2170
504 Ga0501043_0110666 3300049579 Bacteria 2156
505 Ga0501043_0219266 3300049579 Bacteria 1472
506 Ga0501043_0748658 3300049579 Bacteria 710
507 Ga0501043_0978513 3300049579 Bacteria 603
508 Ga0501046_0000242 3300049580 Bacteria 56090
509 Ga0501046_0003999 3300049580 Bacteria 13459
510 Ga0501046_0020657 3300049580 Bacteria 5444
511 Ga0501046_0022257 3300049580 Bacteria 5223
512 Ga0501046_0117041 3300049580 Bacteria 2030
513 Ga0501046_0157484 3300049580 Bacteria 1710
514 Ga0501046_0340902 3300049580 Bacteria 1089
515 Ga0501046_0665277 3300049580 Bacteria 735
516 Ga0501047_0004813 3300049581 Bacteria 12696
517 Ga0501047_0005171 3300049581 Bacteria 12245
518 Ga0501047_0022886 3300049581 Bacteria 5999
519 Ga0501047_0026545 3300049581 Bacteria 5573
520 Ga0501047_0118037 3300049581 Bacteria 2534
521 Ga0501047_0149194 3300049581 Bacteria 2214
522 Ga0501047_0260511 3300049581 Bacteria 1582
523 Ga0501047_0262824 3300049581 Bacteria 1573
524 Ga0501047_0317853 3300049581 Bacteria 1397
525 Ga0501048_0032854 3300049582 Bacteria 3749
526 Ga0501048_0053618 3300049582 Bacteria 2867
527 Ga0501048_0056373 3300049582 Bacteria 2788
528 Ga0501067_0000084 3300049583 Bacteria 54706
529 Ga0501067_0001808 3300049583 Bacteria 11761
530 Ga0501067_0048577 3300049583 Bacteria 2353
531 Ga0501067_0069805 3300049583 Bacteria 1945
532 Ga0501068_0000885 3300049584 Bacteria 15629
533 Ga0501068_0090458 3300049584 Bacteria 1888
534 Ga0501068_0100602 3300049584 Bacteria 1791
535 Ga0501068_0156911 3300049584 Bacteria 1433
536 Ga0501068_0205437 3300049584 Bacteria 1250
537 Ga0501068_0238191 3300049584 Unclassified 1158
538 Ga0501069_0000067 3300049585 Bacteria 54874
539 Ga0501069_0004300 3300049585 Bacteria 7360
540 Ga0501069_0012253 3300049585 Bacteria 4556
541 Ga0501070_0000522 3300049586 Bacteria 35229
542 Ga0501070_0005922 3300049586 Bacteria 10427
543 Ga0501070_0031774 3300049586 Bacteria 4422
544 Ga0501070_0274001 3300049586 Bacteria 1377
545 Ga0501070_0408149 3300049586 Bacteria 1098
546 Ga0501070_0888967 3300049586 Bacteria 695
547 Ga0501070_1223996 3300049586 Bacteria 575
548 Ga0501071_0000194 3300049587 Bacteria 27399
549 Ga0501071_0008150 3300049587 Bacteria 6910
550 Ga0501071_0036019 3300049587 Bacteria 3528
551 Ga0501072_0000039 3300049588 Bacteria 113463
552 Ga0501072_0002408 3300049588 Bacteria 14031
553 Ga0501073_0000175 3300049589 Bacteria 42009
554 Ga0501073_0000241 3300049589 Bacteria 36036
555 Ga0501073_0001173 3300049589 Bacteria 19136
556 Ga0501073_0060845 3300049589 Bacteria 2635
557 Ga0501073_0123379 3300049589 Bacteria 1795
558 Ga0501073_0131116 3300049589 Bacteria 1737
559 Ga0501073_0919557 3300049589 Bacteria 602
560 Ga0501073_0969845 3300049589 Bacteria 585
561 Ga0501074_0000311 3300049590 Bacteria 28230
562 Ga0501074_0005524 3300049590 Bacteria 9096
563 Ga0501074_0023385 3300049590 Bacteria 4493
564 Ga0501074_0098859 3300049590 Bacteria 2089
565 Ga0501074_0115600 3300049590 Bacteria 1919
566 Ga0501074_0174612 3300049590 Bacteria 1533
567 Ga0501074_0199390 3300049590 Bacteria 1426
568 Ga0501076_0333138 3300049592 Bacteria 1245
569 Ga0501076_1337455 3300049592 Bacteria 589
570 Ga0501076_1728559 3300049592 Bacteria 513
571 Ga0501077_0078924 3300049593 Bacteria 2086
572 Ga0501079_0043557 3300049741 Bacteria 3464
573 Ga0501079_0064536 3300049741 Bacteria 2825
574 Ga0501079_0130512 3300049741 Bacteria 1955
575 Ga0501079_0151142 3300049741 Bacteria 1810
576 Ga0501079_0936040 3300049741 Bacteria 682
577 Ga0501080_0000259 3300049742 Bacteria 40024
578 Ga0501080_0007456 3300049742 Bacteria 9875
579 Ga0501080_0008430 3300049742 Bacteria 9337
580 Ga0501080_0012653 3300049742 Bacteria 7737
581 Ga0501080_0023645 3300049742 Bacteria 5693
582 Ga0501080_0033400 3300049742 Bacteria 4801
583 Ga0501080_0067853 3300049742 Bacteria 3317
584 Ga0501080_0172454 3300049742 Bacteria 1994
585 Ga0501080_0602497 3300049742 Bacteria 975
586 Ga0501080_1031238 3300049742 Bacteria 712
587 Ga0501081_0859984 3300049743 Bacteria 683
588 Ga0501083_0000108 3300049744 Bacteria 55825
589 Ga0501083_0000670 3300049744 Bacteria 22251
590 Ga0501083_0008194 3300049744 Bacteria 7394
591 Ga0501083_0102663 3300049744 Bacteria 1885
592 Ga0501035_0003146 3300049822 Bacteria 15853
593 Ga0501035_0036161 3300049822 Bacteria 4477
594 Ga0501035_0078536 3300049822 Bacteria 2915
595 Ga0501035_0122685 3300049822 Bacteria 2270
596 Ga0501035_0615756 3300049822 Bacteria 883
597 Ga0501035_0798243 3300049822 Bacteria 754
598 Ga0501044_0005560 3300049823 Bacteria 13993
599 Ga0501044_0024085 3300049823 Bacteria 6467
600 Ga0501044_0032632 3300049823 Bacteria 5473
601 Ga0501044_0100640 3300049823 Bacteria 2908
602 Ga0501044_0103286 3300049823 Bacteria 2865
603 Ga0501044_0140228 3300049823 Bacteria 2406
604 Ga0501044_0232503 3300049823 Unclassified 1790
605 Ga0501044_0755226 3300049823 Bacteria 854
606 nmdc:mga00v17_167859_c2 3300050491 Bacteria 807
607 nmdc:mga0yw44_4350_c1 3300050492 Bacteria 6476
608 Ga0500610_0001342 3300053079 Bacteria 8303
609 Ga0500651_0000033 3300053093 Bacteria 108567
610 Ga0500651_0030295 3300053093 Bacteria 3403
611 Ga0500651_0076006 3300053093 Bacteria 2086
612 Ga0500556_0149071 3300053104 Bacteria 921
613 Ga0500597_000119 3300053120 Bacteria 16111
614 Ga0500559_0089398 3300053136 Bacteria 1409
615 Ga0500568_0004134 3300053139 Bacteria 7853
616 Ga0500573_0004462 3300053140 Bacteria 7381
617 Ga0500603_135584 3300053150 Bacteria 755
618 Ga0501084_0000845 3300054114 Bacteria 23657
619 Ga0501084_0010100 3300054114 Bacteria 7802
620 Ga0501084_0098277 3300054114 Bacteria 2458
621 Ga0501084_0123687 3300054114 Bacteria 2176
622 Ga0501084_0150384 3300054114 Bacteria 1962
623 Ga0501084_0171852 3300054114 Bacteria 1829
624 Ga0501084_1794042 3300054114 Bacteria 512
625 Ga0501082_0000449 3300060353 Bacteria 36432
626 Ga0501082_0000776 3300060353 Bacteria 27992
627 Ga0501082_0005143 3300060353 Bacteria 11387
628 Ga0501082_0047810 3300060353 Bacteria 3687
629 Ga0501082_0054543 3300060353 Bacteria 3445
630 Ga0501082_0129500 3300060353 Bacteria 2189
631 Ga0501082_1128658 3300060353 Bacteria 685
632 Ga0530510_0144198 3300061734 Bacteria 1756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_101108390 Ga0068858_1011083901 118
2 3300026095 Ga0207676_10208578 Ga0207676_102085783 118
3 3300005618 Ga0068864_100133393 Ga0068864_1001333933 119
4 3300005841 Ga0068863_100058294 Ga0068863_1000582943 119
5 3300026088 Ga0207641_10029249 Ga0207641_100292494 119
6 3300026095 Ga0207676_10014463 Ga0207676_100144636 119
7 3300035088 Ga0373940_0221117 Ga0373940_0221117_25_450 119
8 3300048907 Ga0496104_0269143 Ga0496104_0269143_866_1291 119
9 3300048911 Ga0496108_0019892 Ga0496108_0019892_640_1065 119
10 3300048912 Ga0496109_0013140 Ga0496109_0013140_639_1064 119
11 3300048913 Ga0496110_0135621 Ga0496110_0135621_1009_1434 119
12 3300048915 Ga0496112_0002481 Ga0496112_0002481_9397_9822 119
13 3300048916 Ga0496113_0075700 Ga0496113_0075700_453_878 119
14 3300048905 Ga0496102_0073671 Ga0496102_0073671_546_977 120
15 3300048909 Ga0496106_0130130 Ga0496106_0130130_216_647 120
16 3300014325 Ga0163163_10035944 Ga0163163_100359443 121
17 3300034817 Ga0373948_0034279 Ga0373948_0034279_268_699 121
18 3300035084 Ga0373928_0039412 Ga0373928_0039412_567_998 121
19 3300035085 Ga0373929_0011053 Ga0373929_0011053_635_1066 121
20 3300035088 Ga0373940_0040143 Ga0373940_0040143_527_958 121
21 3300035114 Ga0373939_0027738 Ga0373939_0027738_109_540 121
22 3300035115 Ga0373941_0067501 Ga0373941_0067501_68_499 121
23 3300035691 Ga0373931_0322736 Ga0373931_0322736_344_775 121
24 3300048907 Ga0496104_0072055 Ga0496104_0072055_2600_3031 121
25 3300048908 Ga0496105_0138319 Ga0496105_0138319_1013_1444 121
26 3300048911 Ga0496108_0001062 Ga0496108_0001062_634_1065 121
27 3300048912 Ga0496109_0002437 Ga0496109_0002437_6365_6796 121
28 3300048913 Ga0496110_0393357 Ga0496110_0393357_591_1022 121
29 3300048914 Ga0496111_0023417 Ga0496111_0023417_615_1046 121
30 3300048915 Ga0496112_0000975 Ga0496112_0000975_19821_20252 121
31 3300048916 Ga0496113_0000793 Ga0496113_0000793_15366_15797 121
32 3300034820 Ga0373959_0010244 Ga0373959_0010244_46_483 122
33 3300025928 Ga0207700_10968406 Ga0207700_109684062 132
34 3300048903 Ga0496100_0048609 Ga0496100_0048609_1382_1807 132
35 3300048904 Ga0496101_0122087 Ga0496101_0122087_375_800 132
36 3300048905 Ga0496102_0823504 Ga0496102_0823504_214_639 132
37 3300048909 Ga0496106_0235658 Ga0496106_0235658_557_982 132
38 3300048917 Ga0496114_0031369 Ga0496114_0031369_1214_1639 132
39 3300048918 Ga0496115_0358365 Ga0496115_0358365_491_916 133
40 3300006038 Ga0075365_10002175 Ga0075365_100021755 136
41 3300006051 Ga0075364_10144886 Ga0075364_101448862 136
42 3300049568 Ga0501031_0258905 Ga0501031_0258905_632_1042 136
43 3300049569 Ga0501032_0740633 Ga0501032_0740633_125_535 136
44 3300049571 Ga0501034_0000451 Ga0501034_0000451_11448_11906 136
45 3300049571 Ga0501034_0004236 Ga0501034_0004236_12941_13351 136
46 3300049573 Ga0501037_0010494 Ga0501037_0010494_6058_6468 136
47 3300049578 Ga0501042_0418720 Ga0501042_0418720_187_618 136
48 3300049580 Ga0501046_0157484 Ga0501046_0157484_139_549 136
49 3300049581 Ga0501047_0026545 Ga0501047_0026545_1566_1976 136
50 3300049581 Ga0501047_0262824 Ga0501047_0262824_208_666 136
51 3300049583 Ga0501067_0000084 Ga0501067_0000084_39695_40153 136
52 3300049584 Ga0501068_0000885 Ga0501068_0000885_11067_11525 136
53 3300049584 Ga0501068_0090458 Ga0501068_0090458_1407_1817 136
54 3300049585 Ga0501069_0000067 Ga0501069_0000067_39618_40076 136
55 3300049586 Ga0501070_0000522 Ga0501070_0000522_20212_20670 136
56 3300049587 Ga0501071_0000194 Ga0501071_0000194_12410_12868 136
57 3300049588 Ga0501072_0000039 Ga0501072_0000039_16168_16626 136
58 3300049589 Ga0501073_0000175 Ga0501073_0000175_1857_2315 136
59 3300049589 Ga0501073_0123379 Ga0501073_0123379_660_1070 136
60 3300049590 Ga0501074_0000311 Ga0501074_0000311_11709_12167 136
61 3300049590 Ga0501074_0174612 Ga0501074_0174612_155_565 136
62 3300049592 Ga0501076_0333138 Ga0501076_0333138_671_1129 136
63 3300049592 Ga0501076_1337455 Ga0501076_1337455_49_480 136
64 3300049741 Ga0501079_0130512 Ga0501079_0130512_860_1270 136
65 3300049741 Ga0501079_0151142 Ga0501079_0151142_1116_1574 136
66 3300049742 Ga0501080_0023645 Ga0501080_0023645_3379_3837 136
67 3300049742 Ga0501080_0067853 Ga0501080_0067853_1798_2208 136
68 3300049744 Ga0501083_0000108 Ga0501083_0000108_50491_50949 136
69 3300049822 Ga0501035_0798243 Ga0501035_0798243_188_646 136
70 3300049823 Ga0501044_0032632 Ga0501044_0032632_4749_5159 136
71 3300050491 nmdc:mga00v17_167859_c2 nmdc:mga00v17_167859_c2_127_555 136
72 3300050492 nmdc:mga0yw44_4350_c1 nmdc:mga0yw44_4350_c1_3689_4117 136
73 3300053140 Ga0500573_0004462 Ga0500573_0004462_98_526 136
74 3300054114 Ga0501084_0000845 Ga0501084_0000845_11510_11968 136
75 3300054114 Ga0501084_0123687 Ga0501084_0123687_304_714 136
76 3300060353 Ga0501082_0000449 Ga0501082_0000449_21415_21873 136
77 3300005331 Ga0070670_100778762 Ga0070670_1007787621 137
78 3300005347 Ga0070668_100120413 Ga0070668_1001204134 137
79 3300005367 Ga0070667_100031478 Ga0070667_1000314784 137
80 3300005367 Ga0070667_100115376 Ga0070667_1001153763 137
81 3300005436 Ga0070713_100351369 Ga0070713_1003513692 137
82 3300005439 Ga0070711_100015700 Ga0070711_1000157006 137
83 3300005458 Ga0070681_10927509 Ga0070681_109275091 137
84 3300005530 Ga0070679_100172504 Ga0070679_1001725043 137
85 3300005539 Ga0068853_100006658 Ga0068853_1000066589 137
86 3300005539 Ga0068853_100146493 Ga0068853_1001464931 137
87 3300005548 Ga0070665_100000512 Ga0070665_10000051235 137
88 3300005563 Ga0068855_101178444 Ga0068855_1011784441 137
89 3300005564 Ga0070664_100861316 Ga0070664_1008613163 137
90 3300005844 Ga0068862_100494678 Ga0068862_1004946783 137
91 3300005937 Ga0081455_10222393 Ga0081455_102223934 137
92 3300006175 Ga0070712_101311980 Ga0070712_1013119802 137
93 3300006237 Ga0097621_100382807 Ga0097621_1003828072 137
94 3300009545 Ga0105237_10772758 Ga0105237_107727582 137
95 3300025915 Ga0207693_10198330 Ga0207693_101983302 137
96 3300025920 Ga0207649_10015154 Ga0207649_100151542 137
97 3300025949 Ga0207667_10174314 Ga0207667_101743141 137
98 3300025972 Ga0207668_10302137 Ga0207668_103021373 137
99 3300025986 Ga0207658_10003668 Ga0207658_1000366812 137
100 3300025986 Ga0207658_10152420 Ga0207658_101524204 137
101 3300026041 Ga0207639_10227842 Ga0207639_102278422 137
102 3300026116 Ga0207674_10022832 Ga0207674_100228329 137
103 3300028379 Ga0268266_10000001 Ga0268266_100000012610 137
104 3300028379 Ga0268266_10375934 Ga0268266_103759343 137
105 3300028379 Ga0268266_11200672 Ga0268266_112006722 137
106 3300028380 Ga0268265_10019820 Ga0268265_100198201 137
107 3300031852 Ga0307410_10090736 Ga0307410_100907361 137
108 3300041486 Ga0451807_1245602 Ga0451807_1245602_184_597 137
109 3300044673 Ga0453683_0124980 Ga0453683_0124980_223_636 137
110 3300046459 Ga0495629_0403400 Ga0495629_0403400_61_474 137
111 3300046675 Ga0495657_0847925 Ga0495657_0847925_58_471 137
112 3300048920 Ga0496117_0059216 Ga0496117_0059216_510_926 137
113 3300049569 Ga0501032_0557900 Ga0501032_0557900_191_604 137
114 3300049571 Ga0501034_0723123 Ga0501034_0723123_413_826 137
115 3300049574 Ga0501038_0189614 Ga0501038_0189614_61_489 137
116 3300049578 Ga0501042_0237023 Ga0501042_0237023_168_581 137
117 3300049579 Ga0501043_0109431 Ga0501043_0109431_1387_1800 137
118 3300049580 Ga0501046_0022257 Ga0501046_0022257_227_640 137
119 3300049584 Ga0501068_0205437 Ga0501068_0205437_497_916 137
120 3300049741 Ga0501079_0064536 Ga0501079_0064536_940_1353 137
121 3300049741 Ga0501079_0936040 Ga0501079_0936040_163_576 137
122 3300049742 Ga0501080_0172454 Ga0501080_0172454_1142_1555 137
123 3300049742 Ga0501080_1031238 Ga0501080_1031238_90_503 137
124 3300049822 Ga0501035_0615756 Ga0501035_0615756_224_637 137
125 3300049823 Ga0501044_0103286 Ga0501044_0103286_1556_1969 137
126 3300053104 Ga0500556_0149071 Ga0500556_0149071_392_805 137
127 3300053136 Ga0500559_0089398 Ga0500559_0089398_382_795 137
128 3300053139 Ga0500568_0004134 Ga0500568_0004134_5631_6044 137
129 3300054114 Ga0501084_0010100 Ga0501084_0010100_6729_7142 137
130 3300060353 Ga0501082_0000776 Ga0501082_0000776_12915_13328 137
131 3300005367 Ga0070667_100225722 Ga0070667_1002257222 138
132 3300005539 Ga0068853_100000780 Ga0068853_10000078014 138
133 3300005563 Ga0068855_100565509 Ga0068855_1005655093 138
134 3300005577 Ga0068857_100708434 Ga0068857_1007084342 138
135 3300009098 Ga0105245_10402190 Ga0105245_104021902 138
136 3300010375 Ga0105239_10022173 Ga0105239_100221732 138
137 3300025303 Ga0209051_1009216 Ga0209051_10092164 138
138 3300025927 Ga0207687_10194899 Ga0207687_101948991 138
139 3300025949 Ga0207667_10117688 Ga0207667_101176885 138
140 3300025986 Ga0207658_10319039 Ga0207658_103190392 138
141 3300026041 Ga0207639_10000319 Ga0207639_1000031910 138
142 3300026041 Ga0207639_10314916 Ga0207639_103149163 138
143 3300026116 Ga0207674_10325803 Ga0207674_103258032 138
144 3300026116 Ga0207674_10703012 Ga0207674_107030122 138
145 3300046616 Ga0495668_0269800 Ga0495668_0269800_138_554 138
146 3300047318 Ga0495636_0210896 Ga0495636_0210896_345_761 138
147 3300049568 Ga0501031_0012252 Ga0501031_0012252_4115_4552 138
148 3300049569 Ga0501032_0004319 Ga0501032_0004319_2410_2847 138
149 3300049570 Ga0501033_0005181 Ga0501033_0005181_2592_3029 138
150 3300049571 Ga0501034_0006042 Ga0501034_0006042_10054_10491 138
151 3300049573 Ga0501037_0004750 Ga0501037_0004750_4824_5261 138
152 3300049574 Ga0501038_0000372 Ga0501038_0000372_708_1145 138
153 3300049575 Ga0501039_0014628 Ga0501039_0014628_744_1181 138
154 3300049576 Ga0501040_0910302 Ga0501040_0910302_129_566 138
155 3300049579 Ga0501043_0003119 Ga0501043_0003119_10091_10528 138
156 3300049580 Ga0501046_0000242 Ga0501046_0000242_9077_9514 138
157 3300049581 Ga0501047_0004813 Ga0501047_0004813_3033_3470 138
158 3300049582 Ga0501048_0053618 Ga0501048_0053618_1970_2407 138
159 3300049586 Ga0501070_0888967 Ga0501070_0888967_163_579 138
160 3300049589 Ga0501073_0000241 Ga0501073_0000241_18907_19344 138
161 3300049589 Ga0501073_0919557 Ga0501073_0919557_32_448 138
162 3300049589 Ga0501073_0969845 Ga0501073_0969845_20_436 138
163 3300049590 Ga0501074_0023385 Ga0501074_0023385_2449_2865 138
164 3300049742 Ga0501080_0008430 Ga0501080_0008430_7739_8176 138
165 3300049742 Ga0501080_0033400 Ga0501080_0033400_4246_4662 138
166 3300049822 Ga0501035_0003146 Ga0501035_0003146_4338_4775 138
167 3300049823 Ga0501044_0140228 Ga0501044_0140228_1151_1588 138
168 3300054114 Ga0501084_1794042 Ga0501084_1794042_14_430 138
169 3300060353 Ga0501082_1128658 Ga0501082_1128658_88_504 138
170 3300005347 Ga0070668_100186138 Ga0070668_1001861382 139
171 3300005367 Ga0070667_100102637 Ga0070667_1001026374 139
172 3300005548 Ga0070665_100063679 Ga0070665_1000636792 139
173 3300005548 Ga0070665_100112844 Ga0070665_1001128444 139
174 3300005617 Ga0068859_100000109 Ga0068859_10000010946 139
175 3300005834 Ga0068851_10020920 Ga0068851_100209202 139
176 3300005844 Ga0068862_100000197 Ga0068862_10000019757 139
177 3300006237 Ga0097621_101266920 Ga0097621_1012669201 139
178 3300006931 Ga0097620_100000109 Ga0097620_10000010946 139
179 3300009093 Ga0105240_10007745 Ga0105240_1000774519 139
180 3300009101 Ga0105247_10088136 Ga0105247_100881362 139
181 3300009177 Ga0105248_10380703 Ga0105248_103807032 139
182 3300009545 Ga0105237_10039315 Ga0105237_100393152 139
183 3300013104 Ga0157370_10352429 Ga0157370_103524292 139
184 3300013105 Ga0157369_10249307 Ga0157369_102493073 139
185 3300013307 Ga0157372_10030618 Ga0157372_100306182 139
186 3300014969 Ga0157376_10614582 Ga0157376_106145821 139
187 3300025321 Ga0207656_10035638 Ga0207656_100356384 139
188 3300025913 Ga0207695_10043274 Ga0207695_100432747 139
189 3300025914 Ga0207671_10021844 Ga0207671_100218446 139
190 3300025972 Ga0207668_10016283 Ga0207668_100162837 139
191 3300028379 Ga0268266_10141130 Ga0268266_101411303 139
192 3300028380 Ga0268265_10000153 Ga0268265_1000015381 139
193 3300028381 Ga0268264_10225514 Ga0268264_102255144 139
194 3300028786 Ga0307517_10177528 Ga0307517_101775282 139
195 3300037312 Ga0395899_0097343 Ga0395899_0097343_800_1222 139
196 3300037418 Ga0395900_0056989 Ga0395900_0056989_2464_2886 139
197 3300037471 Ga0395905_0000630 Ga0395905_0000630_43533_43955 139
198 3300038443 Ga0395901_0816971 Ga0395901_0816971_111_533 139
199 3300046694 Ga0495649_0236628 Ga0495649_0236628_434_853 139
200 3300049569 Ga0501032_0085984 Ga0501032_0085984_254_673 139
201 3300049579 Ga0501043_0032273 Ga0501043_0032273_215_634 139
202 3300049586 Ga0501070_0408149 Ga0501070_0408149_290_709 139
203 3300049822 Ga0501035_0078536 Ga0501035_0078536_810_1229 139
204 3300053093 Ga0500651_0076006 Ga0500651_0076006_298_717 139
205 3300005331 Ga0070670_100117766 Ga0070670_1001177664 140
206 3300005335 Ga0070666_10000349 Ga0070666_100003497 140
207 3300005335 Ga0070666_10473874 Ga0070666_104738742 140
208 3300005338 Ga0068868_100386165 Ga0068868_1003861652 140
209 3300005344 Ga0070661_100176189 Ga0070661_1001761893 140
210 3300005367 Ga0070667_100156717 Ga0070667_1001567174 140
211 3300005455 Ga0070663_100006777 Ga0070663_1000067777 140
212 3300005457 Ga0070662_100010885 Ga0070662_1000108854 140
213 3300005459 Ga0068867_100305189 Ga0068867_1003051893 140
214 3300005548 Ga0070665_100000227 Ga0070665_1000002274 140
215 3300005548 Ga0070665_100309634 Ga0070665_1003096342 140
216 3300005578 Ga0068854_100184914 Ga0068854_1001849141 140
217 3300005614 Ga0068856_100396781 Ga0068856_1003967814 140
218 3300005616 Ga0068852_100080239 Ga0068852_1000802393 140
219 3300005618 Ga0068864_101759409 Ga0068864_1017594091 140
220 3300005841 Ga0068863_100503415 Ga0068863_1005034153 140
221 3300005842 Ga0068858_100001840 Ga0068858_10000184023 140
222 3300009093 Ga0105240_10063857 Ga0105240_100638572 140
223 3300009174 Ga0105241_10180394 Ga0105241_101803943 140
224 3300009177 Ga0105248_11099768 Ga0105248_110997681 140
225 3300009545 Ga0105237_10632068 Ga0105237_106320683 140
226 3300009545 Ga0105237_11402985 Ga0105237_114029852 140
227 3300009551 Ga0105238_10018113 Ga0105238_100181135 140
228 3300009553 Ga0105249_10060344 Ga0105249_100603443 140
229 3300010375 Ga0105239_10278808 Ga0105239_102788083 140
230 3300013307 Ga0157372_10041801 Ga0157372_100418015 140
231 3300025903 Ga0207680_10020535 Ga0207680_100205353 140
232 3300025904 Ga0207647_10035304 Ga0207647_100353044 140
233 3300025911 Ga0207654_10119440 Ga0207654_101194402 140
234 3300025913 Ga0207695_10047016 Ga0207695_100470167 140
235 3300025913 Ga0207695_10123730 Ga0207695_101237302 140
236 3300025914 Ga0207671_10128033 Ga0207671_101280333 140
237 3300025920 Ga0207649_10167226 Ga0207649_101672263 140
238 3300025924 Ga0207694_10007420 Ga0207694_100074206 140
239 3300025925 Ga0207650_10088317 Ga0207650_100883172 140
240 3300025931 Ga0207644_10893169 Ga0207644_108931691 140
241 3300025933 Ga0207706_10001116 Ga0207706_1000111626 140
242 3300025941 Ga0207711_10642405 Ga0207711_106424052 140
243 3300025949 Ga0207667_10278772 Ga0207667_102787723 140
244 3300025961 Ga0207712_10000302 Ga0207712_100003028 140
245 3300025981 Ga0207640_10004856 Ga0207640_100048569 140
246 3300026023 Ga0207677_10070758 Ga0207677_100707583 140
247 3300026035 Ga0207703_10000456 Ga0207703_1000045624 140
248 3300026041 Ga0207639_10004122 Ga0207639_100041229 140
249 3300026067 Ga0207678_10004648 Ga0207678_1000464812 140
250 3300026078 Ga0207702_10123545 Ga0207702_101235453 140
251 3300026088 Ga0207641_10310344 Ga0207641_103103443 140
252 3300026089 Ga0207648_10054124 Ga0207648_100541244 140
253 3300026095 Ga0207676_11331863 Ga0207676_113318632 140
254 3300026142 Ga0207698_10112971 Ga0207698_101129713 140
255 3300028379 Ga0268266_10000006 Ga0268266_10000006698 140
256 3300028379 Ga0268266_10338979 Ga0268266_103389793 140
257 3300005328 Ga0070676_10216840 Ga0070676_102168402 141
258 3300005340 Ga0070689_102055365 Ga0070689_1020553651 141
259 3300005367 Ga0070667_100290116 Ga0070667_1002901162 141
260 3300005539 Ga0068853_100479646 Ga0068853_1004796463 141
261 3300005548 Ga0070665_100969719 Ga0070665_1009697192 141
262 3300005843 Ga0068860_100009878 Ga0068860_1000098789 141
263 3300009545 Ga0105237_10018912 Ga0105237_100189123 141
264 3300010375 Ga0105239_10068918 Ga0105239_100689184 141
265 3300010375 Ga0105239_13023043 Ga0105239_130230431 141
266 3300013308 Ga0157375_11103678 Ga0157375_111036782 141
267 3300025261 Ga0209233_1002219 Ga0209233_10022198 141
268 3300025909 Ga0207705_10430214 Ga0207705_104302142 141
269 3300025920 Ga0207649_10484789 Ga0207649_104847893 141
270 3300025936 Ga0207670_11700916 Ga0207670_117009161 141
271 3300026041 Ga0207639_10277026 Ga0207639_102770263 141
272 3300028381 Ga0268264_10005234 Ga0268264_100052343 141
273 3300041459 Ga0451800_1677929 Ga0451800_1677929_17_460 141
274 3300041494 Ga0451837_0499961 Ga0451837_0499961_56_484 141
275 3300005330 Ga0070690_100171030 Ga0070690_1001710303 142
276 3300005365 Ga0070688_100134226 Ga0070688_1001342264 142
277 3300005466 Ga0070685_10136070 Ga0070685_101360701 142
278 3300005539 Ga0068853_100006385 Ga0068853_1000063858 142
279 3300005563 Ga0068855_101036172 Ga0068855_1010361722 142
280 3300005614 Ga0068856_100001386 Ga0068856_1000013864 142
281 3300005616 Ga0068852_100120763 Ga0068852_1001207632 142
282 3300005616 Ga0068852_100587844 Ga0068852_1005878441 142
283 3300005617 Ga0068859_100268523 Ga0068859_1002685232 142
284 3300005618 Ga0068864_100049105 Ga0068864_1000491054 142
285 3300005841 Ga0068863_100000329 Ga0068863_10000032950 142
286 3300005843 Ga0068860_100024054 Ga0068860_1000240546 142
287 3300006931 Ga0097620_100268507 Ga0097620_1002685072 142
288 3300009093 Ga0105240_10001318 Ga0105240_1000131817 142
289 3300009174 Ga0105241_11519314 Ga0105241_115193142 142
290 3300009545 Ga0105237_10243815 Ga0105237_102438152 142
291 3300009551 Ga0105238_10085564 Ga0105238_100855643 142
292 3300010375 Ga0105239_10111889 Ga0105239_101118894 142
293 3300025911 Ga0207654_10710164 Ga0207654_107101642 142
294 3300025913 Ga0207695_10000007 Ga0207695_1000000760 142
295 3300025914 Ga0207671_10130905 Ga0207671_101309052 142
296 3300025941 Ga0207711_10198563 Ga0207711_101985633 142
297 3300025942 Ga0207689_11018872 Ga0207689_110188721 142
298 3300025949 Ga0207667_10872609 Ga0207667_108726091 142
299 3300025981 Ga0207640_10461634 Ga0207640_104616342 142
300 3300026041 Ga0207639_10008534 Ga0207639_100085343 142
301 3300026078 Ga0207702_10004222 Ga0207702_100042223 142
302 3300026088 Ga0207641_10012486 Ga0207641_100124864 142
303 3300026095 Ga0207676_10050668 Ga0207676_100506684 142
304 3300026142 Ga0207698_10021084 Ga0207698_100210843 142
305 3300026142 Ga0207698_10814766 Ga0207698_108147663 142
306 3300028381 Ga0268264_10008335 Ga0268264_100083355 142
307 3300031824 Ga0307413_10210349 Ga0307413_102103494 142
308 3300031903 Ga0307407_10593592 Ga0307407_105935923 142
309 3300048920 Ga0496117_0079841 Ga0496117_0079841_1579_2019 142
310 3300048921 Ga0496118_0018596 Ga0496118_0018596_5021_5461 142
311 3300049568 Ga0501031_0178683 Ga0501031_0178683_62_490 142
312 3300049569 Ga0501032_0005979 Ga0501032_0005979_1504_1932 142
313 3300049569 Ga0501032_0120774 Ga0501032_0120774_266_694 142
314 3300049570 Ga0501033_0000467 Ga0501033_0000467_23929_24357 142
315 3300049571 Ga0501034_0005990 Ga0501034_0005990_8599_9027 142
316 3300049571 Ga0501034_0017038 Ga0501034_0017038_1852_2280 142
317 3300049571 Ga0501034_0293123 Ga0501034_0293123_692_1120 142
318 3300049572 Ga0501036_0014568 Ga0501036_0014568_4416_4844 142
319 3300049572 Ga0501036_1339987 Ga0501036_1339987_27_455 142
320 3300049573 Ga0501037_0001453 Ga0501037_0001453_15699_16127 142
321 3300049574 Ga0501038_0025620 Ga0501038_0025620_2182_2610 142
322 3300049574 Ga0501038_0051469 Ga0501038_0051469_692_1120 142
323 3300049574 Ga0501038_0529344 Ga0501038_0529344_131_559 142
324 3300049575 Ga0501039_0002224 Ga0501039_0002224_3697_4125 142
325 3300049575 Ga0501039_0034690 Ga0501039_0034690_1209_1637 142
326 3300049576 Ga0501040_0007714 Ga0501040_0007714_5387_5815 142
327 3300049578 Ga0501042_0051008 Ga0501042_0051008_1341_1769 142
328 3300049579 Ga0501043_0008243 Ga0501043_0008243_2614_3042 142
329 3300049579 Ga0501043_0110666 Ga0501043_0110666_1203_1631 142
330 3300049579 Ga0501043_0219266 Ga0501043_0219266_200_628 142
331 3300049579 Ga0501043_0748658 Ga0501043_0748658_17_445 142
332 3300049580 Ga0501046_0003999 Ga0501046_0003999_2904_3332 142
333 3300049580 Ga0501046_0117041 Ga0501046_0117041_573_1001 142
334 3300049580 Ga0501046_0340902 Ga0501046_0340902_564_992 142
335 3300049580 Ga0501046_0665277 Ga0501046_0665277_200_628 142
336 3300049581 Ga0501047_0005171 Ga0501047_0005171_5667_6095 142
337 3300049581 Ga0501047_0118037 Ga0501047_0118037_18_446 142
338 3300049581 Ga0501047_0149194 Ga0501047_0149194_445_873 142
339 3300049581 Ga0501047_0260511 Ga0501047_0260511_941_1369 142
340 3300049581 Ga0501047_0317853 Ga0501047_0317853_934_1362 142
341 3300049582 Ga0501048_0032854 Ga0501048_0032854_2425_2853 142
342 3300049582 Ga0501048_0056373 Ga0501048_0056373_1932_2360 142
343 3300049583 Ga0501067_0001808 Ga0501067_0001808_4901_5329 142
344 3300049583 Ga0501067_0048577 Ga0501067_0048577_552_980 142
345 3300049583 Ga0501067_0069805 Ga0501067_0069805_1220_1648 142
346 3300049584 Ga0501068_0100602 Ga0501068_0100602_661_1089 142
347 3300049584 Ga0501068_0238191 Ga0501068_0238191_218_646 142
348 3300049585 Ga0501069_0004300 Ga0501069_0004300_6296_6724 142
349 3300049585 Ga0501069_0012253 Ga0501069_0012253_3556_3984 142
350 3300049586 Ga0501070_0005922 Ga0501070_0005922_5667_6095 142
351 3300049586 Ga0501070_0031774 Ga0501070_0031774_3340_3768 142
352 3300049586 Ga0501070_0274001 Ga0501070_0274001_18_446 142
353 3300049586 Ga0501070_1223996 Ga0501070_1223996_130_558 142
354 3300049587 Ga0501071_0008150 Ga0501071_0008150_1073_1501 142
355 3300049587 Ga0501071_0036019 Ga0501071_0036019_1752_2180 142
356 3300049588 Ga0501072_0002408 Ga0501072_0002408_6599_7027 142
357 3300049589 Ga0501073_0001173 Ga0501073_0001173_11145_11573 142
358 3300049589 Ga0501073_0060845 Ga0501073_0060845_503_931 142
359 3300049589 Ga0501073_0131116 Ga0501073_0131116_865_1293 142
360 3300049590 Ga0501074_0005524 Ga0501074_0005524_5491_5919 142
361 3300049590 Ga0501074_0115600 Ga0501074_0115600_196_624 142
362 3300049590 Ga0501074_0199390 Ga0501074_0199390_467_895 142
363 3300049593 Ga0501077_0078924 Ga0501077_0078924_453_881 142
364 3300049741 Ga0501079_0043557 Ga0501079_0043557_1616_2044 142
365 3300049742 Ga0501080_0007456 Ga0501080_0007456_5667_6095 142
366 3300049742 Ga0501080_0012653 Ga0501080_0012653_4696_5124 142
367 3300049743 Ga0501081_0859984 Ga0501081_0859984_85_513 142
368 3300049744 Ga0501083_0000670 Ga0501083_0000670_6215_6643 142
369 3300049744 Ga0501083_0008194 Ga0501083_0008194_1557_1985 142
370 3300049744 Ga0501083_0102663 Ga0501083_0102663_124_552 142
371 3300049822 Ga0501035_0036161 Ga0501035_0036161_1705_2133 142
372 3300049822 Ga0501035_0122685 Ga0501035_0122685_1457_1885 142
373 3300049823 Ga0501044_0005560 Ga0501044_0005560_1101_1529 142
374 3300049823 Ga0501044_0024085 Ga0501044_0024085_869_1297 142
375 3300049823 Ga0501044_0232503 Ga0501044_0232503_1215_1643 142
376 3300054114 Ga0501084_0098277 Ga0501084_0098277_1985_2413 142
377 3300054114 Ga0501084_0171852 Ga0501084_0171852_412_840 142
378 3300060353 Ga0501082_0005143 Ga0501082_0005143_5306_5734 142
379 3300060353 Ga0501082_0047810 Ga0501082_0047810_322_750 142
380 3300060353 Ga0501082_0054543 Ga0501082_0054543_633_1061 142
381 3300061734 Ga0530510_0144198 Ga0530510_0144198_505_933 142
382 3300005539 Ga0068853_100120840 Ga0068853_1001208404 143
383 3300005616 Ga0068852_100432359 Ga0068852_1004323592 143
384 3300006358 Ga0068871_100485633 Ga0068871_1004856331 143
385 3300009177 Ga0105248_10317496 Ga0105248_103174963 143
386 3300013104 Ga0157370_10015119 Ga0157370_100151198 143
387 3300014325 Ga0163163_10001571 Ga0163163_1000157115 143
388 3300014968 Ga0157379_10003082 Ga0157379_1000308213 143
389 3300014969 Ga0157376_10064239 Ga0157376_100642392 143
390 3300025918 Ga0207662_10220781 Ga0207662_102207813 143
391 3300026142 Ga0207698_11305856 Ga0207698_113058562 143
392 3300031730 Ga0307516_10047197 Ga0307516_100471974 143
393 3300041486 Ga0451807_1271362 Ga0451807_1271362_2741_3175 143
394 3300049579 Ga0501043_0051927 Ga0501043_0051927_2066_2497 143
395 3300049580 Ga0501046_0020657 Ga0501046_0020657_4119_4550 143
396 3300049581 Ga0501047_0022886 Ga0501047_0022886_541_972 143
397 3300049592 Ga0501076_1728559 Ga0501076_1728559_63_494 143
398 3300049742 Ga0501080_0000259 Ga0501080_0000259_11407_11838 143
399 3300054114 Ga0501084_0150384 Ga0501084_0150384_1486_1917 143
400 3300060353 Ga0501082_0129500 Ga0501082_0129500_295_726 143
401 3300009174 Ga0105241_11494287 Ga0105241_114942872 144
402 3300009551 Ga0105238_10039009 Ga0105238_100390095 144
403 3300009553 Ga0105249_11189397 Ga0105249_111893971 144
404 3300010375 Ga0105239_10012446 Ga0105239_1001244611 144
405 3300013296 Ga0157374_10121405 Ga0157374_101214052 144
406 3300025906 Ga0207699_11030694 Ga0207699_110306942 144
407 3300025911 Ga0207654_10647681 Ga0207654_106476812 144
408 3300025924 Ga0207694_10110655 Ga0207694_101106554 144
409 3300031507 Ga0307509_10127177 Ga0307509_101271774 144
410 3300033179 Ga0307507_10082586 Ga0307507_100825865 144
411 3300041491 Ga0451833_0279494 Ga0451833_0279494_472_915 144
412 3300041505 Ga0451849_1464641 Ga0451849_1464641_47_490 144
413 3300041512 Ga0451853_0300632 Ga0451853_0300632_78_512 144
414 3300044842 Ga0466957_0337028 Ga0466957_0337028_291_725 144
415 3300045976 Ga0466967_1166120 Ga0466967_1166120_242_679 144
416 3300048918 Ga0496115_0000065 Ga0496115_0000065_92241_92675 144
417 3300048920 Ga0496117_0478076 Ga0496117_0478076_142_576 144
418 3300048921 Ga0496118_0000177 Ga0496118_0000177_32825_33262 144
419 3300048921 Ga0496118_0027212 Ga0496118_0027212_440_874 144
420 3300048923 Ga0496120_0336749 Ga0496120_0336749_168_602 144
421 3300048929 Ga0496126_0000185 Ga0496126_0000185_43668_44102 144
422 3300048929 Ga0496126_0461016 Ga0496126_0461016_407_844 144
423 3300053093 Ga0500651_0000033 Ga0500651_0000033_51722_52159 144
424 3300005439 Ga0070711_100270518 Ga0070711_1002705182 145
425 3300005548 Ga0070665_100084118 Ga0070665_1000841182 145
426 3300005563 Ga0068855_100003175 Ga0068855_10000317520 145
427 3300005577 Ga0068857_100147783 Ga0068857_1001477832 145
428 3300005842 Ga0068858_100434723 Ga0068858_1004347232 145
429 3300010375 Ga0105239_10019475 Ga0105239_100194757 145
430 3300025914 Ga0207671_10140396 Ga0207671_101403962 145
431 3300025949 Ga0207667_10018943 Ga0207667_100189439 145
432 3300026041 Ga0207639_10149076 Ga0207639_101490764 145
433 3300026067 Ga0207678_10049240 Ga0207678_100492403 145
434 3300026088 Ga0207641_10055794 Ga0207641_100557943 145
435 3300026116 Ga0207674_10092525 Ga0207674_100925252 145
436 3300028379 Ga0268266_10024713 Ga0268266_100247132 145
437 3300049573 Ga0501037_0309975 Ga0501037_0309975_626_1081 145
438 3300049575 Ga0501039_1269971 Ga0501039_1269971_85_540 145
439 3300049579 Ga0501043_0978513 Ga0501043_0978513_81_521 145
440 3300049823 Ga0501044_0100640 Ga0501044_0100640_2298_2753 145
441 3300053079 Ga0500610_0001342 Ga0500610_0001342_7642_8082 145
442 3300005331 Ga0070670_101770555 Ga0070670_1017705551 146
443 3300005335 Ga0070666_10939868 Ga0070666_109398681 146
444 3300005344 Ga0070661_100500292 Ga0070661_1005002921 146
445 3300005543 Ga0070672_100620666 Ga0070672_1006206662 146
446 3300005563 Ga0068855_101232019 Ga0068855_1012320191 146
447 3300005841 Ga0068863_101020061 Ga0068863_1010200613 146
448 3300005843 Ga0068860_100472504 Ga0068860_1004725041 146
449 3300006237 Ga0097621_100155084 Ga0097621_1001550842 146
450 3300009551 Ga0105238_10458956 Ga0105238_104589562 146
451 3300013308 Ga0157375_12136552 Ga0157375_121365521 146
452 3300014969 Ga0157376_10051666 Ga0157376_100516662 146
453 3300014969 Ga0157376_10845045 Ga0157376_108450453 146
454 3300025907 Ga0207645_10366558 Ga0207645_103665583 146
455 3300025924 Ga0207694_10667339 Ga0207694_106673392 146
456 3300025932 Ga0207690_11546661 Ga0207690_115466611 146
457 3300025940 Ga0207691_10053612 Ga0207691_100536126 146
458 3300025942 Ga0207689_11124497 Ga0207689_111244971 146
459 3300026088 Ga0207641_11091070 Ga0207641_110910702 146
460 3300028381 Ga0268264_11521977 Ga0268264_115219771 146
461 3300046557 Ga0495622_0114266 Ga0495622_0114266_218_661 146
462 3300046689 Ga0495613_0462248 Ga0495613_0462248_148_591 146
463 3300048917 Ga0496114_0296975 Ga0496114_0296975_925_1368 146
464 3300049573 Ga0501037_0051449 Ga0501037_0051449_2112_2555 146
465 3300049584 Ga0501068_0156911 Ga0501068_0156911_480_923 146
466 3300049590 Ga0501074_0098859 Ga0501074_0098859_754_1197 146
467 3300049742 Ga0501080_0602497 Ga0501080_0602497_62_505 146
468 3300049823 Ga0501044_0755226 Ga0501044_0755226_261_704 146
469 3300053093 Ga0500651_0030295 Ga0500651_0030295_2904_3350 146
470 3300053150 Ga0500603_135584 Ga0500603_135584_87_530 146
471 3300005327 Ga0070658_10264427 Ga0070658_102644272 147
472 3300005328 Ga0070676_10019016 Ga0070676_100190162 147
473 3300005329 Ga0070683_100772639 Ga0070683_1007726392 147
474 3300005335 Ga0070666_10016973 Ga0070666_100169731 147
475 3300005335 Ga0070666_10335289 Ga0070666_103352892 147
476 3300005336 Ga0070680_101039786 Ga0070680_1010397862 147
477 3300005338 Ga0068868_100010069 Ga0068868_1000100693 147
478 3300005339 Ga0070660_100649504 Ga0070660_1006495041 147
479 3300005344 Ga0070661_100013089 Ga0070661_1000130898 147
480 3300005347 Ga0070668_100028934 Ga0070668_1000289346 147
481 3300005354 Ga0070675_100295745 Ga0070675_1002957452 147
482 3300005355 Ga0070671_100051395 Ga0070671_1000513952 147
483 3300005355 Ga0070671_100374348 Ga0070671_1003743481 147
484 3300005355 Ga0070671_101269771 Ga0070671_1012697711 147
485 3300005364 Ga0070673_100015600 Ga0070673_1000156007 147
486 3300005367 Ga0070667_100189315 Ga0070667_1001893154 147
487 3300005455 Ga0070663_100223056 Ga0070663_1002230561 147
488 3300005455 Ga0070663_100225362 Ga0070663_1002253622 147
489 3300005456 Ga0070678_100445127 Ga0070678_1004451273 147
490 3300005459 Ga0068867_100248422 Ga0068867_1002484222 147
491 3300005530 Ga0070679_100630703 Ga0070679_1006307033 147
492 3300005539 Ga0068853_100166268 Ga0068853_1001662684 147
493 3300005539 Ga0068853_100331420 Ga0068853_1003314203 147
494 3300005539 Ga0068853_100470620 Ga0068853_1004706203 147
495 3300005543 Ga0070672_100010568 Ga0070672_1000105683 147
496 3300005547 Ga0070693_100007096 Ga0070693_1000070961 147
497 3300005548 Ga0070665_100036031 Ga0070665_1000360316 147
498 3300005563 Ga0068855_100038218 Ga0068855_1000382181 147
499 3300005563 Ga0068855_100227779 Ga0068855_1002277792 147
500 3300005563 Ga0068855_100421281 Ga0068855_1004212811 147
501 3300005564 Ga0070664_100146055 Ga0070664_1001460552 147
502 3300005577 Ga0068857_100201074 Ga0068857_1002010743 147
503 3300005578 Ga0068854_100072895 Ga0068854_1000728953 147
504 3300005614 Ga0068856_100078952 Ga0068856_1000789523 147
505 3300005614 Ga0068856_100128449 Ga0068856_1001284495 147
506 3300005616 Ga0068852_100013277 Ga0068852_1000132772 147
507 3300005616 Ga0068852_100015325 Ga0068852_1000153258 147
508 3300005616 Ga0068852_100216254 Ga0068852_1002162542 147
509 3300005617 Ga0068859_100076536 Ga0068859_1000765365 147
510 3300005617 Ga0068859_101809479 Ga0068859_1018094792 147
511 3300005618 Ga0068864_100028578 Ga0068864_1000285787 147
512 3300005834 Ga0068851_10009662 Ga0068851_100096627 147
513 3300005834 Ga0068851_10066470 Ga0068851_100664701 147
514 3300005842 Ga0068858_100071384 Ga0068858_1000713841 147
515 3300005843 Ga0068860_100049216 Ga0068860_1000492164 147
516 3300005843 Ga0068860_100436822 Ga0068860_1004368224 147
517 3300005844 Ga0068862_101731417 Ga0068862_1017314172 147
518 3300005983 Ga0081540_1001888 Ga0081540_100188814 147
519 3300006237 Ga0097621_100152206 Ga0097621_1001522062 147
520 3300006237 Ga0097621_100174362 Ga0097621_1001743623 147
521 3300006358 Ga0068871_100115700 Ga0068871_1001157002 147
522 3300006358 Ga0068871_100514902 Ga0068871_1005149022 147
523 3300006358 Ga0068871_101369434 Ga0068871_1013694342 147
524 3300006881 Ga0068865_100031333 Ga0068865_1000313333 147
525 3300006881 Ga0068865_100216035 Ga0068865_1002160354 147
526 3300006931 Ga0097620_100076536 Ga0097620_1000765362 147
527 3300006931 Ga0097620_101809499 Ga0097620_1018094991 147
528 3300009093 Ga0105240_11064413 Ga0105240_110644132 147
529 3300009098 Ga0105245_11097591 Ga0105245_110975912 147
530 3300009174 Ga0105241_10005014 Ga0105241_100050148 147
531 3300009174 Ga0105241_10453262 Ga0105241_104532622 147
532 3300009177 Ga0105248_10039905 Ga0105248_100399055 147
533 3300009177 Ga0105248_10969583 Ga0105248_109695832 147
534 3300009545 Ga0105237_10012009 Ga0105237_100120098 147
535 3300009545 Ga0105237_10346802 Ga0105237_103468023 147
536 3300009545 Ga0105237_10961848 Ga0105237_109618482 147
537 3300009551 Ga0105238_10002383 Ga0105238_100023834 147
538 3300009551 Ga0105238_10019466 Ga0105238_100194664 147
539 3300010375 Ga0105239_10047656 Ga0105239_100476567 147
540 3300010375 Ga0105239_10186519 Ga0105239_101865194 147
541 3300013100 Ga0157373_10209896 Ga0157373_102098963 147
542 3300013100 Ga0157373_10559833 Ga0157373_105598332 147
543 3300013102 Ga0157371_10775078 Ga0157371_107750781 147
544 3300013104 Ga0157370_10975593 Ga0157370_109755932 147
545 3300013104 Ga0157370_11204624 Ga0157370_112046242 147
546 3300013105 Ga0157369_10010996 Ga0157369_100109968 147
547 3300013105 Ga0157369_10135752 Ga0157369_101357521 147
548 3300013296 Ga0157374_10110511 Ga0157374_101105112 147
549 3300013297 Ga0157378_10051445 Ga0157378_100514453 147
550 3300013307 Ga0157372_10001701 Ga0157372_1000170124 147
551 3300013308 Ga0157375_10609213 Ga0157375_106092133 147
552 3300014325 Ga0163163_10235688 Ga0163163_102356882 147
553 3300014969 Ga0157376_10058312 Ga0157376_100583124 147
554 3300025321 Ga0207656_10042969 Ga0207656_100429692 147
555 3300025321 Ga0207656_10174782 Ga0207656_101747822 147
556 3300025904 Ga0207647_10004386 Ga0207647_100043868 147
557 3300025907 Ga0207645_10187858 Ga0207645_101878581 147
558 3300025908 Ga0207643_10557322 Ga0207643_105573221 147
559 3300025909 Ga0207705_10356106 Ga0207705_103561061 147
560 3300025909 Ga0207705_10652007 Ga0207705_106520072 147
561 3300025911 Ga0207654_10177109 Ga0207654_101771091 147
562 3300025911 Ga0207654_10262052 Ga0207654_102620521 147
563 3300025913 Ga0207695_10000295 Ga0207695_1000029579 147
564 3300025914 Ga0207671_10004185 Ga0207671_1000418513 147
565 3300025914 Ga0207671_10050124 Ga0207671_100501243 147
566 3300025919 Ga0207657_10030009 Ga0207657_100300092 147
567 3300025920 Ga0207649_10051222 Ga0207649_100512223 147
568 3300025923 Ga0207681_10090945 Ga0207681_100909451 147
569 3300025924 Ga0207694_10048426 Ga0207694_100484263 147
570 3300025924 Ga0207694_10398910 Ga0207694_103989102 147
571 3300025931 Ga0207644_10546040 Ga0207644_105460403 147
572 3300025931 Ga0207644_10882842 Ga0207644_108828421 147
573 3300025940 Ga0207691_10012163 Ga0207691_100121632 147
574 3300025941 Ga0207711_10712189 Ga0207711_107121891 147
575 3300025942 Ga0207689_10086188 Ga0207689_100861881 147
576 3300025945 Ga0207679_10101059 Ga0207679_101010594 147
577 3300025945 Ga0207679_10409668 Ga0207679_104096682 147
578 3300025949 Ga0207667_10024555 Ga0207667_100245551 147
579 3300025949 Ga0207667_10303184 Ga0207667_103031841 147
580 3300025981 Ga0207640_10017540 Ga0207640_100175402 147
581 3300025986 Ga0207658_10876066 Ga0207658_108760661 147
582 3300026035 Ga0207703_10119793 Ga0207703_101197933 147
583 3300026035 Ga0207703_10333465 Ga0207703_103334653 147
584 3300026041 Ga0207639_10002703 Ga0207639_100027037 147
585 3300026041 Ga0207639_10121823 Ga0207639_101218231 147
586 3300026067 Ga0207678_10021725 Ga0207678_100217254 147
587 3300026078 Ga0207702_10033998 Ga0207702_100339984 147
588 3300026078 Ga0207702_10607839 Ga0207702_106078393 147
589 3300026088 Ga0207641_11173730 Ga0207641_111737302 147
590 3300026089 Ga0207648_10382181 Ga0207648_103821811 147
591 3300026095 Ga0207676_10168226 Ga0207676_101682263 147
592 3300026116 Ga0207674_10003529 Ga0207674_1000352923 147
593 3300026116 Ga0207674_11744558 Ga0207674_117445581 147
594 3300026121 Ga0207683_10050995 Ga0207683_100509956 147
595 3300026142 Ga0207698_10056613 Ga0207698_100566132 147
596 3300026142 Ga0207698_10298123 Ga0207698_102981232 147
597 3300028379 Ga0268266_10060519 Ga0268266_100605191 147
598 3300028379 Ga0268266_10141156 Ga0268266_101411562 147
599 3300031616 Ga0307508_10049195 Ga0307508_100491953 147
600 3300039437 Ga0436365_0129859 Ga0436365_0129859_848_1294 147
601 3300042005 Ga0439448_0016086 Ga0439448_0016086_365_826 147
602 3300047472 Ga0495686_0343984 Ga0495686_0343984_34_480 147
603 3300053120 Ga0500597_000119 Ga0500597_000119_15496_15948 147
604 3300010375 Ga0105239_11250084 Ga0105239_112500841 148
605 3300046472 Ga0495580_0578272 Ga0495580_0578272_134_583 148
606 3300002077 JGI24744J21845_10040047 JGI24744J21845_100400472 149
607 3300005335 Ga0070666_10000119 Ga0070666_1000011916 149
608 3300005367 Ga0070667_100851623 Ga0070667_1008516232 149
609 3300005539 Ga0068853_100771445 Ga0068853_1007714453 149
610 3300005842 Ga0068858_100507820 Ga0068858_1005078203 149
611 3300009176 Ga0105242_10430422 Ga0105242_104304223 149
612 3300009177 Ga0105248_10002580 Ga0105248_1000258012 149
613 3300009177 Ga0105248_10897954 Ga0105248_108979542 149
614 3300009545 Ga0105237_10003173 Ga0105237_100031732 149
615 3300009553 Ga0105249_10001401 Ga0105249_1000140123 149
616 3300013297 Ga0157378_10440002 Ga0157378_104400023 149
617 3300014325 Ga0163163_10000233 Ga0163163_1000023353 149
618 3300025903 Ga0207680_10000709 Ga0207680_1000070914 149
619 3300025913 Ga0207695_11010871 Ga0207695_110108711 149
620 3300025941 Ga0207711_10001830 Ga0207711_1000183012 149
621 3300025941 Ga0207711_10551726 Ga0207711_105517262 149
622 3300025961 Ga0207712_10000267 Ga0207712_1000026739 149
623 3300025986 Ga0207658_10000166 Ga0207658_1000016632 149
624 3300026035 Ga0207703_10717164 Ga0207703_107171643 149
625 3300026041 Ga0207639_10061957 Ga0207639_100619572 149
626 3300026067 Ga0207678_10019973 Ga0207678_100199733 149
627 3300026088 Ga0207641_10131186 Ga0207641_101311862 149
628 3300048920 Ga0496117_0033772 Ga0496117_0033772_1744_2196 149
629 3300048921 Ga0496118_0000479 Ga0496118_0000479_21141_21593 149
630 3300048924 Ga0496121_0371565 Ga0496121_0371565_250_711 149
631 3300048925 Ga0496122_0000374 Ga0496122_0000374_53514_53975 149
632 3300048926 Ga0496123_0007035 Ga0496123_0007035_6927_7388 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

6

118

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ap8-assembly1.cif.gz_A crystal structure of human molybdopterin synthase catalytic subunit (mocs2b) 0.9719 4 127
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9658 4 134
2wp4-assembly1.cif.gz_A crystal structure of rv3119 from mycobacterium tuberculosis 0.9633 5 125
2qie-assembly2.cif.gz_H staphylococcus aureus molybdopterin synthase in complex with precursor z 0.957 1 125
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.9502 1 134
ID Description Score Start End Superfamily
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9746 4 137 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9596 1 136 3.90.1170.40
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9525 1 137 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.946 1 136 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.944 2 136 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A524H398-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9927 6 137 GO:0006777
AF-A0A661FSA4-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9918 5 135 GO:0006777
GO:0030366
AF-A0A4Q3EFH4-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.991 21 137 GO:0006777
AF-A0A660NEN0-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9907 26 132 GO:0006777
GO:0030366
AF-A0A355S624-F1-model_v4 Molybdopterin-converting factor chain 2 0.9904 4 113 GO:0006777

Feature Viewer

pLDDT pTM Quality
93.57 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map