F470982

General Info

Members Datasets Scaffolds Average Seq Length
632 354 561 205

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10154528|Ga0081455_101545281
Length 227
Sequence MRRARLYDDGLLRCPWPGDDPLYVAYHDTEWGVPEYDDRALFEKLILDGFQAGLSWITILRKRENFRRAFDGFDPRKIARYDAKKISALMNDPGIVRNRAKIEGAVASAKAYLKIMEDGPGFSKFLWSFVGGAPKVNGFKTTASVPASTPLSIAISKELSGRGFKFVGPTIVYAFMQAVGMVNDHLVTCHCHRKRAARNPKTAKKTLAAVAAGPAARKPRQRQAALA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
7 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
12 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
13 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
16 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
24 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
25 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
26 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
27 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
28 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
29 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
30 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
31 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
32 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
33 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
34 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
35 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
36 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
37 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
40 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
41 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
42 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
43 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
44 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
45 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
46 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
47 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
48 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
49 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
50 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
51 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
52 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
53 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
54 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
55 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
56 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
57 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
58 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
59 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
60 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
61 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
62 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
63 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
64 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
65 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
66 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
67 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
68 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
282 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
341 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
342 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
345 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
346 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
347 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
351 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
352 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
353 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
354 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.61
Metatranscriptomes 0.16
Isolates 11.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 5.22
Rhizoplane 3.01
Rhizosphere 72.94
Stem 0
Stem Tuber 0
Unclassified 12.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000262 3300003203 Bacteria 23511
2 JGI25153J46596_10002451 3300003215 Bacteria 10699
3 Ga0055526_1018124 3300003771 Bacteria 2646
4 Ga0070683_100003848 3300005329 Bacteria 12266
5 Ga0070683_100230120 3300005329 Bacteria 1762
6 Ga0070680_100012456 3300005336 Bacteria 6610
7 Ga0070680_100035084 3300005336 Bacteria 4049
8 Ga0070680_100881409 3300005336 Bacteria 772
9 Ga0070660_100023176 3300005339 Bacteria 4598
10 Ga0070659_100032520 3300005366 Bacteria 4047
11 Ga0070714_100007894 3300005435 Bacteria 8289
12 Ga0070714_100280595 3300005435 Bacteria 1547
13 Ga0070714_100591749 3300005435 Bacteria 1065
14 Ga0070713_100001936 3300005436 Bacteria 13367
15 Ga0070713_100096821 3300005436 Bacteria 2548
16 Ga0070710_10000534 3300005437 Bacteria 17971
17 Ga0070711_100000548 3300005439 Bacteria 19604
18 Ga0070711_100082260 3300005439 Bacteria 2297
19 Ga0070711_100134397 3300005439 Bacteria 1846
20 Ga0070708_100084821 3300005445 Bacteria 2873
21 Ga0070681_10013695 3300005458 Bacteria 8071
22 Ga0070681_10473051 3300005458 Bacteria 1166
23 Ga0070706_100041271 3300005467 Bacteria 4260
24 Ga0070706_100301270 3300005467 Bacteria 1496
25 Ga0070707_100010470 3300005468 Bacteria 8638
26 Ga0070707_100110041 3300005468 Bacteria 2671
27 Ga0070698_100053689 3300005471 Bacteria 4094
28 Ga0070698_100154339 3300005471 Bacteria 2242
29 Ga0070699_100295610 3300005518 Bacteria 1452
30 Ga0070679_100091249 3300005530 Bacteria 3034
31 Ga0070679_100203108 3300005530 Bacteria 1947
32 Ga0070684_100032160 3300005535 Bacteria 4470
33 Ga0070697_100075090 3300005536 Bacteria 2778
34 Ga0068853_100022837 3300005539 Bacteria 5228
35 Ga0070686_100653660 3300005544 Bacteria 834
36 Ga0068855_100056975 3300005563 Bacteria 4582
37 Ga0068855_100339057 3300005563 Bacteria 1658
38 Ga0070664_100167809 3300005564 Bacteria 1946
39 Ga0068854_100280665 3300005578 Bacteria 1341
40 Ga0068856_100058718 3300005614 Bacteria 3800
41 Ga0068856_100167805 3300005614 Bacteria 2206
42 Ga0068856_101041513 3300005614 Bacteria 836
43 Ga0068852_100010119 3300005616 Bacteria 7023
44 Ga0068852_100137152 3300005616 Bacteria 2260
45 Ga0068863_101237310 3300005841 Bacteria 753
46 Ga0068858_100458750 3300005842 Bacteria 1229
47 Ga0068860_100003417 3300005843 Bacteria 16323
48 Ga0081455_10007978 3300005937 Bacteria 11070
49 Ga0081455_10154528 3300005937 Bacteria 1765
50 Ga0081540_1010925 3300005983 Bacteria 6098
51 Ga0081540_1022172 3300005983 Bacteria 3754
52 Ga0081539_10000003 3300005985 Bacteria 594833
53 Ga0081539_10022785 3300005985 Bacteria 4127
54 Ga0070717_10001632 3300006028 Bacteria 15573
55 Ga0070717_10051927 3300006028 Bacteria 3376
56 Ga0070717_10088384 3300006028 Bacteria 2612
57 Ga0070717_10129506 3300006028 Bacteria 2169
58 Ga0070717_10432987 3300006028 Bacteria 1184
59 Ga0070717_10692752 3300006028 Bacteria 926
60 Ga0070715_10021767 3300006163 Bacteria 2491
61 Ga0070715_10028972 3300006163 Bacteria 2227
62 Ga0070712_100111108 3300006175 Bacteria 2045
63 Ga0070712_100564998 3300006175 Bacteria 960
64 Ga0075367_10002456 3300006178 Bacteria 8481
65 Ga0075366_10092763 3300006195 Bacteria 1809
66 Ga0097621_100179336 3300006237 Bacteria 1830
67 Ga0075433_10193924 3300006852 Bacteria 1807
68 Ga0075434_100075472 3300006871 Bacteria 3365
69 Ga0099795_10006504 3300007788 Bacteria 3193
70 Ga0099795_10032396 3300007788 Bacteria 1807
71 Ga0099795_10248416 3300007788 Bacteria 766
72 Ga0105240_10212180 3300009093 Bacteria 2261
73 Ga0105240_10694199 3300009093 Bacteria 1111
74 Ga0105240_11353399 3300009093 Bacteria 749
75 Ga0114129_10038102 3300009147 Bacteria 6783
76 Ga0105248_11702911 3300009177 Bacteria 715
77 Ga0105237_10244674 3300009545 Bacteria 1795
78 Ga0105237_10617438 3300009545 Bacteria 1091
79 Ga0105238_10003869 3300009551 Bacteria 14870
80 Ga0105238_10088823 3300009551 Bacteria 3077
81 Ga0105238_10818959 3300009551 Bacteria 947
82 Ga0105238_11028127 3300009551 Bacteria 845
83 Ga0105239_10082874 3300010375 Bacteria 3532
84 Ga0105239_10297681 3300010375 Bacteria 1817
85 Ga0157371_10498231 3300013102 Bacteria 899
86 Ga0157370_10040261 3300013104 Bacteria 4512
87 Ga0157370_10066584 3300013104 Bacteria 3406
88 Ga0157369_10000685 3300013105 Bacteria 43830
89 Ga0157369_10267359 3300013105 Bacteria 1783
90 Ga0157374_10925759 3300013296 Bacteria 890
91 Ga0157375_10119433 3300013308 Bacteria 2744
92 Ga0163161_10634404 3300017792 Bacteria 884
93 Ga0213873_10004137 3300021358 Bacteria 2681
94 Ga0213872_10030128 3300021361 Bacteria 2488
95 Ga0209564_1000407 3300025295 Bacteria 76572
96 Ga0209758_1000320 3300025297 Bacteria 92649
97 Ga0209758_1002345 3300025297 Bacteria 19516
98 Ga0209758_1009982 3300025297 Bacteria 5773
99 Ga0207692_10000091 3300025898 Bacteria 26705
100 Ga0207710_10004729 3300025900 Bacteria 5907
101 Ga0207685_10012829 3300025905 Bacteria 2571
102 Ga0207685_10051470 3300025905 Bacteria 1591
103 Ga0207699_10000782 3300025906 Bacteria 15227
104 Ga0207699_10008595 3300025906 Bacteria 5047
105 Ga0207643_10151075 3300025908 Bacteria 1392
106 Ga0207705_10032876 3300025909 Bacteria 3706
107 Ga0207705_10415842 3300025909 Bacteria 1041
108 Ga0207684_10081693 3300025910 Bacteria 2750
109 Ga0207684_10248852 3300025910 Bacteria 1534
110 Ga0207684_10415653 3300025910 Bacteria 1156
111 Ga0207707_10001881 3300025912 Bacteria 19162
112 Ga0207707_10306843 3300025912 Bacteria 1372
113 Ga0207671_10379637 3300025914 Bacteria 1123
114 Ga0207671_10400542 3300025914 Bacteria 1091
115 Ga0207693_10009983 3300025915 Bacteria 7719
116 Ga0207693_10029076 3300025915 Bacteria 4368
117 Ga0207693_10111691 3300025915 Bacteria 2144
118 Ga0207693_10314100 3300025915 Bacteria 1227
119 Ga0207663_10023702 3300025916 Bacteria 3526
120 Ga0207663_10046321 3300025916 Bacteria 2679
121 Ga0207663_10047322 3300025916 Bacteria 2655
122 Ga0207660_10005375 3300025917 Bacteria 8316
123 Ga0207660_10048097 3300025917 Bacteria 3018
124 Ga0207657_10005742 3300025919 Bacteria 12944
125 Ga0207652_10001649 3300025921 Bacteria 19585
126 Ga0207646_10024804 3300025922 Bacteria 5489
127 Ga0207646_10257142 3300025922 Bacteria 1578
128 Ga0207694_10041393 3300025924 Bacteria 3550
129 Ga0207694_10136083 3300025924 Bacteria 1973
130 Ga0207700_10001432 3300025928 Bacteria 13527
131 Ga0207700_10018197 3300025928 Bacteria 4715
132 Ga0207700_10396814 3300025928 Bacteria 1208
133 Ga0207664_10011918 3300025929 Bacteria 6205
134 Ga0207664_10012540 3300025929 Bacteria 6065
135 Ga0207664_10023054 3300025929 Bacteria 4659
136 Ga0207690_10076350 3300025932 Bacteria 2326
137 Ga0207709_10453441 3300025935 Bacteria 992
138 Ga0207665_10038595 3300025939 Bacteria 3181
139 Ga0207665_10101486 3300025939 Bacteria 2009
140 Ga0207689_10043629 3300025942 Bacteria 3707
141 Ga0207661_10017276 3300025944 Bacteria 5334
142 Ga0207667_10037563 3300025949 Bacteria 5176
143 Ga0207667_10272240 3300025949 Bacteria 1731
144 Ga0207639_10021282 3300026041 Bacteria 4656
145 Ga0207676_10105807 3300026095 Bacteria 2343
146 Ga0207674_10023609 3300026116 Bacteria 6584
147 Ga0207674_10265382 3300026116 Bacteria 1664
148 Ga0207675_101017567 3300026118 Bacteria 847
149 Ga0207698_10123770 3300026142 Bacteria 2194
150 Ga0268264_10000168 3300028381 Bacteria 146056
151 Ga0265326_10050399 3300028558 Bacteria 1179
152 Ga0265319_1014519 3300028563 Bacteria 3088
153 Ga0265334_10014411 3300028573 Bacteria 3296
154 Ga0265334_10021414 3300028573 Bacteria 2640
155 Ga0265318_10034328 3300028577 Bacteria 1956
156 Ga0265323_10003421 3300028653 Bacteria 7015
157 Ga0265336_10000308 3300028666 Bacteria 33185
158 Ga0307517_10000071 3300028786 Bacteria 138548
159 Ga0307517_10120374 3300028786 Bacteria 1944
160 Ga0265338_10000085 3300028800 Bacteria 175080
161 Ga0265324_10017984 3300029957 Bacteria 2565
162 Ga0307511_10079431 3300030521 Bacteria 2319
163 Ga0265330_10014492 3300031235 Bacteria 3659
164 Ga0265328_10028164 3300031239 Bacteria 2103
165 Ga0265325_10180321 3300031241 Bacteria 984
166 Ga0265340_10005231 3300031247 Bacteria 7203
167 Ga0265339_10003778 3300031249 Bacteria 10553
168 Ga0265313_10113292 3300031595 Bacteria 1190
169 Ga0307508_10000008 3300031616 Bacteria 265023
170 Ga0307508_10108158 3300031616 Bacteria 2380
171 Ga0307508_10111233 3300031616 Bacteria 2339
172 Ga0265314_10089763 3300031711 Bacteria 2004
173 Ga0265342_10126271 3300031712 Bacteria 1436
174 Ga0316578_10005935 3300031728 Bacteria 5978
175 Ga0307507_10008502 3300033179 Bacteria 14157
176 Ga0307510_10018893 3300033180 Bacteria 8091
177 Ga0316215_1001248 3300033544 Bacteria 2468
178 Ga0373926_0047925 3300035083 Bacteria 1536
179 Ga0373934_0075925 3300035086 Bacteria 1347
180 Ga0373944_0049296 3300035089 Bacteria 1323
181 Ga0373923_0117833 3300035111 Bacteria 1184
182 Ga0373945_0053545 3300035116 Bacteria 1490
183 Ga0373945_0143094 3300035116 Bacteria 965
184 Ga0373954_0006494 3300035118 Bacteria 5099
185 Ga0373954_0038279 3300035118 Bacteria 2230
186 Ga0373956_0104538 3300035119 Bacteria 1315
187 Ga0373957_0000801 3300035120 Bacteria 8169
188 Ga0373943_0016263 3300035170 Bacteria 3390
189 Ga0373943_0051269 3300035170 Bacteria 2031
190 Ga0373955_0001870 3300035172 Bacteria 9062
191 Ga0373955_0016636 3300035172 Bacteria 3624
192 Ga0373961_0000805 3300035241 Bacteria 10705
193 Ga0373931_0052031 3300035691 Bacteria 2182
194 Ga0373931_0332586 3300035691 Bacteria 946
195 Ga0373935_0097514 3300035692 Bacteria 1934
196 Ga0373935_0159500 3300035692 Bacteria 1536
197 Ga0373927_0001984 3300035695 Bacteria 15075
198 Ga0373927_0027195 3300035695 Bacteria 3736
199 Ga0373927_0054260 3300035695 Bacteria 2592
200 Ga0373933_0000038 3300035724 Bacteria 80976
201 Ga0373933_0011294 3300035724 Bacteria 4916
202 Ga0373933_0132340 3300035724 Bacteria 1569
203 Ga0373933_0148685 3300035724 Bacteria 1482
204 Ga0373933_0194234 3300035724 Bacteria 1297
205 Ga0373947_0040566 3300035725 Bacteria 2773
206 Ga0373947_0111624 3300035725 Bacteria 1728
207 Ga0373947_0166662 3300035725 Bacteria 1427
208 Ga0373947_0176760 3300035725 Bacteria 1388
209 Ga0373937_0011662 3300036401 Bacteria 7711
210 Ga0373937_0100053 3300036401 Bacteria 2690
211 Ga0373937_0502795 3300036401 Bacteria 1151
212 Ga0372808_005719 3300036459 Bacteria 1651
213 Ga0316584_0025762 3300036712 Bacteria 4316
214 Ga0373925_0020481 3300037068 Bacteria 4815
215 Ga0373925_0049703 3300037068 Bacteria 3126
216 Ga0373925_0277216 3300037068 Bacteria 1350
217 Ga0373925_0339340 3300037068 Bacteria 1219
218 Ga0395899_0097110 3300037312 Bacteria 2130
219 Ga0395899_0394680 3300037312 Bacteria 917
220 Ga0395900_0023914 3300037418 Bacteria 6253
221 Ga0395900_0121023 3300037418 Bacteria 2685
222 Ga0395898_0068553 3300037466 Bacteria 3433
223 Ga0395898_0090138 3300037466 Bacteria 2951
224 Ga0395905_0035844 3300037471 Bacteria 4659
225 Ga0395905_0503207 3300037471 Bacteria 1112
226 Ga0436364_0908905 3300037853 Bacteria 1475
227 Ga0395901_0024268 3300038443 Bacteria 6221
228 Ga0395901_0173790 3300038443 Bacteria 2260
229 Ga0395901_0371344 3300038443 Bacteria 1473
230 Ga0400484_31101 3300038725 Bacteria 10449
231 Ga0436365_0259616 3300039437 Bacteria 1084
232 Ga0436365_0430129 3300039437 Bacteria 1221
233 Ga0436360_0322671 3300039438 Bacteria 1516
234 Ga0436360_0499741 3300039438 Bacteria 2483
235 Ga0436360_0820351 3300039438 Bacteria 2971
236 Ga0436361_0323070 3300039447 Bacteria 827
237 Ga0436361_0779011 3300039447 Bacteria 1870
238 Ga0436363_1220467 3300039450 Bacteria 4457
239 Ga0436363_1513497 3300039450 Bacteria 913
240 Ga0436362_0542741 3300039453 Bacteria 1145
241 Ga0436362_1272902 3300039453 Bacteria 1053
242 Ga0451791_1595999 3300041451 Bacteria 1437
243 Ga0451841_0724584 3300041498 Bacteria 749
244 Ga0451577_0012770 3300042876 Bacteria 7879
245 Ga0451577_0465635 3300042876 Bacteria 1148
246 Ga0466969_0038849 3300044656 Bacteria 2393
247 Ga0466969_0106716 3300044656 Bacteria 1314
248 Ga0466969_0192955 3300044656 Bacteria 930
249 Ga0466972_0000363 3300044658 Bacteria 24488
250 Ga0466972_0075058 3300044658 Bacteria 1611
251 Ga0466966_0002193 3300044684 Bacteria 12682
252 Ga0466961_0000090 3300044693 Bacteria 57757
253 Ga0466963_0110900 3300044694 Bacteria 1883
254 Ga0466964_0092824 3300044706 Bacteria 1317
255 Ga0453684_0000195 3300044712 Bacteria 265496
256 Ga0453684_0016214 3300044712 Bacteria 11672
257 Ga0453684_0040512 3300044712 Bacteria 6323
258 Ga0466968_0056259 3300044735 Bacteria 1689
259 Ga0466957_0101804 3300044842 Bacteria 1811
260 Ga0466959_0010358 3300045049 Bacteria 6659
261 Ga0466959_0026042 3300045049 Bacteria 4337
262 Ga0466959_0114881 3300045049 Bacteria 1918
263 Ga0466959_0165411 3300045049 Bacteria 1554
264 Ga0451576_0009657 3300045051 Bacteria 11164
265 Ga0451576_0022092 3300045051 Bacteria 6903
266 Ga0451576_0285468 3300045051 Bacteria 1725
267 Ga0466958_0041483 3300045836 Bacteria 2768
268 Ga0466958_0322998 3300045836 Bacteria 992
269 Ga0495592_0047000 3300046454 Bacteria 3215
270 Ga0495603_0001668 3300046455 Bacteria 13022
271 Ga0495603_0032422 3300046455 Bacteria 3143
272 Ga0495603_0294517 3300046455 Bacteria 932
273 Ga0495629_0004290 3300046459 Bacteria 10688
274 Ga0495629_0031471 3300046459 Bacteria 3757
275 Ga0495638_0207793 3300046460 Bacteria 1101
276 Ga0495651_0034000 3300046462 Bacteria 3974
277 Ga0495651_0096963 3300046462 Bacteria 2202
278 Ga0495651_0727974 3300046462 Bacteria 616
279 Ga0495653_0019006 3300046463 Bacteria 5576
280 Ga0495653_0051789 3300046463 Bacteria 3149
281 Ga0495653_0067031 3300046463 Bacteria 2697
282 Ga0495580_0068041 3300046472 Bacteria 2491
283 Ga0495662_0143963 3300046476 Bacteria 1174
284 Ga0495584_0398262 3300046491 Bacteria 700
285 Ga0495594_0089452 3300046499 Bacteria 1724
286 Ga0495594_0120670 3300046499 Bacteria 1482
287 Ga0495606_0000514 3300046507 Bacteria 62799
288 Ga0495606_0053725 3300046507 Bacteria 2613
289 Ga0495608_0040209 3300046511 Bacteria 3133
290 Ga0495608_0351159 3300046511 Bacteria 907
291 Ga0495618_0188583 3300046514 Bacteria 1308
292 Ga0495628_0093079 3300046516 Bacteria 2331
293 Ga0495648_0009740 3300046524 Bacteria 7400
294 Ga0495666_0082825 3300046526 Bacteria 1517
295 Ga0495652_0029755 3300046529 Bacteria 4794
296 Ga0495652_0232721 3300046529 Bacteria 1377
297 Ga0495665_0284838 3300046531 Bacteria 847
298 Ga0495640_0029441 3300046533 Bacteria 3943
299 Ga0495640_0057460 3300046533 Bacteria 2655
300 Ga0495587_0006009 3300046536 Bacteria 7911
301 Ga0495587_0086273 3300046536 Bacteria 1816
302 Ga0495645_0103711 3300046543 Bacteria 2020
303 Ga0495645_0187746 3300046543 Bacteria 1411
304 Ga0495622_0069998 3300046557 Bacteria 1620
305 Ga0495667_0037530 3300046559 Bacteria 3228
306 Ga0495667_0061794 3300046559 Bacteria 2455
307 Ga0495634_0020543 3300046642 Bacteria 4682
308 Ga0495634_0092966 3300046642 Bacteria 1956
309 Ga0495635_0004272 3300046663 Bacteria 9893
310 Ga0495588_0028455 3300046674 Bacteria 2797
311 Ga0495657_0016282 3300046675 Bacteria 5419
312 Ga0495657_0042191 3300046675 Bacteria 3116
313 Ga0495599_0110503 3300046678 Bacteria 1712
314 Ga0495623_0023294 3300046679 Bacteria 3996
315 Ga0495623_0039478 3300046679 Bacteria 3016
316 Ga0495623_0106695 3300046679 Bacteria 1701
317 Ga0495669_0338626 3300046684 Bacteria 727
318 Ga0495613_0065807 3300046689 Bacteria 2648
319 Ga0495613_0095354 3300046689 Bacteria 2152
320 Ga0495613_0145915 3300046689 Bacteria 1689
321 Ga0495624_0277220 3300046690 Bacteria 1012
322 Ga0495600_0033343 3300046809 Bacteria 3343
323 Ga0495600_0386448 3300046809 Bacteria 872
324 Ga0495604_0020499 3300047317 Bacteria 5280
325 Ga0495604_0078531 3300047317 Bacteria 2477
326 Ga0495604_0254246 3300047317 Bacteria 1196
327 Ga0495674_0019395 3300047319 Bacteria 6311
328 Ga0495674_0026267 3300047319 Bacteria 5330
329 Ga0495672_0082483 3300047320 Bacteria 1788
330 Ga0495676_0252291 3300047321 Bacteria 1203
331 Ga0495680_0003162 3300047322 Bacteria 16399
332 Ga0495680_0024509 3300047322 Bacteria 5004
333 Ga0495680_0164103 3300047322 Bacteria 1611
334 Ga0495680_0299665 3300047322 Bacteria 1129
335 Ga0495675_0008654 3300047444 Bacteria 6312
336 Ga0495675_0047390 3300047444 Bacteria 2734
337 Ga0495675_0165696 3300047444 Bacteria 1359
338 Ga0495685_087073 3300047447 Bacteria 1037
339 Ga0495684_0004425 3300047471 Bacteria 10986
340 Ga0495684_0007358 3300047471 Bacteria 8533
341 Ga0495684_0547576 3300047471 Bacteria 788
342 Ga0495686_0050201 3300047472 Bacteria 2622
343 Ga0495593_0031228 3300047673 Bacteria 2911
344 Ga0495593_0151524 3300047673 Bacteria 1173
345 Ga0495602_0090343 3300048088 Bacteria 2544
346 Ga0495602_0092730 3300048088 Bacteria 2501
347 Ga0495602_0518457 3300048088 Bacteria 830
348 Ga0496100_0134379 3300048903 Bacteria 1746
349 Ga0496101_0016399 3300048904 Bacteria 5004
350 Ga0496104_0137003 3300048907 Bacteria 2352
351 Ga0496104_0797391 3300048907 Bacteria 851
352 Ga0496106_0000469 3300048909 Bacteria 28840
353 Ga0496109_0289634 3300048912 Bacteria 1544
354 Ga0496109_0752187 3300048912 Bacteria 912
355 Ga0496111_0256563 3300048914 Bacteria 1297
356 Ga0496112_0000045 3300048915 Bacteria 85873
357 Ga0496112_0157903 3300048915 Bacteria 2235
358 Ga0496113_0090148 3300048916 Bacteria 2361
359 Ga0496113_0103546 3300048916 Bacteria 2208
360 Ga0496114_0735629 3300048917 Bacteria 863
361 Ga0496115_0014957 3300048918 Bacteria 5882
362 Ga0496115_0020501 3300048918 Bacteria 5101
363 Ga0496115_0063096 3300048918 Bacteria 2989
364 Ga0496115_0071738 3300048918 Bacteria 2809
365 Ga0496115_0115536 3300048918 Bacteria 2207
366 Ga0496116_0109789 3300048919 Bacteria 1625
367 Ga0496117_0035263 3300048920 Bacteria 3757
368 Ga0496117_0051048 3300048920 Bacteria 2928
369 Ga0496117_0059683 3300048920 Bacteria 2633
370 Ga0496118_0005305 3300048921 Bacteria 14703
371 Ga0496118_0016550 3300048921 Bacteria 6761
372 Ga0496118_0051430 3300048921 Bacteria 3152
373 Ga0496118_0101342 3300048921 Bacteria 1945
374 Ga0496119_0091279 3300048922 Bacteria 1730
375 Ga0496119_0165367 3300048922 Bacteria 1172
376 Ga0496121_0000225 3300048924 Bacteria 122351
377 Ga0496121_0000506 3300048924 Bacteria 74537
378 Ga0496121_0020848 3300048924 Bacteria 6457
379 Ga0496121_0082401 3300048924 Bacteria 2543
380 Ga0496121_0105958 3300048924 Bacteria 2156
381 Ga0496121_0210395 3300048924 Bacteria 1378
382 Ga0496121_0281403 3300048924 Bacteria 1137
383 Ga0496124_0000391 3300048927 Bacteria 79955
384 Ga0496124_0238264 3300048927 Bacteria 1355
385 Ga0496124_0440626 3300048927 Bacteria 891
386 Ga0496125_0026719 3300048928 Bacteria 5248
387 Ga0496125_0058042 3300048928 Bacteria 3129
388 Ga0496126_0003778 3300048929 Bacteria 18792
389 Ga0496126_0086651 3300048929 Bacteria 2760
390 Ga0496126_0091722 3300048929 Bacteria 2670
391 Ga0496126_0234723 3300048929 Bacteria 1535
392 Ga0496126_0704239 3300048929 Bacteria 784
393 Ga0501031_0000308 3300049568 Bacteria 27946
394 Ga0501031_0008527 3300049568 Bacteria 6669
395 Ga0501031_0169324 3300049568 Bacteria 1427
396 Ga0501032_0001663 3300049569 Bacteria 17656
397 Ga0501032_0030107 3300049569 Bacteria 3723
398 Ga0501032_0033117 3300049569 Bacteria 3542
399 Ga0501032_0045454 3300049569 Bacteria 2969
400 Ga0501032_0053412 3300049569 Bacteria 2721
401 Ga0501032_0264438 3300049569 Bacteria 1115
402 Ga0501032_0328888 3300049569 Bacteria 986
403 Ga0501033_0002151 3300049570 Bacteria 17041
404 Ga0501033_0003890 3300049570 Bacteria 12139
405 Ga0501033_0026938 3300049570 Bacteria 4324
406 Ga0501033_0111535 3300049570 Bacteria 1990
407 Ga0501033_0145328 3300049570 Bacteria 1713
408 Ga0501034_0000202 3300049571 Bacteria 112985
409 Ga0501034_0000663 3300049571 Bacteria 52410
410 Ga0501034_0044965 3300049571 Bacteria 4463
411 Ga0501034_0193799 3300049571 Bacteria 1993
412 Ga0501034_0328713 3300049571 Bacteria 1460
413 Ga0501034_0523579 3300049571 Bacteria 1097
414 Ga0501034_0772255 3300049571 Bacteria 855
415 Ga0501036_0000042 3300049572 Bacteria 79876
416 Ga0501036_0024848 3300049572 Bacteria 5052
417 Ga0501036_0425114 3300049572 Bacteria 1107
418 Ga0501037_0000100 3300049573 Bacteria 81013
419 Ga0501037_0000635 3300049573 Bacteria 27166
420 Ga0501037_0073891 3300049573 Bacteria 2478
421 Ga0501037_0146859 3300049573 Bacteria 1686
422 Ga0501037_0150318 3300049573 Bacteria 1665
423 Ga0501037_0188615 3300049573 Bacteria 1460
424 Ga0501037_0625106 3300049573 Bacteria 721
425 Ga0501038_0000353 3300049574 Bacteria 39422
426 Ga0501038_0000377 3300049574 Bacteria 38374
427 Ga0501038_0018922 3300049574 Bacteria 6215
428 Ga0501038_0025675 3300049574 Bacteria 5248
429 Ga0501038_0080510 3300049574 Bacteria 2745
430 Ga0501038_0123439 3300049574 Bacteria 2133
431 Ga0501038_0391319 3300049574 Bacteria 1077
432 Ga0501039_0000216 3300049575 Bacteria 42349
433 Ga0501039_0041561 3300049575 Bacteria 3551
434 Ga0501039_0079044 3300049575 Bacteria 2559
435 Ga0501039_0241816 3300049575 Bacteria 1419
436 Ga0501039_0247592 3300049575 Bacteria 1401
437 Ga0501039_0393341 3300049575 Bacteria 1089
438 Ga0501040_0114402 3300049576 Bacteria 1889
439 Ga0501041_0072568 3300049577 Bacteria 2115
440 Ga0501041_0219253 3300049577 Bacteria 1194
441 Ga0501041_0239917 3300049577 Bacteria 1139
442 Ga0501042_0062074 3300049578 Bacteria 2669
443 Ga0501042_0126926 3300049578 Bacteria 1837
444 Ga0501043_0000666 3300049579 Bacteria 30328
445 Ga0501043_0006300 3300049579 Bacteria 9527
446 Ga0501043_0031952 3300049579 Bacteria 4137
447 Ga0501043_0069873 3300049579 Bacteria 2758
448 Ga0501043_0491117 3300049579 Bacteria 918
449 Ga0501046_0001530 3300049580 Bacteria 22056
450 Ga0501046_0027341 3300049580 Bacteria 4654
451 Ga0501046_0091582 3300049580 Bacteria 2338
452 Ga0501046_0177489 3300049580 Bacteria 1594
453 Ga0501047_0000159 3300049581 Bacteria 82106
454 Ga0501047_0034955 3300049581 Bacteria 4853
455 Ga0501047_0057170 3300049581 Bacteria 3772
456 Ga0501047_0070002 3300049581 Bacteria 3377
457 Ga0501047_0112892 3300049581 Bacteria 2599
458 Ga0501047_0160252 3300049581 Bacteria 2122
459 Ga0501047_0232944 3300049581 Bacteria 1694
460 Ga0501047_0268257 3300049581 Bacteria 1553
461 Ga0501047_0454671 3300049581 Bacteria 1110
462 Ga0501047_0489960 3300049581 Bacteria 1056
463 Ga0501048_0000753 3300049582 Bacteria 23732
464 Ga0501048_0187342 3300049582 Bacteria 1466
465 Ga0501048_0304065 3300049582 Bacteria 1135
466 Ga0501067_0000143 3300049583 Bacteria 39651
467 Ga0501067_0015512 3300049583 Bacteria 4216
468 Ga0501068_0000487 3300049584 Bacteria 20099
469 Ga0501068_0006764 3300049584 Bacteria 6333
470 Ga0501068_0008678 3300049584 Bacteria 5667
471 Ga0501068_0167413 3300049584 Bacteria 1386
472 Ga0501069_0001614 3300049585 Bacteria 11165
473 Ga0501070_0012963 3300049586 Bacteria 7026
474 Ga0501070_0026527 3300049586 Bacteria 4859
475 Ga0501070_0681018 3300049586 Bacteria 814
476 Ga0501071_0059386 3300049587 Bacteria 2767
477 Ga0501071_0072664 3300049587 Bacteria 2509
478 Ga0501072_0004288 3300049588 Bacteria 10823
479 Ga0501072_0089127 3300049588 Bacteria 2448
480 Ga0501072_0335236 3300049588 Bacteria 1201
481 Ga0501073_0000151 3300049589 Bacteria 46171
482 Ga0501073_0021687 3300049589 Bacteria 4627
483 Ga0501073_0248710 3300049589 Bacteria 1227
484 Ga0501073_0253791 3300049589 Bacteria 1214
485 Ga0501073_0285772 3300049589 Bacteria 1138
486 Ga0501074_0000117 3300049590 Bacteria 40113
487 Ga0501074_0018790 3300049590 Bacteria 5021
488 Ga0501074_0093727 3300049590 Bacteria 2150
489 Ga0501075_0037976 3300049591 Bacteria 3600
490 Ga0501076_0016104 3300049592 Bacteria 5661
491 Ga0501076_0221505 3300049592 Bacteria 1546
492 Ga0501076_0730758 3300049592 Bacteria 817
493 Ga0501080_0000845 3300049742 Bacteria 25045
494 Ga0501080_0019680 3300049742 Bacteria 6251
495 Ga0501080_0041782 3300049742 Bacteria 4270
496 Ga0501083_0001012 3300049744 Bacteria 18734
497 Ga0501083_0027807 3300049744 Bacteria 3900
498 Ga0501083_0131198 3300049744 Bacteria 1643
499 Ga0501035_0000172 3300049822 Bacteria 79203
500 Ga0501035_0001593 3300049822 Bacteria 22971
501 Ga0501035_0011227 3300049822 Bacteria 8298
502 Ga0501035_0146034 3300049822 Bacteria 2054
503 Ga0501035_0429527 3300049822 Bacteria 1095
504 Ga0501044_0000282 3300049823 Bacteria 64640
505 Ga0501044_0011954 3300049823 Bacteria 9407
506 Ga0501044_0038664 3300049823 Bacteria 4982
507 Ga0501044_0040881 3300049823 Bacteria 4829
508 Ga0501044_0069698 3300049823 Bacteria 3579
509 Ga0501044_0230806 3300049823 Bacteria 1798
510 Ga0501044_0506752 3300049823 Bacteria 1107
511 Ga0501044_0714485 3300049823 Bacteria 886
512 Ga0501045_0109467 3300049824 Bacteria 2048
513 Ga0501045_0356526 3300049824 Bacteria 1088
514 Ga0501045_0385961 3300049824 Bacteria 1042
515 nmdc:mga07m45_30859_c1 3300050496 Bacteria 2969
516 nmdc:mga05p37_135832_c1 3300050507 Bacteria 3016
517 nmdc:mga09592_193852_c1 3300050508 Bacteria 1759
518 nmdc:mga0n895_68916_c1 3300050512 Bacteria 3504
519 Ga0495601_0089801 3300053077 Bacteria 1976
520 Ga0495601_0314771 3300053077 Bacteria 1019
521 Ga0500635_0012390 3300053080 Bacteria 2448
522 Ga0500635_0025476 3300053080 Bacteria 1864
523 Ga0495595_0000665 3300053084 Bacteria 13109
524 Ga0495595_0002360 3300053084 Bacteria 7356
525 Ga0495595_0101766 3300053084 Bacteria 1387
526 Ga0495619_0017529 3300053085 Bacteria 4535
527 Ga0495619_0020919 3300053085 Bacteria 4172
528 Ga0495619_0045806 3300053085 Bacteria 2874
529 Ga0500643_037477 3300053087 Bacteria 1444
530 Ga0500651_0015705 3300053093 Bacteria 4651
531 Ga0500566_0000003 3300053094 Bacteria 166820
532 Ga0500566_0091176 3300053094 Bacteria 1684
533 Ga0500650_0268921 3300053098 Bacteria 760
534 Ga0500572_000096 3300053111 Bacteria 28795
535 Ga0500594_0017931 3300053118 Bacteria 1738
536 Ga0500595_002883 3300053119 Bacteria 8237
537 Ga0500595_003476 3300053119 Bacteria 7330
538 Ga0500608_007904 3300053122 Bacteria 4430
539 Ga0500559_0001590 3300053136 Bacteria 12648
540 Ga0500559_0012644 3300053136 Bacteria 3585
541 Ga0500568_0027582 3300053139 Bacteria 2373
542 Ga0500590_130676 3300053148 Bacteria 1162
543 Ga0500603_000752 3300053150 Bacteria 7866
544 Ga0500603_001019 3300053150 Bacteria 6592
545 Ga0500616_0006542 3300053153 Bacteria 7613
546 Ga0500616_0040724 3300053153 Bacteria 2497
547 Ga0500622_0115776 3300053156 Bacteria 1305
548 Ga0500630_001065 3300053159 Bacteria 12828
549 Ga0500638_035002 3300053162 Bacteria 2432
550 Ga0500639_000264 3300053163 Bacteria 25991
551 Ga0500636_0034548 3300053177 Bacteria 2993
552 Ga0500576_096258 3300053725 Bacteria 1218
553 Ga0500552_003192 3300053733 Bacteria 1647
554 Ga0500565_007778 3300053734 Bacteria 1025
555 Ga0500596_000577 3300053735 Bacteria 7004
556 Ga0501084_0000856 3300054114 Bacteria 23532
557 Ga0501084_0082116 3300054114 Bacteria 2704
558 Ga0501084_0547212 3300054114 Bacteria 978
559 Ga0501082_0062521 3300060353 Bacteria 3205
560 Ga0466962_0030846 3300061719 Bacteria 2567
561 Ga0466962_0053035 3300061719 Bacteria 1938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0547576 Ga0495684_0547576_60_578 164
2 3300009093 Ga0105240_11353399 Ga0105240_113533992 184
3 3300035691 Ga0373931_0332586 Ga0373931_0332586_339_893 184
4 3300037068 Ga0373925_0277216 Ga0373925_0277216_80_634 184
5 3300037312 Ga0395899_0394680 Ga0395899_0394680_313_867 184
6 3300046462 Ga0495651_0727974 Ga0495651_0727974_50_604 184
7 3300046689 Ga0495613_0145915 Ga0495613_0145915_1091_1645 184
8 3300048921 Ga0496118_0101342 Ga0496118_0101342_390_959 184
9 3300049573 Ga0501037_0625106 Ga0501037_0625106_36_590 184
10 3300053080 Ga0500635_0012390 Ga0500635_0012390_1146_1700 184
11 3300009147 Ga0114129_10038102 Ga0114129_1003810211 185
12 3300050507 nmdc:mga05p37_135832_c1 nmdc:mga05p37_135832_c1_160_717 185
13 3300050508 nmdc:mga09592_193852_c1 nmdc:mga09592_193852_c1_1127_1684 185
14 iso_pu_bacteria 2571042588 2573038758 185
15 iso_pu_bacteria 2579778775 2580931404 185
16 iso_pu_bacteria 2619619294 2621276469 185
17 3300031595 Ga0265313_10113292 Ga0265313_101132922 186
18 3300042876 Ga0451577_0012770 Ga0451577_0012770_1835_2401 187
19 3300044712 Ga0453684_0040512 Ga0453684_0040512_363_929 187
20 3300045051 Ga0451576_0022092 Ga0451576_0022092_918_1484 187
21 3300049577 Ga0501041_0072568 Ga0501041_0072568_52_618 187
22 3300039437 Ga0436365_0430129 Ga0436365_0430129_422_1003 188
23 3300039453 Ga0436362_0542741 Ga0436362_0542741_341_922 188
24 3300035724 Ga0373933_0132340 Ga0373933_0132340_541_1149 189
25 3300044712 Ga0453684_0000195 Ga0453684_0000195_41896_42465 189
26 3300044712 Ga0453684_0016214 Ga0453684_0016214_6555_7127 189
27 3300045051 Ga0451576_0009657 Ga0451576_0009657_5135_5704 189
28 3300046459 Ga0495629_0031471 Ga0495629_0031471_2661_3269 189
29 3300046462 Ga0495651_0096963 Ga0495651_0096963_1072_1680 189
30 3300046463 Ga0495653_0067031 Ga0495653_0067031_513_1121 189
31 3300046511 Ga0495608_0351159 Ga0495608_0351159_231_839 189
32 3300046642 Ga0495634_0092966 Ga0495634_0092966_1103_1711 189
33 3300046679 Ga0495623_0039478 Ga0495623_0039478_1826_2434 189
34 3300046689 Ga0495613_0095354 Ga0495613_0095354_846_1454 189
35 3300047317 Ga0495604_0020499 Ga0495604_0020499_705_1313 189
36 3300047319 Ga0495674_0019395 Ga0495674_0019395_1724_2332 189
37 3300047322 Ga0495680_0164103 Ga0495680_0164103_494_1102 189
38 3300047444 Ga0495675_0047390 Ga0495675_0047390_355_963 189
39 3300047471 Ga0495684_0004425 Ga0495684_0004425_8898_9506 189
40 3300053084 Ga0495595_0101766 Ga0495595_0101766_705_1313 189
41 3300035241 Ga0373961_0000805 Ga0373961_0000805_1405_1980 191
42 3300038725 Ga0400484_31101 Ga0400484_31101_2247_2831 191
43 3300009177 Ga0105248_11702911 Ga0105248_117029111 192
44 3300007788 Ga0099795_10032396 Ga0099795_100323961 193
45 3300009551 Ga0105238_11028127 Ga0105238_110281272 193
46 3300013308 Ga0157375_10119433 Ga0157375_101194331 193
47 3300042876 Ga0451577_0465635 Ga0451577_0465635_546_1127 193
48 3300048912 Ga0496109_0289634 Ga0496109_0289634_502_1083 193
49 3300049575 Ga0501039_0241816 Ga0501039_0241816_646_1227 193
50 3300049588 Ga0501072_0335236 Ga0501072_0335236_444_1025 193
51 3300049591 Ga0501075_0037976 Ga0501075_0037976_2998_3579 193
52 3300049592 Ga0501076_0016104 Ga0501076_0016104_3756_4337 193
53 3300049824 Ga0501045_0109467 Ga0501045_0109467_576_1157 193
54 3300005467 Ga0070706_100041271 Ga0070706_1000412712 194
55 3300005614 Ga0068856_101041513 Ga0068856_1010415131 194
56 3300038443 Ga0395901_0173790 Ga0395901_0173790_905_1531 194
57 3300044656 Ga0466969_0038849 Ga0466969_0038849_1368_1994 194
58 3300044658 Ga0466972_0000363 Ga0466972_0000363_13942_14568 194
59 3300044658 Ga0466972_0075058 Ga0466972_0075058_629_1255 194
60 3300044684 Ga0466966_0002193 Ga0466966_0002193_2995_3621 194
61 3300044693 Ga0466961_0000090 Ga0466961_0000090_35225_35851 194
62 3300044706 Ga0466964_0092824 Ga0466964_0092824_383_1009 194
63 3300044735 Ga0466968_0056259 Ga0466968_0056259_631_1257 194
64 3300045049 Ga0466959_0010358 Ga0466959_0010358_1698_2324 194
65 3300045049 Ga0466959_0114881 Ga0466959_0114881_672_1298 194
66 3300049574 Ga0501038_0391319 Ga0501038_0391319_15_611 194
67 3300049589 Ga0501073_0253791 Ga0501073_0253791_526_1113 194
68 3300005329 Ga0070683_100230120 Ga0070683_1002301202 195
69 3300005336 Ga0070680_100881409 Ga0070680_1008814091 195
70 3300005458 Ga0070681_10473051 Ga0070681_104730512 195
71 3300005614 Ga0068856_100167805 Ga0068856_1001678053 195
72 3300005841 Ga0068863_101237310 Ga0068863_1012373101 195
73 3300013296 Ga0157374_10925759 Ga0157374_109257592 195
74 3300025909 Ga0207705_10415842 Ga0207705_104158421 195
75 3300025912 Ga0207707_10306843 Ga0207707_103068432 195
76 3300044694 Ga0466963_0110900 Ga0466963_0110900_1033_1626 195
77 3300044842 Ga0466957_0101804 Ga0466957_0101804_97_690 195
78 3300045836 Ga0466958_0322998 Ga0466958_0322998_177_770 195
79 3300046543 Ga0495645_0187746 Ga0495645_0187746_636_1262 195
80 3300049571 Ga0501034_0000663 Ga0501034_0000663_45395_45988 195
81 3300049584 Ga0501068_0008678 Ga0501068_0008678_4290_4883 195
82 3300049823 Ga0501044_0230806 Ga0501044_0230806_691_1284 195
83 3300050496 nmdc:mga07m45_30859_c1 nmdc:mga07m45_30859_c1_1344_1937 195
84 3300061719 Ga0466962_0030846 Ga0466962_0030846_452_1039 195
85 3300031239 Ga0265328_10028164 Ga0265328_100281643 196
86 3300035118 Ga0373954_0038279 Ga0373954_0038279_1387_2007 196
87 3300049592 Ga0501076_0730758 Ga0501076_0730758_144_743 196
88 3300053077 Ga0495601_0314771 Ga0495601_0314771_62_682 196
89 3300053098 Ga0500650_0268921 Ga0500650_0268921_25_615 196
90 3300005445 Ga0070708_100084821 Ga0070708_1000848213 197
91 3300005468 Ga0070707_100010470 Ga0070707_1000104704 197
92 3300005471 Ga0070698_100053689 Ga0070698_1000536894 197
93 3300005518 Ga0070699_100295610 Ga0070699_1002956103 197
94 3300025910 Ga0207684_10081693 Ga0207684_100816933 197
95 3300025922 Ga0207646_10024804 Ga0207646_100248042 197
96 3300035086 Ga0373934_0075925 Ga0373934_0075925_432_1055 197
97 3300035172 Ga0373955_0016636 Ga0373955_0016636_2703_3326 197
98 3300035724 Ga0373933_0011294 Ga0373933_0011294_1587_2210 197
99 3300036401 Ga0373937_0502795 Ga0373937_0502795_417_1040 197
100 3300046529 Ga0495652_0232721 Ga0495652_0232721_496_1119 197
101 3300046533 Ga0495640_0057460 Ga0495640_0057460_1208_1831 197
102 3300048088 Ga0495602_0092730 Ga0495602_0092730_1312_1935 197
103 3300049581 Ga0501047_0454671 Ga0501047_0454671_141_767 197
104 3300053085 Ga0495619_0020919 Ga0495619_0020919_3368_3991 197
105 3300026116 Ga0207674_10265382 Ga0207674_102653822 198
106 3300046462 Ga0495651_0034000 Ga0495651_0034000_2591_3244 199
107 3300046463 Ga0495653_0019006 Ga0495653_0019006_2330_2983 199
108 3300046536 Ga0495587_0006009 Ga0495587_0006009_1152_1805 199
109 3300046559 Ga0495667_0061794 Ga0495667_0061794_297_950 199
110 3300046675 Ga0495657_0016282 Ga0495657_0016282_2067_2720 199
111 3300046679 Ga0495623_0106695 Ga0495623_0106695_990_1643 199
112 3300046809 Ga0495600_0033343 Ga0495600_0033343_2562_3215 199
113 3300047317 Ga0495604_0078531 Ga0495604_0078531_564_1217 199
114 3300047322 Ga0495680_0003162 Ga0495680_0003162_3746_4399 199
115 3300047444 Ga0495675_0165696 Ga0495675_0165696_327_980 199
116 3300047673 Ga0495593_0151524 Ga0495593_0151524_485_1138 199
117 3300048088 Ga0495602_0090343 Ga0495602_0090343_1504_2157 199
118 3300053084 Ga0495595_0002360 Ga0495595_0002360_2498_3151 199
119 3300053085 Ga0495619_0045806 Ga0495619_0045806_2117_2770 199
120 3300031728 Ga0316578_10005935 Ga0316578_100059355 200
121 3300049569 Ga0501032_0264438 Ga0501032_0264438_138_746 200
122 3300049571 Ga0501034_0523579 Ga0501034_0523579_279_887 200
123 3300049575 Ga0501039_0393341 Ga0501039_0393341_295_903 200
124 3300017792 Ga0163161_10634404 Ga0163161_106344042 201
125 3300009545 Ga0105237_10617438 Ga0105237_106174381 202
126 3300037312 Ga0395899_0097110 Ga0395899_0097110_1138_1749 202
127 3300037418 Ga0395900_0023914 Ga0395900_0023914_3601_4212 202
128 3300037466 Ga0395898_0068553 Ga0395898_0068553_700_1311 202
129 3300038443 Ga0395901_0024268 Ga0395901_0024268_4866_5477 202
130 3300049568 Ga0501031_0008527 Ga0501031_0008527_5902_6510 202
131 3300049568 Ga0501031_0169324 Ga0501031_0169324_660_1268 202
132 3300049569 Ga0501032_0030107 Ga0501032_0030107_1135_1743 202
133 3300049570 Ga0501033_0002151 Ga0501033_0002151_7643_8251 202
134 3300049570 Ga0501033_0111535 Ga0501033_0111535_738_1349 202
135 3300049571 Ga0501034_0772255 Ga0501034_0772255_138_749 202
136 3300049572 Ga0501036_0024848 Ga0501036_0024848_1059_1667 202
137 3300049573 Ga0501037_0000635 Ga0501037_0000635_3643_4251 202
138 3300049573 Ga0501037_0150318 Ga0501037_0150318_931_1542 202
139 3300049574 Ga0501038_0025675 Ga0501038_0025675_1125_1733 202
140 3300049574 Ga0501038_0080510 Ga0501038_0080510_953_1561 202
141 3300049575 Ga0501039_0041561 Ga0501039_0041561_1374_1982 202
142 3300049577 Ga0501041_0239917 Ga0501041_0239917_258_866 202
143 3300049579 Ga0501043_0006300 Ga0501043_0006300_1762_2370 202
144 3300049579 Ga0501043_0069873 Ga0501043_0069873_1405_2016 202
145 3300049580 Ga0501046_0027341 Ga0501046_0027341_1886_2494 202
146 3300049580 Ga0501046_0091582 Ga0501046_0091582_645_1253 202
147 3300049581 Ga0501047_0057170 Ga0501047_0057170_2930_3541 202
148 3300049581 Ga0501047_0160252 Ga0501047_0160252_395_1003 202
149 3300049581 Ga0501047_0489960 Ga0501047_0489960_386_997 202
150 3300049584 Ga0501068_0167413 Ga0501068_0167413_85_693 202
151 3300049589 Ga0501073_0285772 Ga0501073_0285772_114_722 202
152 3300049744 Ga0501083_0131198 Ga0501083_0131198_661_1272 202
153 3300049822 Ga0501035_0001593 Ga0501035_0001593_14141_14749 202
154 3300049823 Ga0501044_0040881 Ga0501044_0040881_1919_2527 202
155 3300005435 Ga0070714_100280595 Ga0070714_1002805952 203
156 3300036712 Ga0316584_0025762 Ga0316584_0025762_709_1353 203
157 3300005435 Ga0070714_100007894 Ga0070714_1000078947 204
158 3300006028 Ga0070717_10129506 Ga0070717_101295062 204
159 3300009551 Ga0105238_10088823 Ga0105238_100888233 204
160 3300025924 Ga0207694_10136083 Ga0207694_101360832 204
161 iso_pu_bacteria 2508501128 2509148740 204
162 iso_pu_bacteria 2511231028 2511401368 204
163 iso_pu_bacteria 2513237092 2513626380 204
164 iso_pu_bacteria 2513237094 2513637091 204
165 iso_pu_bacteria 2513237095 2513652526 204
166 iso_pu_bacteria 2513237102 2513705957 204
167 iso_pu_bacteria 2513237104 2513719094 204
168 iso_pu_bacteria 2513237139 2513876658 204
169 iso_pu_bacteria 2513237141 2513887410 204
170 iso_pu_bacteria 2513237161 2514012297 204
171 iso_pu_bacteria 2524023205 2524440601 204
172 iso_pu_bacteria 2617270735 2617354209 204
173 iso_pu_bacteria 2617270741 2617373120 204
174 iso_pu_bacteria 2744054633 2745079313 204
175 iso_pu_bacteria 2791355196 2793061265 204
176 iso_pu_bacteria 2802429603 2805918638 204
177 iso_pu_bacteria 2816332527 2818236974 204
178 iso_pu_bacteria 2824600985 2824608558 204
179 iso_pu_bacteria 2824609381 2824613722 204
180 iso_pu_bacteria 2824653114 2824660278 204
181 iso_pu_bacteria 2824671348 2824678119 204
182 iso_pu_bacteria 2824687955 2824694249 204
183 iso_pu_bacteria 2824696289 2824703079 204
184 iso_pu_bacteria 2824704595 2824711777 204
185 iso_pu_bacteria 2824732956 2824739100 204
186 iso_pu_bacteria 2824746037 2824751973 204
187 iso_pu_bacteria 2824753945 2824763104 204
188 iso_pu_bacteria 2824763712 2824772896 204
189 iso_pu_bacteria 2824773399 2824779680 204
190 iso_pu_bacteria 2838122688 2838127124 204
191 iso_pu_bacteria 2841941048 2841947361 204
192 iso_pu_bacteria 2841949485 2841955850 204
193 iso_pu_bacteria 2841957949 2841961703 204
194 iso_pu_bacteria 2841966195 2841974317 204
195 iso_pu_bacteria 2841974524 2841981023 204
196 iso_pu_bacteria 2841983080 2841987224 204
197 iso_pu_bacteria 2844315083 2844320394 204
198 iso_pu_bacteria 2847930680 2847937929 204
199 iso_pu_bacteria 2847939898 2847948163 204
200 iso_pu_bacteria 2849076700 2849077929 204
201 iso_pu_bacteria 2857509624 2857511123 204
202 iso_pu_bacteria 2874612657 2874618501 204
203 iso_pu_bacteria 2874620515 2874625739 204
204 iso_pu_bacteria 2879083081 2879084210 204
205 iso_pu_bacteria 2881665667 2881673595 204
206 iso_pu_bacteria 2885366525 2885368355 204
207 iso_pu_bacteria 2885409591 2885409951 204
208 iso_pu_bacteria 2888378607 2888385899 204
209 iso_pu_bacteria 2888388044 2888392405 204
210 iso_pu_bacteria 2888419890 2888426005 204
211 iso_pu_bacteria 2903727486 2903732945 204
212 iso_pu_bacteria 2904666416 2904673900 204
213 iso_pu_bacteria 2904711408 2904711492 204
214 iso_pu_bacteria 2906602504 2906607277 204
215 iso_pu_bacteria 2906626472 2906630216 204
216 iso_pu_bacteria 2932794094 2932797712 204
217 iso_pu_bacteria 2932801729 2932804230 204
218 iso_pu_bacteria 2935883170 2935890413 204
219 iso_pu_bacteria 2935959822 2935965238 204
220 iso_pu_bacteria 3005483717 3005486210 204
221 iso_pu_bacteria 3005506211 3005511634 204
222 iso_pu_bacteria 3005594810 3005600773 204
223 iso_pu_bacteria 3005710791 3005716188 204
224 iso_pu_bacteria 3005718088 3005723563 204
225 iso_pu_bacteria 8006926726 8006927237 204
226 iso_pu_bacteria 8019648815 8019655654 204
227 iso_pu_bacteria 8056681323 8056682243 204
228 iso_pu_bacteria 8056967851 8056974661 204
229 3300005937 Ga0081455_10154528 Ga0081455_101545281 205
230 3300005985 Ga0081539_10022785 Ga0081539_100227854 205
231 3300025914 Ga0207671_10400542 Ga0207671_104005421 205
232 3300025929 Ga0207664_10011918 Ga0207664_100119183 205
233 3300045051 Ga0451576_0285468 Ga0451576_0285468_886_1539 205
234 3300053087 Ga0500643_037477 Ga0500643_037477_422_1039 205
235 3300039453 Ga0436362_1272902 Ga0436362_1272902_18_638 206
236 3300045049 Ga0466959_0165411 Ga0466959_0165411_831_1457 206
237 3300048924 Ga0496121_0082401 Ga0496121_0082401_635_1306 206
238 3300053153 Ga0500616_0006542 Ga0500616_0006542_2653_3279 206
239 3300053153 Ga0500616_0040724 Ga0500616_0040724_1584_2210 206
240 3300009551 Ga0105238_10818959 Ga0105238_108189592 207
241 3300010375 Ga0105239_10297681 Ga0105239_102976812 207
242 3300025297 Ga0209758_1002345 Ga0209758_100234516 207
243 3300025935 Ga0207709_10453441 Ga0207709_104534411 207
244 3300037418 Ga0395900_0121023 Ga0395900_0121023_833_1456 207
245 3300037466 Ga0395898_0090138 Ga0395898_0090138_1404_2027 207
246 3300038443 Ga0395901_0371344 Ga0395901_0371344_254_877 207
247 3300048924 Ga0496121_0210395 Ga0496121_0210395_182_805 207
248 3300049569 Ga0501032_0053412 Ga0501032_0053412_1999_2622 207
249 3300049570 Ga0501033_0026938 Ga0501033_0026938_2748_3371 207
250 3300049570 Ga0501033_0145328 Ga0501033_0145328_593_1216 207
251 3300049571 Ga0501034_0044965 Ga0501034_0044965_2459_3082 207
252 3300049574 Ga0501038_0123439 Ga0501038_0123439_908_1531 207
253 3300049575 Ga0501039_0079044 Ga0501039_0079044_86_709 207
254 3300049579 Ga0501043_0031952 Ga0501043_0031952_1992_2615 207
255 3300049581 Ga0501047_0034955 Ga0501047_0034955_387_1010 207
256 3300049822 Ga0501035_0011227 Ga0501035_0011227_2366_2989 207
257 3300049823 Ga0501044_0038664 Ga0501044_0038664_1775_2398 207
258 3300003203 JGI25406J46586_10000262 JGI25406J46586_1000026215 208
259 3300003215 JGI25153J46596_10002451 JGI25153J46596_100024515 208
260 3300003771 Ga0055526_1018124 Ga0055526_10181244 208
261 3300005329 Ga0070683_100003848 Ga0070683_1000038486 208
262 3300005336 Ga0070680_100012456 Ga0070680_1000124565 208
263 3300005336 Ga0070680_100035084 Ga0070680_1000350845 208
264 3300005339 Ga0070660_100023176 Ga0070660_1000231763 208
265 3300005366 Ga0070659_100032520 Ga0070659_1000325205 208
266 3300005435 Ga0070714_100591749 Ga0070714_1005917492 208
267 3300005436 Ga0070713_100001936 Ga0070713_1000019363 208
268 3300005436 Ga0070713_100096821 Ga0070713_1000968213 208
269 3300005437 Ga0070710_10000534 Ga0070710_1000053417 208
270 3300005439 Ga0070711_100000548 Ga0070711_1000005485 208
271 3300005439 Ga0070711_100082260 Ga0070711_1000822602 208
272 3300005439 Ga0070711_100134397 Ga0070711_1001343972 208
273 3300005458 Ga0070681_10013695 Ga0070681_100136957 208
274 3300005467 Ga0070706_100301270 Ga0070706_1003012702 208
275 3300005468 Ga0070707_100110041 Ga0070707_1001100414 208
276 3300005471 Ga0070698_100154339 Ga0070698_1001543393 208
277 3300005530 Ga0070679_100091249 Ga0070679_1000912494 208
278 3300005530 Ga0070679_100203108 Ga0070679_1002031083 208
279 3300005535 Ga0070684_100032160 Ga0070684_1000321602 208
280 3300005536 Ga0070697_100075090 Ga0070697_1000750902 208
281 3300005539 Ga0068853_100022837 Ga0068853_1000228373 208
282 3300005544 Ga0070686_100653660 Ga0070686_1006536601 208
283 3300005563 Ga0068855_100056975 Ga0068855_1000569752 208
284 3300005563 Ga0068855_100339057 Ga0068855_1003390572 208
285 3300005564 Ga0070664_100167809 Ga0070664_1001678092 208
286 3300005578 Ga0068854_100280665 Ga0068854_1002806652 208
287 3300005614 Ga0068856_100058718 Ga0068856_1000587182 208
288 3300005616 Ga0068852_100010119 Ga0068852_1000101194 208
289 3300005616 Ga0068852_100137152 Ga0068852_1001371523 208
290 3300005842 Ga0068858_100458750 Ga0068858_1004587502 208
291 3300005843 Ga0068860_100003417 Ga0068860_10000341710 208
292 3300005937 Ga0081455_10007978 Ga0081455_100079789 208
293 3300005983 Ga0081540_1010925 Ga0081540_10109253 208
294 3300005983 Ga0081540_1022172 Ga0081540_10221721 208
295 3300005985 Ga0081539_10000003 Ga0081539_10000003493 208
296 3300006028 Ga0070717_10001632 Ga0070717_100016329 208
297 3300006028 Ga0070717_10051927 Ga0070717_100519274 208
298 3300006028 Ga0070717_10088384 Ga0070717_100883842 208
299 3300006028 Ga0070717_10432987 Ga0070717_104329872 208
300 3300006028 Ga0070717_10692752 Ga0070717_106927522 208
301 3300006163 Ga0070715_10021767 Ga0070715_100217672 208
302 3300006163 Ga0070715_10028972 Ga0070715_100289724 208
303 3300006175 Ga0070712_100111108 Ga0070712_1001111082 208
304 3300006175 Ga0070712_100564998 Ga0070712_1005649982 208
305 3300006178 Ga0075367_10002456 Ga0075367_100024568 208
306 3300006195 Ga0075366_10092763 Ga0075366_100927633 208
307 3300006237 Ga0097621_100179336 Ga0097621_1001793362 208
308 3300006852 Ga0075433_10193924 Ga0075433_101939242 208
309 3300006871 Ga0075434_100075472 Ga0075434_1000754723 208
310 3300007788 Ga0099795_10006504 Ga0099795_100065043 208
311 3300007788 Ga0099795_10248416 Ga0099795_102484161 208
312 3300009093 Ga0105240_10212180 Ga0105240_102121802 208
313 3300009093 Ga0105240_10694199 Ga0105240_106941992 208
314 3300009545 Ga0105237_10244674 Ga0105237_102446742 208
315 3300009551 Ga0105238_10003869 Ga0105238_100038697 208
316 3300010375 Ga0105239_10082874 Ga0105239_100828744 208
317 3300013102 Ga0157371_10498231 Ga0157371_104982312 208
318 3300013104 Ga0157370_10040261 Ga0157370_100402613 208
319 3300013104 Ga0157370_10066584 Ga0157370_100665843 208
320 3300013105 Ga0157369_10000685 Ga0157369_100006855 208
321 3300013105 Ga0157369_10267359 Ga0157369_102673592 208
322 3300021358 Ga0213873_10004137 Ga0213873_100041373 208
323 3300021361 Ga0213872_10030128 Ga0213872_100301282 208
324 3300025295 Ga0209564_1000407 Ga0209564_100040744 208
325 3300025297 Ga0209758_1000320 Ga0209758_100032081 208
326 3300025297 Ga0209758_1009982 Ga0209758_10099824 208
327 3300025898 Ga0207692_10000091 Ga0207692_1000009117 208
328 3300025900 Ga0207710_10004729 Ga0207710_100047295 208
329 3300025905 Ga0207685_10012829 Ga0207685_100128292 208
330 3300025905 Ga0207685_10051470 Ga0207685_100514703 208
331 3300025906 Ga0207699_10000782 Ga0207699_1000078215 208
332 3300025906 Ga0207699_10008595 Ga0207699_100085952 208
333 3300025908 Ga0207643_10151075 Ga0207643_101510752 208
334 3300025909 Ga0207705_10032876 Ga0207705_100328764 208
335 3300025910 Ga0207684_10248852 Ga0207684_102488522 208
336 3300025910 Ga0207684_10415653 Ga0207684_104156531 208
337 3300025912 Ga0207707_10001881 Ga0207707_1000188113 208
338 3300025914 Ga0207671_10379637 Ga0207671_103796372 208
339 3300025915 Ga0207693_10009983 Ga0207693_100099833 208
340 3300025915 Ga0207693_10029076 Ga0207693_100290764 208
341 3300025915 Ga0207693_10111691 Ga0207693_101116912 208
342 3300025915 Ga0207693_10314100 Ga0207693_103141002 208
343 3300025916 Ga0207663_10023702 Ga0207663_100237023 208
344 3300025916 Ga0207663_10046321 Ga0207663_100463212 208
345 3300025916 Ga0207663_10047322 Ga0207663_100473223 208
346 3300025917 Ga0207660_10005375 Ga0207660_100053756 208
347 3300025917 Ga0207660_10048097 Ga0207660_100480974 208
348 3300025919 Ga0207657_10005742 Ga0207657_100057423 208
349 3300025921 Ga0207652_10001649 Ga0207652_1000164914 208
350 3300025922 Ga0207646_10257142 Ga0207646_102571421 208
351 3300025924 Ga0207694_10041393 Ga0207694_100413933 208
352 3300025928 Ga0207700_10001432 Ga0207700_100014323 208
353 3300025928 Ga0207700_10018197 Ga0207700_100181975 208
354 3300025928 Ga0207700_10396814 Ga0207700_103968142 208
355 3300025929 Ga0207664_10012540 Ga0207664_100125408 208
356 3300025929 Ga0207664_10023054 Ga0207664_100230543 208
357 3300025932 Ga0207690_10076350 Ga0207690_100763502 208
358 3300025939 Ga0207665_10038595 Ga0207665_100385953 208
359 3300025939 Ga0207665_10101486 Ga0207665_101014863 208
360 3300025942 Ga0207689_10043629 Ga0207689_100436294 208
361 3300025944 Ga0207661_10017276 Ga0207661_100172765 208
362 3300025949 Ga0207667_10037563 Ga0207667_100375634 208
363 3300025949 Ga0207667_10272240 Ga0207667_102722401 208
364 3300026041 Ga0207639_10021282 Ga0207639_100212824 208
365 3300026095 Ga0207676_10105807 Ga0207676_101058071 208
366 3300026116 Ga0207674_10023609 Ga0207674_100236095 208
367 3300026118 Ga0207675_101017567 Ga0207675_1010175671 208
368 3300026142 Ga0207698_10123770 Ga0207698_101237702 208
369 3300028381 Ga0268264_10000168 Ga0268264_1000016848 208
370 3300028558 Ga0265326_10050399 Ga0265326_100503992 208
371 3300028563 Ga0265319_1014519 Ga0265319_10145192 208
372 3300028573 Ga0265334_10014411 Ga0265334_100144112 208
373 3300028573 Ga0265334_10021414 Ga0265334_100214142 208
374 3300028577 Ga0265318_10034328 Ga0265318_100343284 208
375 3300028653 Ga0265323_10003421 Ga0265323_100034215 208
376 3300028666 Ga0265336_10000308 Ga0265336_100003082 208
377 3300028786 Ga0307517_10000071 Ga0307517_1000007164 208
378 3300028786 Ga0307517_10120374 Ga0307517_101203742 208
379 3300028800 Ga0265338_10000085 Ga0265338_10000085120 208
380 3300029957 Ga0265324_10017984 Ga0265324_100179845 208
381 3300030521 Ga0307511_10079431 Ga0307511_100794313 208
382 3300031235 Ga0265330_10014492 Ga0265330_100144923 208
383 3300031241 Ga0265325_10180321 Ga0265325_101803212 208
384 3300031247 Ga0265340_10005231 Ga0265340_100052315 208
385 3300031249 Ga0265339_10003778 Ga0265339_100037783 208
386 3300031616 Ga0307508_10000008 Ga0307508_10000008203 208
387 3300031616 Ga0307508_10108158 Ga0307508_101081582 208
388 3300031616 Ga0307508_10111233 Ga0307508_101112333 208
389 3300031711 Ga0265314_10089763 Ga0265314_100897632 208
390 3300031712 Ga0265342_10126271 Ga0265342_101262712 208
391 3300033179 Ga0307507_10008502 Ga0307507_1000850214 208
392 3300033180 Ga0307510_10018893 Ga0307510_100188932 208
393 3300033544 Ga0316215_1001248 Ga0316215_10012482 208
394 3300035083 Ga0373926_0047925 Ga0373926_0047925_428_1054 208
395 3300035089 Ga0373944_0049296 Ga0373944_0049296_579_1205 208
396 3300035111 Ga0373923_0117833 Ga0373923_0117833_352_978 208
397 3300035116 Ga0373945_0053545 Ga0373945_0053545_113_739 208
398 3300035116 Ga0373945_0143094 Ga0373945_0143094_171_797 208
399 3300035118 Ga0373954_0006494 Ga0373954_0006494_3798_4424 208
400 3300035119 Ga0373956_0104538 Ga0373956_0104538_508_1134 208
401 3300035120 Ga0373957_0000801 Ga0373957_0000801_104_730 208
402 3300035170 Ga0373943_0016263 Ga0373943_0016263_2151_2777 208
403 3300035170 Ga0373943_0051269 Ga0373943_0051269_1221_1847 208
404 3300035172 Ga0373955_0001870 Ga0373955_0001870_8259_8885 208
405 3300035691 Ga0373931_0052031 Ga0373931_0052031_1002_1628 208
406 3300035692 Ga0373935_0097514 Ga0373935_0097514_43_669 208
407 3300035692 Ga0373935_0159500 Ga0373935_0159500_593_1219 208
408 3300035695 Ga0373927_0001984 Ga0373927_0001984_4122_4748 208
409 3300035695 Ga0373927_0027195 Ga0373927_0027195_375_1001 208
410 3300035695 Ga0373927_0054260 Ga0373927_0054260_971_1597 208
411 3300035724 Ga0373933_0000038 Ga0373933_0000038_71240_71866 208
412 3300035724 Ga0373933_0148685 Ga0373933_0148685_178_804 208
413 3300035724 Ga0373933_0194234 Ga0373933_0194234_183_809 208
414 3300035725 Ga0373947_0040566 Ga0373947_0040566_1938_2564 208
415 3300035725 Ga0373947_0111624 Ga0373947_0111624_536_1162 208
416 3300035725 Ga0373947_0166662 Ga0373947_0166662_336_962 208
417 3300035725 Ga0373947_0176760 Ga0373947_0176760_114_740 208
418 3300036401 Ga0373937_0011662 Ga0373937_0011662_5545_6171 208
419 3300036401 Ga0373937_0100053 Ga0373937_0100053_338_964 208
420 3300036459 Ga0372808_005719 Ga0372808_005719_495_1121 208
421 3300037068 Ga0373925_0020481 Ga0373925_0020481_2484_3110 208
422 3300037068 Ga0373925_0049703 Ga0373925_0049703_1473_2099 208
423 3300037068 Ga0373925_0339340 Ga0373925_0339340_94_720 208
424 3300037471 Ga0395905_0035844 Ga0395905_0035844_1759_2385 208
425 3300037471 Ga0395905_0503207 Ga0395905_0503207_37_663 208
426 3300037853 Ga0436364_0908905 Ga0436364_0908905_187_828 208
427 3300039437 Ga0436365_0259616 Ga0436365_0259616_282_911 208
428 3300039438 Ga0436360_0322671 Ga0436360_0322671_345_971 208
429 3300039438 Ga0436360_0499741 Ga0436360_0499741_885_1511 208
430 3300039438 Ga0436360_0820351 Ga0436360_0820351_909_1535 208
431 3300039447 Ga0436361_0323070 Ga0436361_0323070_133_759 208
432 3300039447 Ga0436361_0779011 Ga0436361_0779011_743_1369 208
433 3300039450 Ga0436363_1220467 Ga0436363_1220467_582_1208 208
434 3300039450 Ga0436363_1513497 Ga0436363_1513497_244_870 208
435 3300041451 Ga0451791_1595999 Ga0451791_1595999_384_1010 208
436 3300041498 Ga0451841_0724584 Ga0451841_0724584_38_664 208
437 3300044656 Ga0466969_0106716 Ga0466969_0106716_113_739 208
438 3300044656 Ga0466969_0192955 Ga0466969_0192955_67_693 208
439 3300045049 Ga0466959_0026042 Ga0466959_0026042_865_1491 208
440 3300045836 Ga0466958_0041483 Ga0466958_0041483_1325_1951 208
441 3300046454 Ga0495592_0047000 Ga0495592_0047000_2408_3034 208
442 3300046455 Ga0495603_0001668 Ga0495603_0001668_9053_9679 208
443 3300046455 Ga0495603_0032422 Ga0495603_0032422_901_1527 208
444 3300046455 Ga0495603_0294517 Ga0495603_0294517_70_696 208
445 3300046459 Ga0495629_0004290 Ga0495629_0004290_9763_10389 208
446 3300046460 Ga0495638_0207793 Ga0495638_0207793_385_1011 208
447 3300046463 Ga0495653_0051789 Ga0495653_0051789_1111_1737 208
448 3300046472 Ga0495580_0068041 Ga0495580_0068041_1455_2081 208
449 3300046476 Ga0495662_0143963 Ga0495662_0143963_125_751 208
450 3300046491 Ga0495584_0398262 Ga0495584_0398262_43_669 208
451 3300046499 Ga0495594_0089452 Ga0495594_0089452_1048_1674 208
452 3300046499 Ga0495594_0120670 Ga0495594_0120670_579_1205 208
453 3300046507 Ga0495606_0000514 Ga0495606_0000514_48953_49579 208
454 3300046507 Ga0495606_0053725 Ga0495606_0053725_594_1220 208
455 3300046511 Ga0495608_0040209 Ga0495608_0040209_2161_2787 208
456 3300046514 Ga0495618_0188583 Ga0495618_0188583_593_1219 208
457 3300046516 Ga0495628_0093079 Ga0495628_0093079_189_815 208
458 3300046524 Ga0495648_0009740 Ga0495648_0009740_2982_3608 208
459 3300046526 Ga0495666_0082825 Ga0495666_0082825_660_1286 208
460 3300046529 Ga0495652_0029755 Ga0495652_0029755_178_804 208
461 3300046531 Ga0495665_0284838 Ga0495665_0284838_39_665 208
462 3300046533 Ga0495640_0029441 Ga0495640_0029441_3306_3932 208
463 3300046536 Ga0495587_0086273 Ga0495587_0086273_1013_1639 208
464 3300046543 Ga0495645_0103711 Ga0495645_0103711_452_1078 208
465 3300046557 Ga0495622_0069998 Ga0495622_0069998_272_898 208
466 3300046559 Ga0495667_0037530 Ga0495667_0037530_2260_2886 208
467 3300046642 Ga0495634_0020543 Ga0495634_0020543_187_813 208
468 3300046663 Ga0495635_0004272 Ga0495635_0004272_9083_9709 208
469 3300046674 Ga0495588_0028455 Ga0495588_0028455_1179_1805 208
470 3300046675 Ga0495657_0042191 Ga0495657_0042191_1669_2295 208
471 3300046678 Ga0495599_0110503 Ga0495599_0110503_199_825 208
472 3300046679 Ga0495623_0023294 Ga0495623_0023294_2260_2886 208
473 3300046684 Ga0495669_0338626 Ga0495669_0338626_14_640 208
474 3300046689 Ga0495613_0065807 Ga0495613_0065807_195_821 208
475 3300046690 Ga0495624_0277220 Ga0495624_0277220_339_965 208
476 3300046809 Ga0495600_0386448 Ga0495600_0386448_178_804 208
477 3300047317 Ga0495604_0254246 Ga0495604_0254246_178_804 208
478 3300047319 Ga0495674_0026267 Ga0495674_0026267_4539_5165 208
479 3300047320 Ga0495672_0082483 Ga0495672_0082483_177_803 208
480 3300047321 Ga0495676_0252291 Ga0495676_0252291_142_768 208
481 3300047322 Ga0495680_0024509 Ga0495680_0024509_950_1576 208
482 3300047322 Ga0495680_0299665 Ga0495680_0299665_389_1015 208
483 3300047444 Ga0495675_0008654 Ga0495675_0008654_3555_4181 208
484 3300047447 Ga0495685_087073 Ga0495685_087073_386_1012 208
485 3300047471 Ga0495684_0007358 Ga0495684_0007358_342_968 208
486 3300047472 Ga0495686_0050201 Ga0495686_0050201_1643_2269 208
487 3300047673 Ga0495593_0031228 Ga0495593_0031228_1797_2423 208
488 3300048088 Ga0495602_0518457 Ga0495602_0518457_155_781 208
489 3300048903 Ga0496100_0134379 Ga0496100_0134379_808_1434 208
490 3300048904 Ga0496101_0016399 Ga0496101_0016399_2790_3416 208
491 3300048907 Ga0496104_0137003 Ga0496104_0137003_194_820 208
492 3300048907 Ga0496104_0797391 Ga0496104_0797391_159_785 208
493 3300048909 Ga0496106_0000469 Ga0496106_0000469_2555_3181 208
494 3300048912 Ga0496109_0752187 Ga0496109_0752187_67_693 208
495 3300048914 Ga0496111_0256563 Ga0496111_0256563_321_947 208
496 3300048915 Ga0496112_0000045 Ga0496112_0000045_7493_8119 208
497 3300048915 Ga0496112_0157903 Ga0496112_0157903_457_1083 208
498 3300048916 Ga0496113_0090148 Ga0496113_0090148_290_916 208
499 3300048916 Ga0496113_0103546 Ga0496113_0103546_1431_2057 208
500 3300048917 Ga0496114_0735629 Ga0496114_0735629_196_822 208
501 3300048918 Ga0496115_0014957 Ga0496115_0014957_2554_3180 208
502 3300048918 Ga0496115_0020501 Ga0496115_0020501_2790_3416 208
503 3300048918 Ga0496115_0063096 Ga0496115_0063096_614_1240 208
504 3300048918 Ga0496115_0071738 Ga0496115_0071738_2024_2650 208
505 3300048918 Ga0496115_0115536 Ga0496115_0115536_964_1590 208
506 3300048919 Ga0496116_0109789 Ga0496116_0109789_391_1017 208
507 3300048920 Ga0496117_0035263 Ga0496117_0035263_788_1429 208
508 3300048920 Ga0496117_0051048 Ga0496117_0051048_565_1191 208
509 3300048920 Ga0496117_0059683 Ga0496117_0059683_1534_2160 208
510 3300048921 Ga0496118_0005305 Ga0496118_0005305_3934_4560 208
511 3300048921 Ga0496118_0016550 Ga0496118_0016550_2804_3445 208
512 3300048921 Ga0496118_0051430 Ga0496118_0051430_627_1253 208
513 3300048922 Ga0496119_0091279 Ga0496119_0091279_737_1363 208
514 3300048922 Ga0496119_0165367 Ga0496119_0165367_96_722 208
515 3300048924 Ga0496121_0000225 Ga0496121_0000225_77186_77812 208
516 3300048924 Ga0496121_0000506 Ga0496121_0000506_22135_22761 208
517 3300048924 Ga0496121_0020848 Ga0496121_0020848_4407_5033 208
518 3300048924 Ga0496121_0105958 Ga0496121_0105958_842_1468 208
519 3300048924 Ga0496121_0281403 Ga0496121_0281403_358_984 208
520 3300048927 Ga0496124_0000391 Ga0496124_0000391_72528_73154 208
521 3300048927 Ga0496124_0238264 Ga0496124_0238264_208_849 208
522 3300048927 Ga0496124_0440626 Ga0496124_0440626_103_729 208
523 3300048928 Ga0496125_0026719 Ga0496125_0026719_3960_4586 208
524 3300048928 Ga0496125_0058042 Ga0496125_0058042_1092_1733 208
525 3300048929 Ga0496126_0003778 Ga0496126_0003778_11693_12319 208
526 3300048929 Ga0496126_0086651 Ga0496126_0086651_373_1008 208
527 3300048929 Ga0496126_0091722 Ga0496126_0091722_1630_2256 208
528 3300048929 Ga0496126_0234723 Ga0496126_0234723_309_935 208
529 3300048929 Ga0496126_0704239 Ga0496126_0704239_97_723 208
530 3300049568 Ga0501031_0000308 Ga0501031_0000308_10794_11420 208
531 3300049569 Ga0501032_0001663 Ga0501032_0001663_8824_9450 208
532 3300049569 Ga0501032_0033117 Ga0501032_0033117_2458_3084 208
533 3300049569 Ga0501032_0045454 Ga0501032_0045454_923_1549 208
534 3300049569 Ga0501032_0328888 Ga0501032_0328888_278_904 208
535 3300049570 Ga0501033_0003890 Ga0501033_0003890_4872_5498 208
536 3300049571 Ga0501034_0000202 Ga0501034_0000202_71257_71883 208
537 3300049571 Ga0501034_0193799 Ga0501034_0193799_340_966 208
538 3300049571 Ga0501034_0328713 Ga0501034_0328713_371_997 208
539 3300049572 Ga0501036_0000042 Ga0501036_0000042_38173_38799 208
540 3300049572 Ga0501036_0425114 Ga0501036_0425114_18_644 208
541 3300049573 Ga0501037_0000100 Ga0501037_0000100_35009_35635 208
542 3300049573 Ga0501037_0073891 Ga0501037_0073891_115_741 208
543 3300049573 Ga0501037_0146859 Ga0501037_0146859_320_946 208
544 3300049573 Ga0501037_0188615 Ga0501037_0188615_371_997 208
545 3300049574 Ga0501038_0000353 Ga0501038_0000353_19918_20544 208
546 3300049574 Ga0501038_0000377 Ga0501038_0000377_16119_16745 208
547 3300049574 Ga0501038_0018922 Ga0501038_0018922_3131_3757 208
548 3300049575 Ga0501039_0000216 Ga0501039_0000216_34990_35616 208
549 3300049575 Ga0501039_0247592 Ga0501039_0247592_553_1179 208
550 3300049576 Ga0501040_0114402 Ga0501040_0114402_288_914 208
551 3300049577 Ga0501041_0219253 Ga0501041_0219253_468_1094 208
552 3300049578 Ga0501042_0062074 Ga0501042_0062074_1943_2569 208
553 3300049578 Ga0501042_0126926 Ga0501042_0126926_1133_1759 208
554 3300049579 Ga0501043_0000666 Ga0501043_0000666_10824_11450 208
555 3300049579 Ga0501043_0491117 Ga0501043_0491117_204_830 208
556 3300049580 Ga0501046_0001530 Ga0501046_0001530_2298_2924 208
557 3300049580 Ga0501046_0177489 Ga0501046_0177489_614_1240 208
558 3300049581 Ga0501047_0000159 Ga0501047_0000159_43029_43655 208
559 3300049581 Ga0501047_0070002 Ga0501047_0070002_2199_2825 208
560 3300049581 Ga0501047_0112892 Ga0501047_0112892_1477_2103 208
561 3300049581 Ga0501047_0232944 Ga0501047_0232944_1036_1662 208
562 3300049581 Ga0501047_0268257 Ga0501047_0268257_830_1456 208
563 3300049582 Ga0501048_0000753 Ga0501048_0000753_8671_9297 208
564 3300049582 Ga0501048_0187342 Ga0501048_0187342_614_1240 208
565 3300049582 Ga0501048_0304065 Ga0501048_0304065_466_1092 208
566 3300049583 Ga0501067_0000143 Ga0501067_0000143_17587_18213 208
567 3300049583 Ga0501067_0015512 Ga0501067_0015512_2738_3364 208
568 3300049584 Ga0501068_0000487 Ga0501068_0000487_2161_2787 208
569 3300049584 Ga0501068_0006764 Ga0501068_0006764_5280_5906 208
570 3300049585 Ga0501069_0001614 Ga0501069_0001614_1520_2146 208
571 3300049586 Ga0501070_0012963 Ga0501070_0012963_3946_4572 208
572 3300049586 Ga0501070_0026527 Ga0501070_0026527_1546_2172 208
573 3300049586 Ga0501070_0681018 Ga0501070_0681018_171_797 208
574 3300049587 Ga0501071_0059386 Ga0501071_0059386_1290_1916 208
575 3300049587 Ga0501071_0072664 Ga0501071_0072664_35_661 208
576 3300049588 Ga0501072_0004288 Ga0501072_0004288_10066_10692 208
577 3300049588 Ga0501072_0089127 Ga0501072_0089127_1282_1908 208
578 3300049589 Ga0501073_0000151 Ga0501073_0000151_17290_17916 208
579 3300049589 Ga0501073_0021687 Ga0501073_0021687_994_1620 208
580 3300049589 Ga0501073_0248710 Ga0501073_0248710_494_1120 208
581 3300049590 Ga0501074_0000117 Ga0501074_0000117_26800_27426 208
582 3300049590 Ga0501074_0018790 Ga0501074_0018790_3586_4212 208
583 3300049590 Ga0501074_0093727 Ga0501074_0093727_187_813 208
584 3300049592 Ga0501076_0221505 Ga0501076_0221505_306_932 208
585 3300049742 Ga0501080_0000845 Ga0501080_0000845_9827_10453 208
586 3300049742 Ga0501080_0019680 Ga0501080_0019680_4645_5271 208
587 3300049742 Ga0501080_0041782 Ga0501080_0041782_349_975 208
588 3300049744 Ga0501083_0001012 Ga0501083_0001012_8190_8816 208
589 3300049744 Ga0501083_0027807 Ga0501083_0027807_2626_3252 208
590 3300049822 Ga0501035_0000172 Ga0501035_0000172_1485_2111 208
591 3300049822 Ga0501035_0146034 Ga0501035_0146034_907_1533 208
592 3300049822 Ga0501035_0429527 Ga0501035_0429527_243_869 208
593 3300049823 Ga0501044_0000282 Ga0501044_0000282_24380_25006 208
594 3300049823 Ga0501044_0011954 Ga0501044_0011954_8153_8779 208
595 3300049823 Ga0501044_0069698 Ga0501044_0069698_1410_2036 208
596 3300049823 Ga0501044_0506752 Ga0501044_0506752_464_1090 208
597 3300049823 Ga0501044_0714485 Ga0501044_0714485_243_869 208
598 3300049824 Ga0501045_0356526 Ga0501045_0356526_87_713 208
599 3300049824 Ga0501045_0385961 Ga0501045_0385961_371_997 208
600 3300050512 nmdc:mga0n895_68916_c1 nmdc:mga0n895_68916_c1_1104_1730 208
601 3300053077 Ga0495601_0089801 Ga0495601_0089801_241_867 208
602 3300053080 Ga0500635_0025476 Ga0500635_0025476_1034_1660 208
603 3300053084 Ga0495595_0000665 Ga0495595_0000665_5525_6151 208
604 3300053085 Ga0495619_0017529 Ga0495619_0017529_3555_4181 208
605 3300053093 Ga0500651_0015705 Ga0500651_0015705_3083_3709 208
606 3300053094 Ga0500566_0000003 Ga0500566_0000003_8900_9526 208
607 3300053094 Ga0500566_0091176 Ga0500566_0091176_737_1363 208
608 3300053111 Ga0500572_000096 Ga0500572_000096_8910_9536 208
609 3300053118 Ga0500594_0017931 Ga0500594_0017931_1057_1683 208
610 3300053119 Ga0500595_002883 Ga0500595_002883_798_1424 208
611 3300053119 Ga0500595_003476 Ga0500595_003476_843_1469 208
612 3300053122 Ga0500608_007904 Ga0500608_007904_1639_2265 208
613 3300053136 Ga0500559_0001590 Ga0500559_0001590_702_1328 208
614 3300053136 Ga0500559_0012644 Ga0500559_0012644_484_1110 208
615 3300053139 Ga0500568_0027582 Ga0500568_0027582_1347_1973 208
616 3300053148 Ga0500590_130676 Ga0500590_130676_115_741 208
617 3300053150 Ga0500603_000752 Ga0500603_000752_1036_1662 208
618 3300053150 Ga0500603_001019 Ga0500603_001019_1464_2090 208
619 3300053156 Ga0500622_0115776 Ga0500622_0115776_517_1143 208
620 3300053159 Ga0500630_001065 Ga0500630_001065_123_749 208
621 3300053162 Ga0500638_035002 Ga0500638_035002_1688_2314 208
622 3300053163 Ga0500639_000264 Ga0500639_000264_19507_20133 208
623 3300053177 Ga0500636_0034548 Ga0500636_0034548_330_971 208
624 3300053725 Ga0500576_096258 Ga0500576_096258_377_1003 208
625 3300053733 Ga0500552_003192 Ga0500552_003192_546_1172 208
626 3300053734 Ga0500565_007778 Ga0500565_007778_42_668 208
627 3300053735 Ga0500596_000577 Ga0500596_000577_1630_2256 208
628 3300054114 Ga0501084_0000856 Ga0501084_0000856_16498_17124 208
629 3300054114 Ga0501084_0082116 Ga0501084_0082116_1603_2229 208
630 3300054114 Ga0501084_0547212 Ga0501084_0547212_10_636 208
631 3300060353 Ga0501082_0062521 Ga0501082_0062521_1349_1975 208
632 3300061719 Ga0466962_0053035 Ga0466962_0053035_829_1455 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

16

192

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9856 14 193
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9705 14 191
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9699 14 191
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9697 14 193
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9507 14 199
ID Description Score Start End Superfamily
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9855 14 195 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9784 20 191 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.968 14 193 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9544 14 195 1.10.340.30
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9395 12 191 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A0A8K1W9-F1-model_v4 DNA-3-methyladenine glycosylase (EC 3.2.2.20) 0.9993 26 197 GO:0006284
GO:0008725
GO:0046872
AF-A0A2N3E7L6-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9973 14 196 GO:0006284
GO:0008725
GO:0046872
AF-A0A7U3HDY0-F1-model_v4 deleted 0.9965 4 193
AF-A0A7T9HZA3-F1-model_v4 deleted 0.9963 12 194
AF-A0A2S6N4P6-F1-model_v4 DNA-3-methyladenine glycosylase 0.9961 3 197 GO:0006284
GO:0008725
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.2 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map