F471012

General Info

Members Datasets Scaffolds Average Seq Length
632 304 1264 291

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0015468|Ga0395900_0015468_6275_7207
Length 310
Sequence VAVRAEAAVVAPPRTFSERLVRALKRAPLHLGLLAVAIIWLVPTIGLAVTSIRPRSDILSSGWWNVFTSHLTFENYSKVIHTAGMGHAFLNSIYITLPATILPLTLGALAAYAFAWTRFPFRDAVFLCIVALMVVPIQAAFVPLLKIFRTWDLHVDLFGVGLIHWAHLNNSFWGIWLAHTAFGLPLAIFLFRNFFITLPKDLIEAARMDGASEFAVFRRVVLPLSVPALASFAIFQFLWVWNDLLMALVFVSDPAKQPMTVKITTLISTYGVEYQLLSAAAFLLMVLPLAVFFALQRYFVQGLLAGSVKS

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
299 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 9.65
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0015468 3300037418 Bacteria 7778
2 JGI24752J21851_1004540 3300001976 Bacteria 1820
3 JGI24743J22301_10022324 3300001991 Bacteria 1213
4 JGI24743J22301_10030000 3300001991 Bacteria 1068
5 JGI24749J21850_1012987 3300002076 Bacteria 1170
6 JGI24744J21845_10008422 3300002077 Bacteria 2123
7 rootH1_10189289 3300003323 Bacteria 1791
8 JGI25407J50210_10002889 3300003373 Unclassified 4088
9 JGI25407J50210_10007088 3300003373 Bacteria 2805
10 Ga0058860_10090352 3300004801 Bacteria 3595
11 Ga0058862_12833186 3300004803 Bacteria 1068
12 Ga0065715_10129945 3300005293 Bacteria 2035
13 Ga0070676_10067408 3300005328 Bacteria 2140
14 Ga0070683_100028747 3300005329 Bacteria 5027
15 Ga0070690_100009438 3300005330 Bacteria 5651
16 Ga0070690_100034339 3300005330 Bacteria 3178
17 Ga0070670_100054751 3300005331 Bacteria 3425
18 Ga0068869_100048843 3300005334 Bacteria 3062
19 Ga0070666_10093879 3300005335 Bacteria 2063
20 Ga0070680_100017430 3300005336 Bacteria 5664
21 Ga0070680_100037285 3300005336 Bacteria 3928
22 Ga0070680_100168004 3300005336 Bacteria 1845
23 Ga0070682_100090107 3300005337 Bacteria 2005
24 Ga0070682_100114190 3300005337 Bacteria 1805
25 Ga0068868_100035709 3300005338 Bacteria 3844
26 Ga0068868_100117481 3300005338 Bacteria 2167
27 Ga0070660_100008648 3300005339 Bacteria 7130
28 Ga0070689_100002337 3300005340 Bacteria 12351
29 Ga0070687_100002588 3300005343 Bacteria 6825
30 Ga0070687_100087283 3300005343 Bacteria 1717
31 Ga0070661_100000183 3300005344 Bacteria 51585
32 Ga0070661_100319921 3300005344 Bacteria 1212
33 Ga0070692_10002778 3300005345 Bacteria 6895
34 Ga0070692_10006547 3300005345 Bacteria 5067
35 Ga0070692_10038652 3300005345 Bacteria 2433
36 Ga0070669_100345192 3300005353 Bacteria 1207
37 Ga0070675_100003746 3300005354 Bacteria 11548
38 Ga0070675_100116303 3300005354 Bacteria 2268
39 Ga0070671_100244740 3300005355 Bacteria 1523
40 Ga0070674_100001865 3300005356 Bacteria 11435
41 Ga0070673_100002635 3300005364 Bacteria 10979
42 Ga0070673_100102792 3300005364 Bacteria 2357
43 Ga0070688_100001562 3300005365 Bacteria 11432
44 Ga0070659_100000691 3300005366 Bacteria 24551
45 Ga0070659_100315193 3300005366 Bacteria 1306
46 Ga0070703_10000819 3300005406 Bacteria 10131
47 Ga0070703_10059513 3300005406 Bacteria 1246
48 Ga0070710_10183469 3300005437 Bacteria 1312
49 Ga0070701_10004382 3300005438 Bacteria 5709
50 Ga0070701_10025470 3300005438 Bacteria 2873
51 Ga0070701_10182166 3300005438 Bacteria 1230
52 Ga0070705_100006517 3300005440 Bacteria 5728
53 Ga0070705_100007009 3300005440 Bacteria 5542
54 Ga0070705_100058807 3300005440 Bacteria 2273
55 Ga0070700_100007658 3300005441 Bacteria 5844
56 Ga0070694_100015076 3300005444 Bacteria 4845
57 Ga0070694_100016329 3300005444 Bacteria 4674
58 Ga0070694_100109947 3300005444 Bacteria 1962
59 Ga0070694_100121640 3300005444 Bacteria 1874
60 Ga0070708_100003895 3300005445 Bacteria 11713
61 Ga0070708_100004849 3300005445 Bacteria 10618
62 Ga0070708_100007508 3300005445 Bacteria 8731
63 Ga0070708_100020103 3300005445 Bacteria 5624
64 Ga0070708_100035768 3300005445 Bacteria 4328
65 Ga0070708_100108446 3300005445 Bacteria 2550
66 Ga0070708_100142131 3300005445 Bacteria 2226
67 Ga0070708_100184172 3300005445 Bacteria 1952
68 Ga0070663_100019404 3300005455 Bacteria 4480
69 Ga0070678_100075932 3300005456 Bacteria 2530
70 Ga0070662_100064803 3300005457 Bacteria 2677
71 Ga0070681_10007702 3300005458 Bacteria 10531
72 Ga0068867_100008182 3300005459 Bacteria 7387
73 Ga0070685_10000992 3300005466 Bacteria 15250
74 Ga0070685_10001311 3300005466 Bacteria 13081
75 Ga0070706_100010463 3300005467 Bacteria 8610
76 Ga0070706_100024390 3300005467 Bacteria 5568
77 Ga0070706_100031957 3300005467 Bacteria 4854
78 Ga0070706_100040384 3300005467 Bacteria 4307
79 Ga0070706_100085210 3300005467 Bacteria 2928
80 Ga0070706_100098512 3300005467 Bacteria 2716
81 Ga0070706_100327153 3300005467 Bacteria 1429
82 Ga0070707_100002140 3300005468 Bacteria 18919
83 Ga0070707_100015952 3300005468 Bacteria 7052
84 Ga0070698_100000152 3300005471 Bacteria 62827
85 Ga0070698_100019118 3300005471 Bacteria 7201
86 Ga0070698_100045964 3300005471 Bacteria 4466
87 Ga0070698_100078260 3300005471 Bacteria 3305
88 Ga0070698_100114665 3300005471 Bacteria 2659
89 Ga0070698_100156251 3300005471 Bacteria 2226
90 Ga0070698_100205315 3300005471 Bacteria 1905
91 Ga0070698_100276982 3300005471 Bacteria 1609
92 Ga0070698_100316399 3300005471 Bacteria 1491
93 Ga0070699_100001770 3300005518 Bacteria 19675
94 Ga0070699_100019264 3300005518 Bacteria 5873
95 Ga0070699_100024038 3300005518 Bacteria 5251
96 Ga0070699_100111927 3300005518 Bacteria 2397
97 Ga0070699_100186009 3300005518 Bacteria 1844
98 Ga0070699_100394459 3300005518 Bacteria 1251
99 Ga0070684_100107846 3300005535 Bacteria 2495
100 Ga0070697_100018320 3300005536 Bacteria 5520
101 Ga0070697_100033070 3300005536 Bacteria 4164
102 Ga0070697_100097429 3300005536 Bacteria 2440
103 Ga0070697_100128497 3300005536 Bacteria 2123
104 Ga0070697_100250802 3300005536 Bacteria 1513
105 Ga0068853_100000748 3300005539 Bacteria 22540
106 Ga0068853_100087307 3300005539 Bacteria 2737
107 Ga0070672_100013751 3300005543 Bacteria 5722
108 Ga0070672_100322380 3300005543 Bacteria 1314
109 Ga0070686_100038222 3300005544 Bacteria 2982
110 Ga0070686_100264316 3300005544 Bacteria 1262
111 Ga0070695_100001612 3300005545 Bacteria 12638
112 Ga0070695_100020617 3300005545 Bacteria 4025
113 Ga0070695_100038640 3300005545 Bacteria 3013
114 Ga0070695_100277322 3300005545 Bacteria 1230
115 Ga0070696_100004898 3300005546 Bacteria 8942
116 Ga0070696_100005588 3300005546 Bacteria 8393
117 Ga0070696_100011349 3300005546 Bacteria 5965
118 Ga0070696_100020831 3300005546 Bacteria 4443
119 Ga0070696_100107616 3300005546 Bacteria 2005
120 Ga0070696_100151133 3300005546 Bacteria 1704
121 Ga0070696_100325473 3300005546 Bacteria 1184
122 Ga0070693_100008229 3300005547 Bacteria 5129
123 Ga0070693_100053786 3300005547 Bacteria 2313
124 Ga0070704_100010827 3300005549 Bacteria 5562
125 Ga0070704_100022656 3300005549 Bacteria 4090
126 Ga0070704_100115449 3300005549 Bacteria 2051
127 Ga0070704_100253330 3300005549 Bacteria 1447
128 Ga0070704_100272405 3300005549 Bacteria 1399
129 Ga0070704_100356892 3300005549 Bacteria 1236
130 Ga0068855_100368676 3300005563 Bacteria 1579
131 Ga0068855_100503278 3300005563 Bacteria 1316
132 Ga0070664_100018377 3300005564 Bacteria 5741
133 Ga0068854_100000629 3300005578 Bacteria 20872
134 Ga0068854_100326523 3300005578 Bacteria 1249
135 Ga0068856_100035100 3300005614 Bacteria 4914
136 Ga0068856_100126414 3300005614 Bacteria 2560
137 Ga0068856_100163668 3300005614 Bacteria 2236
138 Ga0068856_100244931 3300005614 Bacteria 1808
139 Ga0068856_100287236 3300005614 Bacteria 1662
140 Ga0070702_100004127 3300005615 Bacteria 6598
141 Ga0070702_100010062 3300005615 Bacteria 4647
142 Ga0070702_100276441 3300005615 Bacteria 1151
143 Ga0068852_100000230 3300005616 Bacteria 37770
144 Ga0068852_100002859 3300005616 Bacteria 11969
145 Ga0068852_100220396 3300005616 Bacteria 1804
146 Ga0068859_100004475 3300005617 Bacteria 14259
147 Ga0068864_100195688 3300005618 Bacteria 1855
148 Ga0068866_10032383 3300005718 Bacteria 2527
149 Ga0068866_10069919 3300005718 Bacteria 1851
150 Ga0068861_100025333 3300005719 Bacteria 4301
151 Ga0068851_10000425 3300005834 Bacteria 18866
152 Ga0068870_10001275 3300005840 Bacteria 10118
153 Ga0068858_100092031 3300005842 Bacteria 2822
154 Ga0068860_100010726 3300005843 Bacteria 9048
155 Ga0068862_100113359 3300005844 Bacteria 2382
156 Ga0081455_10048240 3300005937 Bacteria 3682
157 Ga0081455_10060059 3300005937 Bacteria 3207
158 Ga0081538_10000144 3300005981 Bacteria 73787
159 Ga0081538_10000529 3300005981 Bacteria 42265
160 Ga0081538_10003083 3300005981 Bacteria 15854
161 Ga0081538_10009328 3300005981 Bacteria 8207
162 Ga0081538_10098127 3300005981 Bacteria 1486
163 Ga0081539_10003268 3300005985 Bacteria 20345
164 Ga0075365_10035150 3300006038 Bacteria 3240
165 Ga0075364_10018893 3300006051 Bacteria 4322
166 Ga0075432_10005796 3300006058 Bacteria 4202
167 Ga0070712_100019748 3300006175 Bacteria 4400
168 Ga0070712_100085037 3300006175 Bacteria 2302
169 Ga0070712_100377951 3300006175 Bacteria 1165
170 Ga0075362_10020713 3300006177 Bacteria 2751
171 Ga0097621_100096452 3300006237 Bacteria 2482
172 Ga0097621_100172322 3300006237 Bacteria 1866
173 Ga0068871_100094296 3300006358 Bacteria 2498
174 Ga0075428_100064854 3300006844 Bacteria 4000
175 Ga0075430_100043830 3300006846 Bacteria 3783
176 Ga0075430_100070163 3300006846 Bacteria 2939
177 Ga0075431_100042966 3300006847 Bacteria 4663
178 Ga0075431_100055702 3300006847 Bacteria 4079
179 Ga0075431_100224250 3300006847 Bacteria 1917
180 Ga0075433_10005537 3300006852 Bacteria 9914
181 Ga0075433_10037494 3300006852 Bacteria 4182
182 Ga0075433_10118047 3300006852 Bacteria 2354
183 Ga0075434_100109083 3300006871 Bacteria 2778
184 Ga0075434_100638859 3300006871 Bacteria 1083
185 Ga0075429_100071252 3300006880 Bacteria 3026
186 Ga0075429_100147109 3300006880 Bacteria 2062
187 Ga0068865_100001880 3300006881 Bacteria 12347
188 Ga0068865_100184017 3300006881 Bacteria 1611
189 Ga0075436_100004210 3300006914 Bacteria 9870
190 Ga0075436_100056590 3300006914 Bacteria 2708
191 Ga0097620_100004475 3300006931 Bacteria 14259
192 Ga0075435_100002950 3300007076 Bacteria 11440
193 Ga0105240_10284881 3300009093 Bacteria 1897
194 Ga0111539_10028704 3300009094 Bacteria 6785
195 Ga0111539_10038612 3300009094 Bacteria 5760
196 Ga0111539_10065510 3300009094 Bacteria 4292
197 Ga0111539_10074656 3300009094 Bacteria 3995
198 Ga0105245_10005337 3300009098 Bacteria 11291
199 Ga0105245_10013250 3300009098 Bacteria 7185
200 Ga0105245_10143936 3300009098 Bacteria 2248
201 Ga0114129_10006178 3300009147 Bacteria 16996
202 Ga0114129_10007477 3300009147 Bacteria 15557
203 Ga0114129_10013711 3300009147 Bacteria 11550
204 Ga0114129_10022613 3300009147 Bacteria 8917
205 Ga0114129_10029987 3300009147 Bacteria 7702
206 Ga0114129_10063386 3300009147 Bacteria 5161
207 Ga0114129_10088178 3300009147 Bacteria 4302
208 Ga0114129_10165206 3300009147 Bacteria 3021
209 Ga0105243_10012711 3300009148 Bacteria 6359
210 Ga0105243_10015394 3300009148 Bacteria 5783
211 Ga0105243_10066446 3300009148 Bacteria 2900
212 Ga0105243_10210668 3300009148 Bacteria 1711
213 Ga0105241_10007460 3300009174 Bacteria 8049
214 Ga0105241_10453768 3300009174 Bacteria 1134
215 Ga0105242_10049018 3300009176 Bacteria 3435
216 Ga0105242_10079326 3300009176 Bacteria 2742
217 Ga0105242_10166568 3300009176 Bacteria 1934
218 Ga0105248_10120347 3300009177 Bacteria 2962
219 Ga0105248_10171790 3300009177 Bacteria 2443
220 Ga0105237_10177723 3300009545 Bacteria 2129
221 Ga0105238_10005635 3300009551 Bacteria 12375
222 Ga0105238_10026765 3300009551 Bacteria 5879
223 Ga0105249_10009910 3300009553 Bacteria 8352
224 Ga0105249_10014979 3300009553 Bacteria 6858
225 Ga0099796_10020067 3300010159 Bacteria 2037
226 Ga0105239_10001587 3300010375 Bacteria 30014
227 Ga0105239_10124369 3300010375 Bacteria 2866
228 Ga0105239_10224191 3300010375 Bacteria 2108
229 Ga0105246_10224614 3300011119 Bacteria 1474
230 Ga0157374_10002122 3300013296 Bacteria 16690
231 Ga0157374_10096634 3300013296 Bacteria 2825
232 Ga0157378_10011627 3300013297 Bacteria 7706
233 Ga0157378_10275661 3300013297 Bacteria 1619
234 Ga0157372_10063412 3300013307 Bacteria 4143
235 Ga0157375_10005033 3300013308 Bacteria 11479
236 Ga0157375_10016035 3300013308 Bacteria 6721
237 Ga0157375_10465839 3300013308 Bacteria 1429
238 Ga0163163_10121234 3300014325 Bacteria 2649
239 Ga0163163_10402975 3300014325 Bacteria 1426
240 Ga0157380_10002688 3300014326 Bacteria 12062
241 Ga0157380_10003941 3300014326 Bacteria 10244
242 Ga0182008_10096057 3300014497 Bacteria 1463
243 Ga0157377_10003170 3300014745 Bacteria 7415
244 Ga0157379_10032676 3300014968 Bacteria 4640
245 Ga0157379_10115290 3300014968 Bacteria 2416
246 Ga0163161_10054178 3300017792 Bacteria 2911
247 Ga0207653_10000440 3300025885 Bacteria 17023
248 Ga0207653_10016040 3300025885 Bacteria 2352
249 Ga0207653_10020958 3300025885 Bacteria 2071
250 Ga0207642_10028789 3300025899 Bacteria 2292
251 Ga0207688_10002429 3300025901 Bacteria 10035
252 Ga0207688_10090335 3300025901 Bacteria 1758
253 Ga0207680_10111036 3300025903 Bacteria 1778
254 Ga0207643_10002406 3300025908 Bacteria 10126
255 Ga0207684_10026840 3300025910 Bacteria 4911
256 Ga0207684_10030057 3300025910 Bacteria 4625
257 Ga0207684_10038553 3300025910 Bacteria 4054
258 Ga0207684_10084131 3300025910 Bacteria 2709
259 Ga0207684_10099606 3300025910 Bacteria 2482
260 Ga0207684_10548088 3300025910 Bacteria 989
261 Ga0207654_10020286 3300025911 Bacteria 3521
262 Ga0207695_10435262 3300025913 Unclassified 1195
263 Ga0207671_10150449 3300025914 Bacteria 1798
264 Ga0207693_10011221 3300025915 Bacteria 7253
265 Ga0207693_10024958 3300025915 Bacteria 4741
266 Ga0207693_10032793 3300025915 Bacteria 4099
267 Ga0207663_10029210 3300025916 Bacteria 3236
268 Ga0207660_10009020 3300025917 Bacteria 6456
269 Ga0207660_10323283 3300025917 Bacteria 1232
270 Ga0207660_10374563 3300025917 Bacteria 1144
271 Ga0207662_10004983 3300025918 Bacteria 7029
272 Ga0207662_10100699 3300025918 Bacteria 1790
273 Ga0207657_10021736 3300025919 Bacteria 6030
274 Ga0207649_10006864 3300025920 Bacteria 6184
275 Ga0207649_10117860 3300025920 Bacteria 1785
276 Ga0207652_10109618 3300025921 Bacteria 2448
277 Ga0207646_10000891 3300025922 Bacteria 38486
278 Ga0207646_10000981 3300025922 Bacteria 36664
279 Ga0207646_10001817 3300025922 Bacteria 25795
280 Ga0207646_10032625 3300025922 Bacteria 4712
281 Ga0207646_10033913 3300025922 Bacteria 4613
282 Ga0207659_10155127 3300025926 Bacteria 1792
283 Ga0207687_10005797 3300025927 Bacteria 8174
284 Ga0207687_10163362 3300025927 Bacteria 1711
285 Ga0207687_10228377 3300025927 Bacteria 1469
286 Ga0207700_10400696 3300025928 Bacteria 1202
287 Ga0207690_10016157 3300025932 Bacteria 4538
288 Ga0207706_10002884 3300025933 Bacteria 16651
289 Ga0207686_10024654 3300025934 Bacteria 3488
290 Ga0207686_10066207 3300025934 Bacteria 2307
291 Ga0207709_10005429 3300025935 Bacteria 7243
292 Ga0207709_10023996 3300025935 Bacteria 3478
293 Ga0207709_10055353 3300025935 Bacteria 2450
294 Ga0207669_10030461 3300025937 Bacteria 2998
295 Ga0207704_10030468 3300025938 Bacteria 3025
296 Ga0207704_10148120 3300025938 Bacteria 1652
297 Ga0207691_10013713 3300025940 Bacteria 7743
298 Ga0207691_10254946 3300025940 Bacteria 1513
299 Ga0207711_10115580 3300025941 Bacteria 2391
300 Ga0207711_10208041 3300025941 Bacteria 1787
301 Ga0207689_10156351 3300025942 Bacteria 1879
302 Ga0207679_10015544 3300025945 Bacteria 5033
303 Ga0207667_10316163 3300025949 Bacteria 1595
304 Ga0207667_10433953 3300025949 Bacteria 1336
305 Ga0207651_10045519 3300025960 Bacteria 2944
306 Ga0207651_10077424 3300025960 Bacteria 2381
307 Ga0207651_10082612 3300025960 Bacteria 2320
308 Ga0207712_10002564 3300025961 Bacteria 11677
309 Ga0207712_10009244 3300025961 Bacteria 6240
310 Ga0207640_10022099 3300025981 Bacteria 3802
311 Ga0207640_10375660 3300025981 Bacteria 1150
312 Ga0207677_10132738 3300026023 Bacteria 1894
313 Ga0207677_10134155 3300026023 Bacteria 1885
314 Ga0207703_10303826 3300026035 Bacteria 1456
315 Ga0207639_10009095 3300026041 Bacteria 6845
316 Ga0207678_10102745 3300026067 Bacteria 2440
317 Ga0207708_10000994 3300026075 Bacteria 21202
318 Ga0207708_10164522 3300026075 Bacteria 1753
319 Ga0207702_10044700 3300026078 Bacteria 3723
320 Ga0207702_10129625 3300026078 Bacteria 2268
321 Ga0207641_10093255 3300026088 Bacteria 2639
322 Ga0207641_10618607 3300026088 Bacteria 1062
323 Ga0207648_10002386 3300026089 Bacteria 20220
324 Ga0207648_10002488 3300026089 Bacteria 19783
325 Ga0207674_10005794 3300026116 Bacteria 14657
326 Ga0207674_10620690 3300026116 Bacteria 1044
327 Ga0207675_100013036 3300026118 Bacteria 7761
328 Ga0207683_10001856 3300026121 Bacteria 18682
329 Ga0207698_10009870 3300026142 Bacteria 6104
330 Ga0207698_10048836 3300026142 Bacteria 3216
331 Ga0207428_10021729 3300027907 Bacteria 5428
332 Ga0207428_10033767 3300027907 Bacteria 4197
333 Ga0268265_10060719 3300028380 Bacteria 2898
334 Ga0265318_10048102 3300028577 Unclassified 1607
335 Ga0265340_10008701 3300031247 Bacteria 5476
336 Ga0265316_10030909 3300031344 Bacteria 4384
337 Ga0307408_100117410 3300031548 Bacteria 2055
338 Ga0307409_100014543 3300031995 Bacteria 5126
339 Ga0307416_100004734 3300032002 Bacteria 8254
340 Ga0307416_100036482 3300032002 Bacteria 3771
341 Ga0307416_100772800 3300032002 Bacteria 1055
342 Ga0307411_10174639 3300032005 Bacteria 1624
343 Ga0307415_100045502 3300032126 Bacteria 2943
344 Ga0307415_100143205 3300032126 Bacteria 1829
345 Ga0307415_100228345 3300032126 Bacteria 1497
346 Ga0373960_0044646 3300035121 Bacteria 1295
347 Ga0373943_0105968 3300035170 Bacteria 1477
348 Ga0373962_0020930 3300035242 Bacteria 1722
349 Ga0373931_0034616 3300035691 Bacteria 2622
350 Ga0373935_0177244 3300035692 Bacteria 1462
351 Ga0373947_0284597 3300035725 Bacteria 1099
352 Ga0373925_0097076 3300037068 Bacteria 2260
353 Ga0395899_0004617 3300037312 Bacteria 10734
354 Ga0395899_0009015 3300037312 Bacteria 7667
355 Ga0395899_0010775 3300037312 Bacteria 7007
356 Ga0395899_0033584 3300037312 Bacteria 3852
357 Ga0395899_0195740 3300037312 Bacteria 1412
358 Ga0395899_0224078 3300037312 Bacteria 1301
359 Ga0395900_0002780 3300037418 Bacteria 19127
360 Ga0395900_0005725 3300037418 Bacteria 12989
361 Ga0395900_0014246 3300037418 Bacteria 8115
362 Ga0395900_0022189 3300037418 Bacteria 6494
363 Ga0395900_0025779 3300037418 Bacteria 6017
364 Ga0395900_0025987 3300037418 Bacteria 5996
365 Ga0395900_0039547 3300037418 Bacteria 4859
366 Ga0395900_0109303 3300037418 Bacteria 2840
367 Ga0395900_0148343 3300037418 Bacteria 2397
368 Ga0395900_0155409 3300037418 Bacteria 2336
369 Ga0395900_0304593 3300037418 Bacteria 1578
370 Ga0395900_0424778 3300037418 Bacteria 1289
371 Ga0395898_0001403 3300037466 Bacteria 34348
372 Ga0395898_0002309 3300037466 Bacteria 22851
373 Ga0395898_0003072 3300037466 Bacteria 18922
374 Ga0395898_0003108 3300037466 Bacteria 18761
375 Ga0395898_0007530 3300037466 Bacteria 11569
376 Ga0395898_0009477 3300037466 Bacteria 10228
377 Ga0395898_0011120 3300037466 Bacteria 9370
378 Ga0395898_0012494 3300037466 Bacteria 8780
379 Ga0395898_0015017 3300037466 Bacteria 7949
380 Ga0395898_0026606 3300037466 Bacteria 5818
381 Ga0395898_0055419 3300037466 Bacteria 3866
382 Ga0395898_0375492 3300037466 Bacteria 1356
383 Ga0395905_0001294 3300037471 Bacteria 30743
384 Ga0395905_0003029 3300037471 Bacteria 18205
385 Ga0395905_0003546 3300037471 Bacteria 16632
386 Ga0395905_0006111 3300037471 Bacteria 12167
387 Ga0395905_0013722 3300037471 Bacteria 7756
388 Ga0395905_0019950 3300037471 Bacteria 6352
389 Ga0395905_0039054 3300037471 Bacteria 4453
390 Ga0395905_0071041 3300037471 Bacteria 3263
391 Ga0395905_0078244 3300037471 Bacteria 3099
392 Ga0395905_0082191 3300037471 Bacteria 3019
393 Ga0395905_0183134 3300037471 Bacteria 1966
394 Ga0395901_0001604 3300038443 Bacteria 23434
395 Ga0395901_0002634 3300038443 Bacteria 18147
396 Ga0395901_0005627 3300038443 Bacteria 12679
397 Ga0395901_0015746 3300038443 Bacteria 7704
398 Ga0395901_0026485 3300038443 Bacteria 5953
399 Ga0395901_0030829 3300038443 Bacteria 5526
400 Ga0395901_0033549 3300038443 Bacteria 5299
401 Ga0395901_0069833 3300038443 Bacteria 3659
402 Ga0395901_0150226 3300038443 Bacteria 2448
403 Ga0395901_0160711 3300038443 Bacteria 2359
404 Ga0395901_0162716 3300038443 Bacteria 2343
405 Ga0395901_0195309 3300038443 Bacteria 2122
406 Ga0395901_0241155 3300038443 Bacteria 1885
407 Ga0242420_024031 3300038996 Bacteria 1103
408 Ga0450910_002654 3300042147 Bacteria 2351
409 Ga0466964_0028551 3300044706 Bacteria 2199
410 Ga0466957_0162769 3300044842 Bacteria 1450
411 Ga0466967_0024334 3300045976 Bacteria 4977
412 Ga0466967_0131666 3300045976 Bacteria 2322
413 Ga0495592_0011491 3300046454 Bacteria 6701
414 Ga0495603_0047106 3300046455 Bacteria 2568
415 Ga0495629_0305699 3300046459 Bacteria 1089
416 Ga0495641_0085736 3300046461 Bacteria 1410
417 Ga0495653_0003300 3300046463 Bacteria 12943
418 Ga0495580_0051142 3300046472 Bacteria 2921
419 Ga0495582_0051161 3300046473 Bacteria 2277
420 Ga0495582_0066545 3300046473 Bacteria 1991
421 Ga0495605_0027708 3300046474 Bacteria 2933
422 Ga0495605_0036151 3300046474 Bacteria 2492
423 Ga0495662_0001625 3300046476 Bacteria 11173
424 Ga0495664_0004491 3300046477 Bacteria 7634
425 Ga0495584_0046833 3300046491 Bacteria 2181
426 Ga0495584_0079438 3300046491 Bacteria 1650
427 Ga0495594_0041955 3300046499 Bacteria 2505
428 Ga0495608_0001414 3300046511 Bacteria 17061
429 Ga0495628_0004306 3300046516 Bacteria 12644
430 Ga0495630_0123776 3300046517 Bacteria 1962
431 Ga0495666_0013207 3300046526 Bacteria 4117
432 Ga0495642_0031934 3300046528 Bacteria 2111
433 Ga0495642_0054857 3300046528 Bacteria 1644
434 Ga0495652_0008434 3300046529 Bacteria 9405
435 Ga0495665_0001018 3300046531 Bacteria 14833
436 Ga0495640_0003990 3300046533 Bacteria 11808
437 Ga0495586_0005303 3300046535 Bacteria 6899
438 Ga0495587_0003757 3300046536 Bacteria 10071
439 Ga0495598_0034450 3300046537 Bacteria 1444
440 Ga0495645_0065487 3300046543 Bacteria 2628
441 Ga0495667_0024499 3300046559 Bacteria 4063
442 Ga0495656_0013491 3300046615 Bacteria 3043
443 Ga0495656_0031673 3300046615 Bacteria 2147
444 Ga0495634_0019996 3300046642 Bacteria 4750
445 Ga0495635_0023672 3300046663 Bacteria 4277
446 Ga0495659_0073865 3300046664 Bacteria 1282
447 Ga0495661_0189001 3300046665 Bacteria 1086
448 Ga0495657_0009934 3300046675 Bacteria 7181
449 Ga0495599_0025835 3300046678 Bacteria 3678
450 Ga0495623_0038698 3300046679 Bacteria 3049
451 Ga0495646_0013347 3300046680 Bacteria 5220
452 Ga0495647_0030965 3300046681 Bacteria 1988
453 Ga0495647_0056567 3300046681 Bacteria 1538
454 Ga0495669_0100682 3300046684 Bacteria 1342
455 Ga0495613_0097009 3300046689 Bacteria 2131
456 Ga0495624_0130357 3300046690 Bacteria 1542
457 Ga0495624_0220296 3300046690 Bacteria 1151
458 Ga0495671_0062573 3300046692 Bacteria 1834
459 Ga0495589_0048679 3300046794 Bacteria 2098
460 Ga0495589_0102667 3300046794 Bacteria 1383
461 Ga0495600_0096380 3300046809 Bacteria 1928
462 Ga0495581_0004737 3300047315 Bacteria 7853
463 Ga0495604_0007720 3300047317 Bacteria 8521
464 Ga0495674_0007085 3300047319 Bacteria 10729
465 Ga0495676_0013312 3300047321 Bacteria 7394
466 Ga0495675_0020928 3300047444 Bacteria 4163
467 Ga0495684_0028619 3300047471 Bacteria 4277
468 Ga0495602_0020357 3300048088 Bacteria 6557
469 Ga0496100_0114248 3300048903 Bacteria 1880
470 Ga0496100_0333344 3300048903 Bacteria 1142
471 Ga0496101_0025955 3300048904 Bacteria 4070
472 Ga0496101_0302176 3300048904 Bacteria 1254
473 Ga0496102_0018237 3300048905 Bacteria 6163
474 Ga0496102_0046385 3300048905 Bacteria 3947
475 Ga0496102_0096298 3300048905 Bacteria 2744
476 Ga0496102_0140369 3300048905 Bacteria 2265
477 Ga0496102_0318255 3300048905 Bacteria 1466
478 Ga0496102_0344676 3300048905 Bacteria 1403
479 Ga0496102_0603721 3300048905 Bacteria 1020
480 Ga0496103_0015516 3300048906 Bacteria 4535
481 Ga0496103_0025548 3300048906 Bacteria 3570
482 Ga0496104_0070013 3300048907 Bacteria 3334
483 Ga0496104_0081931 3300048907 Bacteria 3077
484 Ga0496104_0206437 3300048907 Bacteria 1876
485 Ga0496105_0070470 3300048908 Bacteria 2890
486 Ga0496105_0079348 3300048908 Bacteria 2711
487 Ga0496105_0099266 3300048908 Bacteria 2404
488 Ga0496105_0118598 3300048908 Bacteria 2183
489 Ga0496106_0008046 3300048909 Bacteria 7788
490 Ga0496106_0071259 3300048909 Bacteria 2656
491 Ga0496106_0089431 3300048909 Bacteria 2375
492 Ga0496106_0275661 3300048909 Bacteria 1347
493 Ga0496106_0290248 3300048909 Bacteria 1311
494 Ga0496107_0017376 3300048910 Bacteria 5060
495 Ga0496107_0028138 3300048910 Bacteria 3994
496 Ga0496107_0049636 3300048910 Bacteria 3024
497 Ga0496107_0169675 3300048910 Bacteria 1619
498 Ga0496107_0411278 3300048910 Bacteria 1006
499 Ga0496108_0003345 3300048911 Bacteria 12882
500 Ga0496108_0010656 3300048911 Bacteria 7457
501 Ga0496108_0140430 3300048911 Bacteria 2081
502 Ga0496109_0004246 3300048912 Bacteria 11964
503 Ga0496109_0005258 3300048912 Bacteria 10809
504 Ga0496109_0127924 3300048912 Bacteria 2369
505 Ga0496109_0179828 3300048912 Bacteria 1986
506 Ga0496109_0320969 3300048912 Bacteria 1461
507 Ga0496109_0362912 3300048912 Bacteria 1368
508 Ga0496110_0008369 3300048913 Bacteria 8322
509 Ga0496110_0077615 3300048913 Bacteria 2955
510 Ga0496110_0217393 3300048913 Bacteria 1738
511 Ga0496110_0469141 3300048913 Bacteria 1147
512 Ga0496111_0000239 3300048914 Bacteria 26296
513 Ga0496111_0033805 3300048914 Bacteria 3648
514 Ga0496111_0086595 3300048914 Bacteria 2292
515 Ga0496111_0139087 3300048914 Bacteria 1799
516 Ga0496112_0008801 3300048915 Bacteria 9059
517 Ga0496112_0024466 3300048915 Bacteria 5782
518 Ga0496112_0089034 3300048915 Bacteria 3054
519 Ga0496112_0246512 3300048915 Bacteria 1738
520 Ga0496112_0438087 3300048915 Bacteria 1245
521 Ga0496113_0027884 3300048916 Bacteria 4054
522 Ga0496113_0048420 3300048916 Bacteria 3162
523 Ga0496113_0113669 3300048916 Bacteria 2110
524 Ga0496113_0138164 3300048916 Bacteria 1916
525 Ga0496113_0147775 3300048916 Bacteria 1853
526 Ga0496114_0031205 3300048917 Bacteria 4384
527 Ga0496114_0075359 3300048917 Bacteria 2842
528 Ga0496114_0108301 3300048917 Bacteria 2378
529 Ga0496115_0109927 3300048918 Bacteria 2264
530 Ga0501031_0004850 3300049568 Bacteria 8743
531 Ga0501031_0007549 3300049568 Bacteria 7083
532 Ga0501032_0031207 3300049569 Bacteria 3654
533 Ga0501036_0010851 3300049572 Bacteria 7527
534 Ga0501036_0203391 3300049572 Bacteria 1665
535 Ga0501037_0041054 3300049573 Bacteria 3403
536 Ga0501038_0011136 3300049574 Bacteria 8213
537 Ga0501040_0155353 3300049576 Bacteria 1615
538 Ga0501040_0156912 3300049576 Bacteria 1607
539 Ga0501041_0010230 3300049577 Bacteria 5528
540 Ga0501041_0078887 3300049577 Bacteria 2027
541 Ga0501041_0269619 3300049577 Bacteria 1071
542 Ga0501042_0002606 3300049578 Bacteria 11090
543 Ga0501042_0004953 3300049578 Bacteria 8526
544 Ga0501043_0017058 3300049579 Bacteria 5693
545 Ga0501046_0001782 3300049580 Bacteria 20562
546 Ga0501047_0298189 3300049581 Bacteria 1455
547 Ga0501048_0006532 3300049582 Bacteria 8864
548 Ga0501048_0007986 3300049582 Bacteria 8010
549 Ga0501067_0002815 3300049583 Bacteria 9566
550 Ga0501067_0006229 3300049583 Bacteria 6615
551 Ga0501067_0086612 3300049583 Bacteria 1738
552 Ga0501068_0005297 3300049584 Bacteria 7044
553 Ga0501069_0020922 3300049585 Bacteria 3547
554 Ga0501070_0001614 3300049586 Bacteria 20005
555 Ga0501070_0058787 3300049586 Bacteria 3187
556 Ga0501071_0012842 3300049587 Bacteria 5695
557 Ga0501071_0187497 3300049587 Bacteria 1550
558 Ga0501071_0262519 3300049587 Bacteria 1305
559 Ga0501072_0102800 3300049588 Bacteria 2271
560 Ga0501072_0164850 3300049588 Bacteria 1768
561 Ga0501072_0194468 3300049588 Bacteria 1617
562 Ga0501073_0045095 3300049589 Bacteria 3106
563 Ga0501074_0052716 3300049590 Bacteria 2935
564 Ga0501074_0147169 3300049590 Bacteria 1684
565 Ga0501075_0049157 3300049591 Bacteria 3170
566 Ga0501075_0144874 3300049591 Bacteria 1810
567 Ga0501076_0011905 3300049592 Bacteria 6495
568 Ga0501076_0045323 3300049592 Bacteria 3471
569 Ga0501076_0048825 3300049592 Bacteria 3345
570 Ga0501076_0130302 3300049592 Bacteria 2040
571 Ga0501077_0018821 3300049593 Bacteria 4370
572 Ga0501077_0118277 3300049593 Bacteria 1679
573 Ga0501077_0133550 3300049593 Bacteria 1574
574 Ga0501079_0008013 3300049741 Bacteria 8005
575 Ga0501079_0013120 3300049741 Bacteria 6317
576 Ga0501079_0194502 3300049741 Bacteria 1583
577 Ga0501079_0472757 3300049741 Bacteria 985
578 Ga0501080_0036101 3300049742 Bacteria 4614
579 Ga0501080_0053908 3300049742 Bacteria 3745
580 Ga0501080_0158635 3300049742 Bacteria 2090
581 Ga0501081_0128881 3300049743 Bacteria 1806
582 Ga0501081_0199663 3300049743 Bacteria 1450
583 Ga0501083_0005829 3300049744 Bacteria 8722
584 Ga0501035_0029823 3300049822 Bacteria 4975
585 Ga0501045_0002121 3300049824 Bacteria 13424
586 Ga0501045_0033084 3300049824 Bacteria 3748
587 Ga0501045_0109778 3300049824 Bacteria 2045
588 nmdc:mga03683_3289_c1 3300050489 Bacteria 2294
589 nmdc:mga00v17_24608_c1 3300050491 Bacteria 3494
590 nmdc:mga00v17_316525_c1 3300050491 Bacteria 1014
591 nmdc:mga0yw44_25001_c1 3300050492 Bacteria 3389
592 nmdc:mga0yw44_7370_c1 3300050492 Bacteria 5407
593 nmdc:mga05p37_147347_c1 3300050507 Bacteria 2881
594 nmdc:mga05p37_15393_c1 3300050507 Bacteria 9188
595 nmdc:mga05p37_414343_c1 3300050507 Bacteria 1570
596 nmdc:mga05p37_46247_c1 3300050507 Bacteria 5352
597 nmdc:mga05p37_551325_c1 3300050507 Bacteria 1312
598 nmdc:mga05p37_80750_c1 3300050507 Bacteria 4005
599 nmdc:mga05p37_89471_c1 3300050507 Bacteria 3794
600 nmdc:mga09592_21619_c1 3300050508 Bacteria 5304
601 nmdc:mga0qj67_98158_c1 3300050509 Bacteria 2360
602 nmdc:mga06r32_139110_c1 3300050510 Bacteria 2404
603 nmdc:mga06r32_17160_c1 3300050510 Bacteria 6608
604 nmdc:mga06r32_35042_c1 3300050510 Bacteria 4736
605 nmdc:mga06r32_72245_c1 3300050510 Bacteria 3340
606 nmdc:mga08y16_104378_c1 3300050511 Bacteria 2950
607 nmdc:mga08y16_234949_c1 3300050511 Bacteria 1896
608 nmdc:mga08y16_371003_c1 3300050511 Bacteria 1468
609 nmdc:mga0n895_514658_c1 3300050512 Bacteria 1205
610 nmdc:mga0rr50_16533_c1 3300050513 Bacteria 4905
611 nmdc:mga0rr50_213013_c1 3300050513 Bacteria 1592
612 nmdc:mga08x19_170195_c1 3300050514 Bacteria 1483
613 nmdc:mga08x19_27635_c1 3300050514 Bacteria 3549
614 nmdc:mga08x19_31724_c1 3300050514 Bacteria 3327
615 nmdc:mga0a205_16250_c1 3300050515 Bacteria 6969
616 nmdc:mga0a205_1945_c1 3300050515 Bacteria 17954
617 Ga0495601_0009054 3300053077 Bacteria 5879
618 Ga0495612_0030115 3300053078 Bacteria 2186
619 Ga0495619_0037348 3300053085 Bacteria 3164
620 Ga0495619_0108513 3300053085 Bacteria 1895
621 Ga0501084_0020653 3300054114 Bacteria 5493
622 Ga0501084_0407174 3300054114 Bacteria 1149
623 Ga0590071_027542 3300059421 Bacteria 1349
624 Ga0587077_002324 3300059493 Bacteria 2235
625 Ga0587091_016886 3300059511 Bacteria 1223
626 Ga0587079_011774 3300059647 Bacteria 1416
627 Ga0587079_018219 3300059647 Bacteria 1228
628 Ga0587071_017883 3300060344 Bacteria 1269
629 Ga0501082_0004533 3300060353 Bacteria 12126
630 Ga0501082_0283634 3300060353 Bacteria 1442
631 Ga0530510_0019413 3300061734 Bacteria 4824
632 Ga0530510_0044757 3300061734 Bacteria 3199
633 Ga0395900_0015468
634 JGI24752J21851_1004540
635 JGI24743J22301_10022324
636 JGI24743J22301_10030000
637 JGI24749J21850_1012987
638 JGI24744J21845_10008422
639 rootH1_10189289
640 JGI25407J50210_10002889
641 JGI25407J50210_10007088
642 Ga0058860_10090352
643 Ga0058862_12833186
644 Ga0065715_10129945
645 Ga0070676_10067408
646 Ga0070683_100028747
647 Ga0070690_100009438
648 Ga0070690_100034339
649 Ga0070670_100054751
650 Ga0068869_100048843
651 Ga0070666_10093879
652 Ga0070680_100017430
653 Ga0070680_100037285
654 Ga0070680_100168004
655 Ga0070682_100090107
656 Ga0070682_100114190
657 Ga0068868_100035709
658 Ga0068868_100117481
659 Ga0070660_100008648
660 Ga0070689_100002337
661 Ga0070687_100002588
662 Ga0070687_100087283
663 Ga0070661_100000183
664 Ga0070661_100319921
665 Ga0070692_10002778
666 Ga0070692_10006547
667 Ga0070692_10038652
668 Ga0070669_100345192
669 Ga0070675_100003746
670 Ga0070675_100116303
671 Ga0070671_100244740
672 Ga0070674_100001865
673 Ga0070673_100002635
674 Ga0070673_100102792
675 Ga0070688_100001562
676 Ga0070659_100000691
677 Ga0070659_100315193
678 Ga0070703_10000819
679 Ga0070703_10059513
680 Ga0070710_10183469
681 Ga0070701_10004382
682 Ga0070701_10025470
683 Ga0070701_10182166
684 Ga0070705_100006517
685 Ga0070705_100007009
686 Ga0070705_100058807
687 Ga0070700_100007658
688 Ga0070694_100015076
689 Ga0070694_100016329
690 Ga0070694_100109947
691 Ga0070694_100121640
692 Ga0070708_100003895
693 Ga0070708_100004849
694 Ga0070708_100007508
695 Ga0070708_100020103
696 Ga0070708_100035768
697 Ga0070708_100108446
698 Ga0070708_100142131
699 Ga0070708_100184172
700 Ga0070663_100019404
701 Ga0070678_100075932
702 Ga0070662_100064803
703 Ga0070681_10007702
704 Ga0068867_100008182
705 Ga0070685_10000992
706 Ga0070685_10001311
707 Ga0070706_100010463
708 Ga0070706_100024390
709 Ga0070706_100031957
710 Ga0070706_100040384
711 Ga0070706_100085210
712 Ga0070706_100098512
713 Ga0070706_100327153
714 Ga0070707_100002140
715 Ga0070707_100015952
716 Ga0070698_100000152
717 Ga0070698_100019118
718 Ga0070698_100045964
719 Ga0070698_100078260
720 Ga0070698_100114665
721 Ga0070698_100156251
722 Ga0070698_100205315
723 Ga0070698_100276982
724 Ga0070698_100316399
725 Ga0070699_100001770
726 Ga0070699_100019264
727 Ga0070699_100024038
728 Ga0070699_100111927
729 Ga0070699_100186009
730 Ga0070699_100394459
731 Ga0070684_100107846
732 Ga0070697_100018320
733 Ga0070697_100033070
734 Ga0070697_100097429
735 Ga0070697_100128497
736 Ga0070697_100250802
737 Ga0068853_100000748
738 Ga0068853_100087307
739 Ga0070672_100013751
740 Ga0070672_100322380
741 Ga0070686_100038222
742 Ga0070686_100264316
743 Ga0070695_100001612
744 Ga0070695_100020617
745 Ga0070695_100038640
746 Ga0070695_100277322
747 Ga0070696_100004898
748 Ga0070696_100005588
749 Ga0070696_100011349
750 Ga0070696_100020831
751 Ga0070696_100107616
752 Ga0070696_100151133
753 Ga0070696_100325473
754 Ga0070693_100008229
755 Ga0070693_100053786
756 Ga0070704_100010827
757 Ga0070704_100022656
758 Ga0070704_100115449
759 Ga0070704_100253330
760 Ga0070704_100272405
761 Ga0070704_100356892
762 Ga0068855_100368676
763 Ga0068855_100503278
764 Ga0070664_100018377
765 Ga0068854_100000629
766 Ga0068854_100326523
767 Ga0068856_100035100
768 Ga0068856_100126414
769 Ga0068856_100163668
770 Ga0068856_100244931
771 Ga0068856_100287236
772 Ga0070702_100004127
773 Ga0070702_100010062
774 Ga0070702_100276441
775 Ga0068852_100000230
776 Ga0068852_100002859
777 Ga0068852_100220396
778 Ga0068859_100004475
779 Ga0068864_100195688
780 Ga0068866_10032383
781 Ga0068866_10069919
782 Ga0068861_100025333
783 Ga0068851_10000425
784 Ga0068870_10001275
785 Ga0068858_100092031
786 Ga0068860_100010726
787 Ga0068862_100113359
788 Ga0081455_10048240
789 Ga0081455_10060059
790 Ga0081538_10000144
791 Ga0081538_10000529
792 Ga0081538_10003083
793 Ga0081538_10009328
794 Ga0081538_10098127
795 Ga0081539_10003268
796 Ga0075365_10035150
797 Ga0075364_10018893
798 Ga0075432_10005796
799 Ga0070712_100019748
800 Ga0070712_100085037
801 Ga0070712_100377951
802 Ga0075362_10020713
803 Ga0097621_100096452
804 Ga0097621_100172322
805 Ga0068871_100094296
806 Ga0075428_100064854
807 Ga0075430_100043830
808 Ga0075430_100070163
809 Ga0075431_100042966
810 Ga0075431_100055702
811 Ga0075431_100224250
812 Ga0075433_10005537
813 Ga0075433_10037494
814 Ga0075433_10118047
815 Ga0075434_100109083
816 Ga0075434_100638859
817 Ga0075429_100071252
818 Ga0075429_100147109
819 Ga0068865_100001880
820 Ga0068865_100184017
821 Ga0075436_100004210
822 Ga0075436_100056590
823 Ga0097620_100004475
824 Ga0075435_100002950
825 Ga0105240_10284881
826 Ga0111539_10028704
827 Ga0111539_10038612
828 Ga0111539_10065510
829 Ga0111539_10074656
830 Ga0105245_10005337
831 Ga0105245_10013250
832 Ga0105245_10143936
833 Ga0114129_10006178
834 Ga0114129_10007477
835 Ga0114129_10013711
836 Ga0114129_10022613
837 Ga0114129_10029987
838 Ga0114129_10063386
839 Ga0114129_10088178
840 Ga0114129_10165206
841 Ga0105243_10012711
842 Ga0105243_10015394
843 Ga0105243_10066446
844 Ga0105243_10210668
845 Ga0105241_10007460
846 Ga0105241_10453768
847 Ga0105242_10049018
848 Ga0105242_10079326
849 Ga0105242_10166568
850 Ga0105248_10120347
851 Ga0105248_10171790
852 Ga0105237_10177723
853 Ga0105238_10005635
854 Ga0105238_10026765
855 Ga0105249_10009910
856 Ga0105249_10014979
857 Ga0099796_10020067
858 Ga0105239_10001587
859 Ga0105239_10124369
860 Ga0105239_10224191
861 Ga0105246_10224614
862 Ga0157374_10002122
863 Ga0157374_10096634
864 Ga0157378_10011627
865 Ga0157378_10275661
866 Ga0157372_10063412
867 Ga0157375_10005033
868 Ga0157375_10016035
869 Ga0157375_10465839
870 Ga0163163_10121234
871 Ga0163163_10402975
872 Ga0157380_10002688
873 Ga0157380_10003941
874 Ga0182008_10096057
875 Ga0157377_10003170
876 Ga0157379_10032676
877 Ga0157379_10115290
878 Ga0163161_10054178
879 Ga0207653_10000440
880 Ga0207653_10016040
881 Ga0207653_10020958
882 Ga0207642_10028789
883 Ga0207688_10002429
884 Ga0207688_10090335
885 Ga0207680_10111036
886 Ga0207643_10002406
887 Ga0207684_10026840
888 Ga0207684_10030057
889 Ga0207684_10038553
890 Ga0207684_10084131
891 Ga0207684_10099606
892 Ga0207684_10548088
893 Ga0207654_10020286
894 Ga0207695_10435262
895 Ga0207671_10150449
896 Ga0207693_10011221
897 Ga0207693_10024958
898 Ga0207693_10032793
899 Ga0207663_10029210
900 Ga0207660_10009020
901 Ga0207660_10323283
902 Ga0207660_10374563
903 Ga0207662_10004983
904 Ga0207662_10100699
905 Ga0207657_10021736
906 Ga0207649_10006864
907 Ga0207649_10117860
908 Ga0207652_10109618
909 Ga0207646_10000891
910 Ga0207646_10000981
911 Ga0207646_10001817
912 Ga0207646_10032625
913 Ga0207646_10033913
914 Ga0207659_10155127
915 Ga0207687_10005797
916 Ga0207687_10163362
917 Ga0207687_10228377
918 Ga0207700_10400696
919 Ga0207690_10016157
920 Ga0207706_10002884
921 Ga0207686_10024654
922 Ga0207686_10066207
923 Ga0207709_10005429
924 Ga0207709_10023996
925 Ga0207709_10055353
926 Ga0207669_10030461
927 Ga0207704_10030468
928 Ga0207704_10148120
929 Ga0207691_10013713
930 Ga0207691_10254946
931 Ga0207711_10115580
932 Ga0207711_10208041
933 Ga0207689_10156351
934 Ga0207679_10015544
935 Ga0207667_10316163
936 Ga0207667_10433953
937 Ga0207651_10045519
938 Ga0207651_10077424
939 Ga0207651_10082612
940 Ga0207712_10002564
941 Ga0207712_10009244
942 Ga0207640_10022099
943 Ga0207640_10375660
944 Ga0207677_10132738
945 Ga0207677_10134155
946 Ga0207703_10303826
947 Ga0207639_10009095
948 Ga0207678_10102745
949 Ga0207708_10000994
950 Ga0207708_10164522
951 Ga0207702_10044700
952 Ga0207702_10129625
953 Ga0207641_10093255
954 Ga0207641_10618607
955 Ga0207648_10002386
956 Ga0207648_10002488
957 Ga0207674_10005794
958 Ga0207674_10620690
959 Ga0207675_100013036
960 Ga0207683_10001856
961 Ga0207698_10009870
962 Ga0207698_10048836
963 Ga0207428_10021729
964 Ga0207428_10033767
965 Ga0268265_10060719
966 Ga0265318_10048102
967 Ga0265340_10008701
968 Ga0265316_10030909
969 Ga0307408_100117410
970 Ga0307409_100014543
971 Ga0307416_100004734
972 Ga0307416_100036482
973 Ga0307416_100772800
974 Ga0307411_10174639
975 Ga0307415_100045502
976 Ga0307415_100143205
977 Ga0307415_100228345
978 Ga0373960_0044646
979 Ga0373943_0105968
980 Ga0373962_0020930
981 Ga0373931_0034616
982 Ga0373935_0177244
983 Ga0373947_0284597
984 Ga0373925_0097076
985 Ga0395899_0004617
986 Ga0395899_0009015
987 Ga0395899_0010775
988 Ga0395899_0033584
989 Ga0395899_0195740
990 Ga0395899_0224078
991 Ga0395900_0002780
992 Ga0395900_0005725
993 Ga0395900_0014246
994 Ga0395900_0022189
995 Ga0395900_0025779
996 Ga0395900_0025987
997 Ga0395900_0039547
998 Ga0395900_0109303
999 Ga0395900_0148343
1000 Ga0395900_0155409
1001 Ga0395900_0304593
1002 Ga0395900_0424778
1003 Ga0395898_0001403
1004 Ga0395898_0002309
1005 Ga0395898_0003072
1006 Ga0395898_0003108
1007 Ga0395898_0007530
1008 Ga0395898_0009477
1009 Ga0395898_0011120
1010 Ga0395898_0012494
1011 Ga0395898_0015017
1012 Ga0395898_0026606
1013 Ga0395898_0055419
1014 Ga0395898_0375492
1015 Ga0395905_0001294
1016 Ga0395905_0003029
1017 Ga0395905_0003546
1018 Ga0395905_0006111
1019 Ga0395905_0013722
1020 Ga0395905_0019950
1021 Ga0395905_0039054
1022 Ga0395905_0071041
1023 Ga0395905_0078244
1024 Ga0395905_0082191
1025 Ga0395905_0183134
1026 Ga0395901_0001604
1027 Ga0395901_0002634
1028 Ga0395901_0005627
1029 Ga0395901_0015746
1030 Ga0395901_0026485
1031 Ga0395901_0030829
1032 Ga0395901_0033549
1033 Ga0395901_0069833
1034 Ga0395901_0150226
1035 Ga0395901_0160711
1036 Ga0395901_0162716
1037 Ga0395901_0195309
1038 Ga0395901_0241155
1039 Ga0242420_024031
1040 Ga0450910_002654
1041 Ga0466964_0028551
1042 Ga0466957_0162769
1043 Ga0466967_0024334
1044 Ga0466967_0131666
1045 Ga0495592_0011491
1046 Ga0495603_0047106
1047 Ga0495629_0305699
1048 Ga0495641_0085736
1049 Ga0495653_0003300
1050 Ga0495580_0051142
1051 Ga0495582_0051161
1052 Ga0495582_0066545
1053 Ga0495605_0027708
1054 Ga0495605_0036151
1055 Ga0495662_0001625
1056 Ga0495664_0004491
1057 Ga0495584_0046833
1058 Ga0495584_0079438
1059 Ga0495594_0041955
1060 Ga0495608_0001414
1061 Ga0495628_0004306
1062 Ga0495630_0123776
1063 Ga0495666_0013207
1064 Ga0495642_0031934
1065 Ga0495642_0054857
1066 Ga0495652_0008434
1067 Ga0495665_0001018
1068 Ga0495640_0003990
1069 Ga0495586_0005303
1070 Ga0495587_0003757
1071 Ga0495598_0034450
1072 Ga0495645_0065487
1073 Ga0495667_0024499
1074 Ga0495656_0013491
1075 Ga0495656_0031673
1076 Ga0495634_0019996
1077 Ga0495635_0023672
1078 Ga0495659_0073865
1079 Ga0495661_0189001
1080 Ga0495657_0009934
1081 Ga0495599_0025835
1082 Ga0495623_0038698
1083 Ga0495646_0013347
1084 Ga0495647_0030965
1085 Ga0495647_0056567
1086 Ga0495669_0100682
1087 Ga0495613_0097009
1088 Ga0495624_0130357
1089 Ga0495624_0220296
1090 Ga0495671_0062573
1091 Ga0495589_0048679
1092 Ga0495589_0102667
1093 Ga0495600_0096380
1094 Ga0495581_0004737
1095 Ga0495604_0007720
1096 Ga0495674_0007085
1097 Ga0495676_0013312
1098 Ga0495675_0020928
1099 Ga0495684_0028619
1100 Ga0495602_0020357
1101 Ga0496100_0114248
1102 Ga0496100_0333344
1103 Ga0496101_0025955
1104 Ga0496101_0302176
1105 Ga0496102_0018237
1106 Ga0496102_0046385
1107 Ga0496102_0096298
1108 Ga0496102_0140369
1109 Ga0496102_0318255
1110 Ga0496102_0344676
1111 Ga0496102_0603721
1112 Ga0496103_0015516
1113 Ga0496103_0025548
1114 Ga0496104_0070013
1115 Ga0496104_0081931
1116 Ga0496104_0206437
1117 Ga0496105_0070470
1118 Ga0496105_0079348
1119 Ga0496105_0099266
1120 Ga0496105_0118598
1121 Ga0496106_0008046
1122 Ga0496106_0071259
1123 Ga0496106_0089431
1124 Ga0496106_0275661
1125 Ga0496106_0290248
1126 Ga0496107_0017376
1127 Ga0496107_0028138
1128 Ga0496107_0049636
1129 Ga0496107_0169675
1130 Ga0496107_0411278
1131 Ga0496108_0003345
1132 Ga0496108_0010656
1133 Ga0496108_0140430
1134 Ga0496109_0004246
1135 Ga0496109_0005258
1136 Ga0496109_0127924
1137 Ga0496109_0179828
1138 Ga0496109_0320969
1139 Ga0496109_0362912
1140 Ga0496110_0008369
1141 Ga0496110_0077615
1142 Ga0496110_0217393
1143 Ga0496110_0469141
1144 Ga0496111_0000239
1145 Ga0496111_0033805
1146 Ga0496111_0086595
1147 Ga0496111_0139087
1148 Ga0496112_0008801
1149 Ga0496112_0024466
1150 Ga0496112_0089034
1151 Ga0496112_0246512
1152 Ga0496112_0438087
1153 Ga0496113_0027884
1154 Ga0496113_0048420
1155 Ga0496113_0113669
1156 Ga0496113_0138164
1157 Ga0496113_0147775
1158 Ga0496114_0031205
1159 Ga0496114_0075359
1160 Ga0496114_0108301
1161 Ga0496115_0109927
1162 Ga0501031_0004850
1163 Ga0501031_0007549
1164 Ga0501032_0031207
1165 Ga0501036_0010851
1166 Ga0501036_0203391
1167 Ga0501037_0041054
1168 Ga0501038_0011136
1169 Ga0501040_0155353
1170 Ga0501040_0156912
1171 Ga0501041_0010230
1172 Ga0501041_0078887
1173 Ga0501041_0269619
1174 Ga0501042_0002606
1175 Ga0501042_0004953
1176 Ga0501043_0017058
1177 Ga0501046_0001782
1178 Ga0501047_0298189
1179 Ga0501048_0006532
1180 Ga0501048_0007986
1181 Ga0501067_0002815
1182 Ga0501067_0006229
1183 Ga0501067_0086612
1184 Ga0501068_0005297
1185 Ga0501069_0020922
1186 Ga0501070_0001614
1187 Ga0501070_0058787
1188 Ga0501071_0012842
1189 Ga0501071_0187497
1190 Ga0501071_0262519
1191 Ga0501072_0102800
1192 Ga0501072_0164850
1193 Ga0501072_0194468
1194 Ga0501073_0045095
1195 Ga0501074_0052716
1196 Ga0501074_0147169
1197 Ga0501075_0049157
1198 Ga0501075_0144874
1199 Ga0501076_0011905
1200 Ga0501076_0045323
1201 Ga0501076_0048825
1202 Ga0501076_0130302
1203 Ga0501077_0018821
1204 Ga0501077_0118277
1205 Ga0501077_0133550
1206 Ga0501079_0008013
1207 Ga0501079_0013120
1208 Ga0501079_0194502
1209 Ga0501079_0472757
1210 Ga0501080_0036101
1211 Ga0501080_0053908
1212 Ga0501080_0158635
1213 Ga0501081_0128881
1214 Ga0501081_0199663
1215 Ga0501083_0005829
1216 Ga0501035_0029823
1217 Ga0501045_0002121
1218 Ga0501045_0033084
1219 Ga0501045_0109778
1220 nmdc:mga03683_3289_c1
1221 nmdc:mga00v17_24608_c1
1222 nmdc:mga00v17_316525_c1
1223 nmdc:mga0yw44_25001_c1
1224 nmdc:mga0yw44_7370_c1
1225 nmdc:mga05p37_147347_c1
1226 nmdc:mga05p37_15393_c1
1227 nmdc:mga05p37_414343_c1
1228 nmdc:mga05p37_46247_c1
1229 nmdc:mga05p37_551325_c1
1230 nmdc:mga05p37_80750_c1
1231 nmdc:mga05p37_89471_c1
1232 nmdc:mga09592_21619_c1
1233 nmdc:mga0qj67_98158_c1
1234 nmdc:mga06r32_139110_c1
1235 nmdc:mga06r32_17160_c1
1236 nmdc:mga06r32_35042_c1
1237 nmdc:mga06r32_72245_c1
1238 nmdc:mga08y16_104378_c1
1239 nmdc:mga08y16_234949_c1
1240 nmdc:mga08y16_371003_c1
1241 nmdc:mga0n895_514658_c1
1242 nmdc:mga0rr50_16533_c1
1243 nmdc:mga0rr50_213013_c1
1244 nmdc:mga08x19_170195_c1
1245 nmdc:mga08x19_27635_c1
1246 nmdc:mga08x19_31724_c1
1247 nmdc:mga0a205_16250_c1
1248 nmdc:mga0a205_1945_c1
1249 Ga0495601_0009054
1250 Ga0495612_0030115
1251 Ga0495619_0037348
1252 Ga0495619_0108513
1253 Ga0501084_0020653
1254 Ga0501084_0407174
1255 Ga0590071_027542
1256 Ga0587077_002324
1257 Ga0587091_016886
1258 Ga0587079_011774
1259 Ga0587079_018219
1260 Ga0587071_017883
1261 Ga0501082_0004533
1262 Ga0501082_0283634
1263 Ga0530510_0019413
1264 Ga0530510_0044757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

103

304

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.7886 23 257
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.7871 24 267
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7775 24 271
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7653 25 271
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.7491 71 252
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8119 18 262 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8098 22 265 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8075 24 265 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8033 18 262 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7977 16 265 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7X8IY00-F1-model_v4 ABC transporter permease subunit 0.8919 86 274 GO:0005886
GO:0015423
GO:0042956
AF-A0A2V6X7V7-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8868 73 274 GO:0005886
GO:0055085
AF-A0A7V9HLP5-F1-model_v4 Carbohydrate ABC transporter permease 0.8807 77 270 GO:0005886
GO:0055085
AF-A0A248UN56-F1-model_v4 Binding-protein-dependent transport system inner membrane component family protein 0.8726 72 274 GO:0005886
GO:0055085
AF-A0A661TPQ6-F1-model_v4 Carbohydrate ABC transporter permease 0.8719 86 274 GO:0005886
GO:0055085

Map