F471077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 268 | 633 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10418774|Ga0157373_104187742 |
| Length | 264 |
| Sequence | MSETTLVPPAGLEFDAPHVPGLLRATWLVARKDLAIEFRTRSAFFSAVVFALLALAIFYYAWDPTAVTATDLAPGVLWVIFTFSGLLGLHRSFGVEMSDRAIDGLLASPASREAIFLGKALANLIFVAAVQLVAIPALVLFYNLPLTSIAGPLIAIAALAAIGXXXVGTLFSAMAVNTRLAELLLPMLALPFFVPIVTAAAQATAKLLSGRPVVEISAWLKLLVAFDLVFVVACTVAFPFTVEDELVTATATERVRDVSGIVPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 158 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 251 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.58 |
| Rhizosphere | 97.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4672892 | 2162886012 | Bacteria | 3150 |
| 2 | Ga0065712_10082566 | 3300005290 | Bacteria | 2906 |
| 3 | Ga0065715_10093395 | 3300005293 | Bacteria | 4701 |
| 4 | Ga0070658_10001684 | 3300005327 | Bacteria | 18659 |
| 5 | Ga0070658_10005474 | 3300005327 | Bacteria | 10300 |
| 6 | Ga0070658_10118904 | 3300005327 | Bacteria | 2195 |
| 7 | Ga0070658_10128251 | 3300005327 | Bacteria | 2113 |
| 8 | Ga0070683_100006630 | 3300005329 | Bacteria | 9721 |
| 9 | Ga0070683_100015822 | 3300005329 | Bacteria | 6633 |
| 10 | Ga0070683_100021358 | 3300005329 | Bacteria | 5778 |
| 11 | Ga0070683_100023805 | 3300005329 | Bacteria | 5481 |
| 12 | Ga0070683_100029411 | 3300005329 | Bacteria | 4973 |
| 13 | Ga0070683_100037963 | 3300005329 | Bacteria | 4412 |
| 14 | Ga0070683_100045724 | 3300005329 | Bacteria | 4041 |
| 15 | Ga0070683_100091934 | 3300005329 | Bacteria | 2850 |
| 16 | Ga0070683_100130762 | 3300005329 | Unclassified | 2376 |
| 17 | Ga0070683_100178090 | 3300005329 | Bacteria | 2018 |
| 18 | Ga0070683_100188530 | 3300005329 | Bacteria | 1958 |
| 19 | Ga0070683_100252583 | 3300005329 | Unclassified | 1677 |
| 20 | Ga0070690_100014309 | 3300005330 | Bacteria | 4707 |
| 21 | Ga0070690_100028789 | 3300005330 | Bacteria | 3442 |
| 22 | Ga0070690_100102149 | 3300005330 | Bacteria | 1902 |
| 23 | Ga0070690_100126557 | 3300005330 | Unclassified | 1721 |
| 24 | Ga0070670_100088295 | 3300005331 | Bacteria | 2665 |
| 25 | Ga0070677_10152472 | 3300005333 | Bacteria | 1077 |
| 26 | Ga0068869_100135235 | 3300005334 | Unclassified | 1898 |
| 27 | Ga0070680_100000187 | 3300005336 | Bacteria | 40138 |
| 28 | Ga0070680_100000740 | 3300005336 | Bacteria | 22791 |
| 29 | Ga0070680_100002251 | 3300005336 | Bacteria | 14251 |
| 30 | Ga0070680_100010964 | 3300005336 | Bacteria | 7007 |
| 31 | Ga0070680_100054279 | 3300005336 | Bacteria | 3272 |
| 32 | Ga0070680_100210191 | 3300005336 | Bacteria | 1642 |
| 33 | Ga0070680_100225977 | 3300005336 | Unclassified | 1580 |
| 34 | Ga0070682_100089269 | 3300005337 | Bacteria | 2013 |
| 35 | Ga0070682_100173712 | 3300005337 | Unclassified | 1499 |
| 36 | Ga0068868_100013966 | 3300005338 | Bacteria | 5908 |
| 37 | Ga0068868_100056027 | 3300005338 | Bacteria | 3112 |
| 38 | Ga0068868_100559362 | 3300005338 | Bacteria | 1009 |
| 39 | Ga0070660_100016690 | 3300005339 | Bacteria | 5336 |
| 40 | Ga0070660_100080282 | 3300005339 | Bacteria | 2559 |
| 41 | Ga0070660_100438343 | 3300005339 | Bacteria | 1083 |
| 42 | Ga0070689_100056549 | 3300005340 | Unclassified | 3042 |
| 43 | Ga0070691_10004179 | 3300005341 | Bacteria | 6559 |
| 44 | Ga0070691_10010004 | 3300005341 | Unclassified | 4321 |
| 45 | Ga0070691_10037141 | 3300005341 | Bacteria | 2298 |
| 46 | Ga0070687_100022622 | 3300005343 | Unclassified | 2975 |
| 47 | Ga0070661_100007670 | 3300005344 | Bacteria | 7451 |
| 48 | Ga0070661_100049184 | 3300005344 | Bacteria | 3087 |
| 49 | Ga0070661_100057094 | 3300005344 | Bacteria | 2861 |
| 50 | Ga0070692_10148848 | 3300005345 | Unclassified | 1331 |
| 51 | Ga0070668_100268726 | 3300005347 | Unclassified | 1421 |
| 52 | Ga0070669_100034397 | 3300005353 | Bacteria | 3669 |
| 53 | Ga0070669_100463277 | 3300005353 | Bacteria | 1046 |
| 54 | Ga0070675_100024357 | 3300005354 | Bacteria | 4847 |
| 55 | Ga0070675_100525993 | 3300005354 | Unclassified | 1067 |
| 56 | Ga0070671_100014627 | 3300005355 | Bacteria | 6344 |
| 57 | Ga0070671_100037473 | 3300005355 | Bacteria | 4021 |
| 58 | Ga0070671_100052254 | 3300005355 | Bacteria | 3398 |
| 59 | Ga0070674_100289519 | 3300005356 | Bacteria | 1301 |
| 60 | Ga0070673_100068503 | 3300005364 | Unclassified | 2842 |
| 61 | Ga0070688_100005628 | 3300005365 | Bacteria | 6612 |
| 62 | Ga0070688_100090788 | 3300005365 | Unclassified | 1995 |
| 63 | Ga0070659_100165992 | 3300005366 | Bacteria | 1807 |
| 64 | Ga0070659_100242241 | 3300005366 | Bacteria | 1493 |
| 65 | Ga0070667_100082900 | 3300005367 | Unclassified | 2746 |
| 66 | Ga0070667_100246733 | 3300005367 | Bacteria | 1596 |
| 67 | Ga0070667_100792639 | 3300005367 | Unclassified | 879 |
| 68 | Ga0070709_10503685 | 3300005434 | Bacteria | 920 |
| 69 | Ga0070714_100145189 | 3300005435 | Bacteria | 2133 |
| 70 | Ga0070713_100012772 | 3300005436 | Bacteria | 6173 |
| 71 | Ga0070701_10055034 | 3300005438 | Bacteria | 2077 |
| 72 | Ga0070711_100047808 | 3300005439 | Bacteria | 2922 |
| 73 | Ga0070711_100139992 | 3300005439 | Bacteria | 1813 |
| 74 | Ga0070694_100063519 | 3300005444 | Bacteria | 2525 |
| 75 | Ga0070694_100068455 | 3300005444 | Bacteria | 2440 |
| 76 | Ga0070694_100214476 | 3300005444 | Bacteria | 1441 |
| 77 | Ga0070708_100000089 | 3300005445 | Bacteria | 59378 |
| 78 | Ga0070708_100004987 | 3300005445 | Bacteria | 10492 |
| 79 | Ga0070708_100053005 | 3300005445 | Bacteria | 3598 |
| 80 | Ga0070663_100064728 | 3300005455 | Bacteria | 2643 |
| 81 | Ga0070678_100541771 | 3300005456 | Unclassified | 1032 |
| 82 | Ga0070662_100296759 | 3300005457 | Unclassified | 1312 |
| 83 | Ga0070681_10005730 | 3300005458 | Bacteria | 12008 |
| 84 | Ga0070681_10006463 | 3300005458 | Bacteria | 11408 |
| 85 | Ga0070681_10016025 | 3300005458 | Bacteria | 7473 |
| 86 | Ga0070681_10034983 | 3300005458 | Bacteria | 5045 |
| 87 | Ga0070681_10067660 | 3300005458 | Bacteria | 3539 |
| 88 | Ga0070681_10174531 | 3300005458 | Bacteria | 2071 |
| 89 | Ga0070681_10291638 | 3300005458 | Bacteria | 1541 |
| 90 | Ga0070681_10483622 | 3300005458 | Bacteria | 1151 |
| 91 | Ga0070685_10070273 | 3300005466 | Unclassified | 2072 |
| 92 | Ga0070706_100525910 | 3300005467 | Bacteria | 1100 |
| 93 | Ga0070707_100021715 | 3300005468 | Bacteria | 6067 |
| 94 | Ga0070707_100038876 | 3300005468 | Bacteria | 4546 |
| 95 | Ga0070707_100057738 | 3300005468 | Bacteria | 3723 |
| 96 | Ga0070707_100265640 | 3300005468 | Bacteria | 1669 |
| 97 | Ga0070698_100167902 | 3300005471 | Bacteria | 2136 |
| 98 | Ga0070698_100366715 | 3300005471 | Bacteria | 1372 |
| 99 | Ga0070698_100829293 | 3300005471 | Bacteria | 869 |
| 100 | Ga0070699_100072998 | 3300005518 | Bacteria | 2985 |
| 101 | Ga0070699_100084762 | 3300005518 | Bacteria | 2765 |
| 102 | Ga0070679_100001679 | 3300005530 | Bacteria | 19948 |
| 103 | Ga0070679_100002452 | 3300005530 | Bacteria | 16819 |
| 104 | Ga0070679_100003788 | 3300005530 | Bacteria | 13877 |
| 105 | Ga0070679_100005794 | 3300005530 | Bacteria | 11467 |
| 106 | Ga0070679_100016947 | 3300005530 | Bacteria | 7042 |
| 107 | Ga0070679_100033701 | 3300005530 | Bacteria | 5071 |
| 108 | Ga0070679_100065523 | 3300005530 | Bacteria | 3621 |
| 109 | Ga0070679_100089657 | 3300005530 | Bacteria | 3062 |
| 110 | Ga0070679_100111942 | 3300005530 | Bacteria | 2716 |
| 111 | Ga0070679_100170635 | 3300005530 | Bacteria | 2148 |
| 112 | Ga0070679_100171017 | 3300005530 | Unclassified | 2146 |
| 113 | Ga0070679_100508197 | 3300005530 | Unclassified | 1149 |
| 114 | Ga0070679_100508437 | 3300005530 | Unclassified | 1149 |
| 115 | Ga0070684_100000778 | 3300005535 | Bacteria | 22137 |
| 116 | Ga0070684_100008531 | 3300005535 | Bacteria | 8018 |
| 117 | Ga0070684_100028726 | 3300005535 | Bacteria | 4705 |
| 118 | Ga0070684_100043276 | 3300005535 | Bacteria | 3888 |
| 119 | Ga0070684_100046228 | 3300005535 | Bacteria | 3771 |
| 120 | Ga0070684_100069207 | 3300005535 | Bacteria | 3104 |
| 121 | Ga0070684_100170208 | 3300005535 | Bacteria | 1978 |
| 122 | Ga0070684_100207883 | 3300005535 | Bacteria | 1784 |
| 123 | Ga0070684_100341923 | 3300005535 | Bacteria | 1376 |
| 124 | Ga0070697_100138475 | 3300005536 | Bacteria | 2045 |
| 125 | Ga0070672_100075885 | 3300005543 | Bacteria | 2684 |
| 126 | Ga0070695_100436880 | 3300005545 | Unclassified | 1000 |
| 127 | Ga0070696_100002712 | 3300005546 | Bacteria | 11748 |
| 128 | Ga0070696_100041503 | 3300005546 | Bacteria | 3179 |
| 129 | Ga0070696_100100787 | 3300005546 | Bacteria | 2069 |
| 130 | Ga0070696_100180670 | 3300005546 | Bacteria | 1565 |
| 131 | Ga0070693_100000716 | 3300005547 | Bacteria | 14629 |
| 132 | Ga0070693_100379996 | 3300005547 | Bacteria | 974 |
| 133 | Ga0070693_100476915 | 3300005547 | Bacteria | 881 |
| 134 | Ga0070693_100482831 | 3300005547 | Bacteria | 876 |
| 135 | Ga0070704_100025997 | 3300005549 | Bacteria | 3861 |
| 136 | Ga0070704_100123009 | 3300005549 | Unclassified | 1997 |
| 137 | Ga0070704_100267075 | 3300005549 | Bacteria | 1412 |
| 138 | Ga0070704_100667037 | 3300005549 | Bacteria | 919 |
| 139 | Ga0068855_100021185 | 3300005563 | Bacteria | 7793 |
| 140 | Ga0068855_100258194 | 3300005563 | Bacteria | 1942 |
| 141 | Ga0068855_100332298 | 3300005563 | Bacteria | 1677 |
| 142 | Ga0068855_100515950 | 3300005563 | Bacteria | 1297 |
| 143 | Ga0068855_100548618 | 3300005563 | Bacteria | 1251 |
| 144 | Ga0070664_100092703 | 3300005564 | Bacteria | 2616 |
| 145 | Ga0070664_100297289 | 3300005564 | Bacteria | 1458 |
| 146 | Ga0070664_100798296 | 3300005564 | Unclassified | 882 |
| 147 | Ga0068857_100073137 | 3300005577 | Bacteria | 3054 |
| 148 | Ga0068857_100459257 | 3300005577 | Bacteria | 1191 |
| 149 | Ga0068854_100315787 | 3300005578 | Bacteria | 1268 |
| 150 | Ga0068854_100393084 | 3300005578 | Bacteria | 1145 |
| 151 | Ga0068854_100420183 | 3300005578 | Unclassified | 1110 |
| 152 | Ga0068856_100054366 | 3300005614 | Bacteria | 3949 |
| 153 | Ga0068856_100214180 | 3300005614 | Bacteria | 1942 |
| 154 | Ga0068856_100248575 | 3300005614 | Unclassified | 1793 |
| 155 | Ga0068856_100257352 | 3300005614 | Bacteria | 1761 |
| 156 | Ga0068856_100483823 | 3300005614 | Bacteria | 1259 |
| 157 | Ga0068856_100704776 | 3300005614 | Bacteria | 1030 |
| 158 | Ga0070702_100179772 | 3300005615 | Bacteria | 1383 |
| 159 | Ga0068852_100005679 | 3300005616 | Bacteria | 8948 |
| 160 | Ga0068852_100035272 | 3300005616 | Unclassified | 4171 |
| 161 | Ga0068852_100104535 | 3300005616 | Bacteria | 2563 |
| 162 | Ga0068859_100085745 | 3300005617 | Unclassified | 3195 |
| 163 | Ga0068859_100086502 | 3300005617 | Unclassified | 3181 |
| 164 | Ga0068859_100132360 | 3300005617 | Bacteria | 2566 |
| 165 | Ga0068859_100191537 | 3300005617 | Bacteria | 2129 |
| 166 | Ga0068864_100098422 | 3300005618 | Unclassified | 2591 |
| 167 | Ga0068870_10073588 | 3300005840 | Bacteria | 1869 |
| 168 | Ga0068870_10338599 | 3300005840 | Unclassified | 961 |
| 169 | Ga0068860_100315861 | 3300005843 | Unclassified | 1533 |
| 170 | Ga0068862_100179745 | 3300005844 | Bacteria | 1898 |
| 171 | Ga0081455_10041058 | 3300005937 | Bacteria | 4074 |
| 172 | Ga0070716_100081146 | 3300006173 | Bacteria | 1936 |
| 173 | Ga0070716_100184270 | 3300006173 | Bacteria | 1374 |
| 174 | Ga0097621_100215972 | 3300006237 | Bacteria | 1669 |
| 175 | Ga0097621_100334787 | 3300006237 | Bacteria | 1343 |
| 176 | Ga0075428_100664478 | 3300006844 | Unclassified | 1111 |
| 177 | Ga0075434_100033783 | 3300006871 | Bacteria | 5049 |
| 178 | Ga0075436_100104820 | 3300006914 | Bacteria | 1971 |
| 179 | Ga0075436_100496457 | 3300006914 | Bacteria | 892 |
| 180 | Ga0097620_100085740 | 3300006931 | Unclassified | 3195 |
| 181 | Ga0097620_100086508 | 3300006931 | Unclassified | 3181 |
| 182 | Ga0097620_100132352 | 3300006931 | Bacteria | 2566 |
| 183 | Ga0097620_100191511 | 3300006931 | Bacteria | 2129 |
| 184 | Ga0075435_100156648 | 3300007076 | Bacteria | 1917 |
| 185 | Ga0075435_100187457 | 3300007076 | Unclassified | 1750 |
| 186 | Ga0105240_10002404 | 3300009093 | Bacteria | 30105 |
| 187 | Ga0105240_10007054 | 3300009093 | Bacteria | 16382 |
| 188 | Ga0105240_10035417 | 3300009093 | Bacteria | 6433 |
| 189 | Ga0105240_10039700 | 3300009093 | Bacteria | 6025 |
| 190 | Ga0105240_10109606 | 3300009093 | Bacteria | 3343 |
| 191 | Ga0105240_10114766 | 3300009093 | Unclassified | 3253 |
| 192 | Ga0105240_10290028 | 3300009093 | Unclassified | 1876 |
| 193 | Ga0111539_10704607 | 3300009094 | Unclassified | 1175 |
| 194 | Ga0105245_10155871 | 3300009098 | Bacteria | 2163 |
| 195 | Ga0105245_10864373 | 3300009098 | Unclassified | 945 |
| 196 | Ga0114129_10067730 | 3300009147 | Bacteria | 4978 |
| 197 | Ga0105243_10110796 | 3300009148 | Bacteria | 2296 |
| 198 | Ga0105241_10002439 | 3300009174 | Bacteria | 13950 |
| 199 | Ga0105241_10206830 | 3300009174 | Bacteria | 1643 |
| 200 | Ga0105241_10570182 | 3300009174 | Bacteria | 1019 |
| 201 | Ga0105242_10172514 | 3300009176 | Unclassified | 1902 |
| 202 | Ga0105248_10219449 | 3300009177 | Unclassified | 2141 |
| 203 | Ga0105248_11163791 | 3300009177 | Unclassified | 872 |
| 204 | Ga0105237_10043671 | 3300009545 | Bacteria | 4514 |
| 205 | Ga0105237_10908706 | 3300009545 | Bacteria | 887 |
| 206 | Ga0105238_10056905 | 3300009551 | Unclassified | 3922 |
| 207 | Ga0105238_10103026 | 3300009551 | Bacteria | 2836 |
| 208 | Ga0105238_10424973 | 3300009551 | Bacteria | 1324 |
| 209 | Ga0105238_10831037 | 3300009551 | Bacteria | 940 |
| 210 | Ga0105249_11495754 | 3300009553 | Bacteria | 747 |
| 211 | Ga0105239_10088619 | 3300010375 | Bacteria | 3412 |
| 212 | Ga0105239_10604538 | 3300010375 | Bacteria | 1251 |
| 213 | Ga0105246_10154882 | 3300011119 | Bacteria | 1739 |
| 214 | Ga0105246_10300626 | 3300011119 | Unclassified | 1295 |
| 215 | Ga0105246_10622876 | 3300011119 | Unclassified | 935 |
| 216 | Ga0105246_10903564 | 3300011119 | Bacteria | 792 |
| 217 | Ga0157373_10060511 | 3300013100 | Bacteria | 2683 |
| 218 | Ga0157373_10208247 | 3300013100 | Bacteria | 1379 |
| 219 | Ga0157373_10418774 | 3300013100 | Unclassified | 961 |
| 220 | Ga0157371_10082313 | 3300013102 | Bacteria | 2279 |
| 221 | Ga0157371_10161941 | 3300013102 | Bacteria | 1598 |
| 222 | Ga0157370_10000540 | 3300013104 | Bacteria | 47409 |
| 223 | Ga0157370_10003694 | 3300013104 | Bacteria | 17883 |
| 224 | Ga0157370_10004399 | 3300013104 | Bacteria | 16165 |
| 225 | Ga0157370_10040372 | 3300013104 | Bacteria | 4505 |
| 226 | Ga0157370_10125431 | 3300013104 | Bacteria | 2396 |
| 227 | Ga0157370_10209269 | 3300013104 | Bacteria | 1808 |
| 228 | Ga0157370_10307768 | 3300013104 | Bacteria | 1462 |
| 229 | Ga0157369_10002739 | 3300013105 | Bacteria | 21042 |
| 230 | Ga0157369_10015801 | 3300013105 | Bacteria | 8503 |
| 231 | Ga0157369_10083959 | 3300013105 | Bacteria | 3405 |
| 232 | Ga0157369_10151149 | 3300013105 | Bacteria | 2454 |
| 233 | Ga0157369_10214724 | 3300013105 | Bacteria | 2015 |
| 234 | Ga0157369_10384223 | 3300013105 | Bacteria | 1457 |
| 235 | Ga0157369_11183013 | 3300013105 | Unclassified | 780 |
| 236 | Ga0157374_10185267 | 3300013296 | Bacteria | 2035 |
| 237 | Ga0157378_10026888 | 3300013297 | Bacteria | 5074 |
| 238 | Ga0157378_10356705 | 3300013297 | Unclassified | 1430 |
| 239 | Ga0157378_11330383 | 3300013297 | Unclassified | 760 |
| 240 | Ga0163162_10069273 | 3300013306 | Bacteria | 3579 |
| 241 | Ga0163162_10468854 | 3300013306 | Unclassified | 1391 |
| 242 | Ga0157372_10001743 | 3300013307 | Bacteria | 23591 |
| 243 | Ga0157372_10003651 | 3300013307 | Bacteria | 16548 |
| 244 | Ga0157372_10007923 | 3300013307 | Bacteria | 11293 |
| 245 | Ga0157372_10009451 | 3300013307 | Bacteria | 10373 |
| 246 | Ga0157372_10041502 | 3300013307 | Bacteria | 5088 |
| 247 | Ga0157372_10080645 | 3300013307 | Bacteria | 3683 |
| 248 | Ga0157372_10103477 | 3300013307 | Bacteria | 3254 |
| 249 | Ga0157372_10104797 | 3300013307 | Bacteria | 3234 |
| 250 | Ga0157372_10199573 | 3300013307 | Bacteria | 2317 |
| 251 | Ga0157372_10214939 | 3300013307 | Bacteria | 2228 |
| 252 | Ga0157372_10253381 | 3300013307 | Bacteria | 2043 |
| 253 | Ga0157372_10369537 | 3300013307 | Unclassified | 1671 |
| 254 | Ga0157372_10448099 | 3300013307 | Unclassified | 1504 |
| 255 | Ga0157372_10876762 | 3300013307 | Unclassified | 1042 |
| 256 | Ga0157375_10029480 | 3300013308 | Bacteria | 5162 |
| 257 | Ga0157375_10084945 | 3300013308 | Unclassified | 3215 |
| 258 | Ga0157375_10119586 | 3300013308 | Bacteria | 2742 |
| 259 | Ga0157375_10157166 | 3300013308 | Unclassified | 2413 |
| 260 | Ga0157375_10234100 | 3300013308 | Bacteria | 1996 |
| 261 | Ga0157380_10393769 | 3300014326 | Bacteria | 1312 |
| 262 | Ga0157380_10737438 | 3300014326 | Bacteria | 995 |
| 263 | Ga0157377_10058658 | 3300014745 | Bacteria | 2192 |
| 264 | Ga0157377_10140413 | 3300014745 | Bacteria | 1484 |
| 265 | Ga0157379_10572962 | 3300014968 | Bacteria | 1052 |
| 266 | Ga0157376_10056588 | 3300014969 | Bacteria | 3277 |
| 267 | Ga0197907_10335094 | 3300020069 | Bacteria | 1282 |
| 268 | Ga0206353_11787594 | 3300020082 | Bacteria | 1440 |
| 269 | Ga0213876_10026623 | 3300021384 | Bacteria | 3050 |
| 270 | Ga0207682_10146308 | 3300025893 | Bacteria | 1063 |
| 271 | Ga0207642_10056912 | 3300025899 | Bacteria | 1796 |
| 272 | Ga0207688_10163360 | 3300025901 | Bacteria | 1321 |
| 273 | Ga0207680_10054574 | 3300025903 | Unclassified | 2405 |
| 274 | Ga0207699_10261714 | 3300025906 | Bacteria | 1196 |
| 275 | Ga0207645_10056374 | 3300025907 | Bacteria | 2508 |
| 276 | Ga0207645_10349702 | 3300025907 | Bacteria | 989 |
| 277 | Ga0207643_10052595 | 3300025908 | Bacteria | 2313 |
| 278 | Ga0207705_10003698 | 3300025909 | Bacteria | 11640 |
| 279 | Ga0207705_10014773 | 3300025909 | Bacteria | 5614 |
| 280 | Ga0207705_10184728 | 3300025909 | Bacteria | 1575 |
| 281 | Ga0207684_10451994 | 3300025910 | Bacteria | 1103 |
| 282 | Ga0207654_10017982 | 3300025911 | Bacteria | 3705 |
| 283 | Ga0207707_10002022 | 3300025912 | Bacteria | 18412 |
| 284 | Ga0207707_10011617 | 3300025912 | Bacteria | 7665 |
| 285 | Ga0207707_10018744 | 3300025912 | Bacteria | 6034 |
| 286 | Ga0207707_10037243 | 3300025912 | Bacteria | 4250 |
| 287 | Ga0207707_10093867 | 3300025912 | Bacteria | 2621 |
| 288 | Ga0207707_10131280 | 3300025912 | Bacteria | 2191 |
| 289 | Ga0207707_10198967 | 3300025912 | Bacteria | 1747 |
| 290 | Ga0207695_10001840 | 3300025913 | Bacteria | 33282 |
| 291 | Ga0207695_10002822 | 3300025913 | Bacteria | 25243 |
| 292 | Ga0207695_10009902 | 3300025913 | Bacteria | 11713 |
| 293 | Ga0207695_10014926 | 3300025913 | Bacteria | 9168 |
| 294 | Ga0207695_10025723 | 3300025913 | Bacteria | 6584 |
| 295 | Ga0207695_10044047 | 3300025913 | Unclassified | 4750 |
| 296 | Ga0207695_10096842 | 3300025913 | Bacteria | 2952 |
| 297 | Ga0207695_10133735 | 3300025913 | Unclassified | 2435 |
| 298 | Ga0207671_10045989 | 3300025914 | Bacteria | 3228 |
| 299 | Ga0207663_10029987 | 3300025916 | Bacteria | 3203 |
| 300 | Ga0207663_10307051 | 3300025916 | Bacteria | 1187 |
| 301 | Ga0207660_10000071 | 3300025917 | Bacteria | 52971 |
| 302 | Ga0207660_10009685 | 3300025917 | Bacteria | 6235 |
| 303 | Ga0207660_10011949 | 3300025917 | Bacteria | 5668 |
| 304 | Ga0207660_10075828 | 3300025917 | Bacteria | 2458 |
| 305 | Ga0207660_10109902 | 3300025917 | Bacteria | 2073 |
| 306 | Ga0207660_10116611 | 3300025917 | Bacteria | 2017 |
| 307 | Ga0207660_10503591 | 3300025917 | Bacteria | 983 |
| 308 | Ga0207662_10006600 | 3300025918 | Bacteria | 6266 |
| 309 | Ga0207657_10001748 | 3300025919 | Bacteria | 23427 |
| 310 | Ga0207657_10002151 | 3300025919 | Bacteria | 21361 |
| 311 | Ga0207657_10040525 | 3300025919 | Bacteria | 4126 |
| 312 | Ga0207657_10106432 | 3300025919 | Bacteria | 2321 |
| 313 | Ga0207657_10116166 | 3300025919 | Bacteria | 2205 |
| 314 | Ga0207657_10366525 | 3300025919 | Bacteria | 1135 |
| 315 | Ga0207649_10089241 | 3300025920 | Bacteria | 2015 |
| 316 | Ga0207652_10009562 | 3300025921 | Bacteria | 7797 |
| 317 | Ga0207652_10012829 | 3300025921 | Bacteria | 6775 |
| 318 | Ga0207652_10023518 | 3300025921 | Bacteria | 5105 |
| 319 | Ga0207652_10043502 | 3300025921 | Bacteria | 3824 |
| 320 | Ga0207652_10044813 | 3300025921 | Bacteria | 3769 |
| 321 | Ga0207652_10049713 | 3300025921 | Bacteria | 3590 |
| 322 | Ga0207652_10086227 | 3300025921 | Bacteria | 2753 |
| 323 | Ga0207652_10139699 | 3300025921 | Bacteria | 2165 |
| 324 | Ga0207652_10186696 | 3300025921 | Bacteria | 1864 |
| 325 | Ga0207652_10200744 | 3300025921 | Bacteria | 1794 |
| 326 | Ga0207652_10263202 | 3300025921 | Bacteria | 1556 |
| 327 | Ga0207646_10043630 | 3300025922 | Bacteria | 4026 |
| 328 | Ga0207646_10053295 | 3300025922 | Bacteria | 3618 |
| 329 | Ga0207694_10076618 | 3300025924 | Bacteria | 2619 |
| 330 | Ga0207694_10344769 | 3300025924 | Bacteria | 1232 |
| 331 | Ga0207694_10548625 | 3300025924 | Unclassified | 970 |
| 332 | Ga0207659_10065029 | 3300025926 | Unclassified | 2642 |
| 333 | Ga0207659_10071449 | 3300025926 | Bacteria | 2534 |
| 334 | Ga0207687_10719203 | 3300025927 | Unclassified | 848 |
| 335 | Ga0207687_10755258 | 3300025927 | Bacteria | 828 |
| 336 | Ga0207700_10089487 | 3300025928 | Bacteria | 2427 |
| 337 | Ga0207664_10047944 | 3300025929 | Bacteria | 3358 |
| 338 | Ga0207644_10026125 | 3300025931 | Unclassified | 4022 |
| 339 | Ga0207644_10062127 | 3300025931 | Bacteria | 2708 |
| 340 | Ga0207644_10425154 | 3300025931 | Bacteria | 1089 |
| 341 | Ga0207690_10007736 | 3300025932 | Bacteria | 6377 |
| 342 | Ga0207690_10018034 | 3300025932 | Bacteria | 4323 |
| 343 | Ga0207690_10128083 | 3300025932 | Bacteria | 1854 |
| 344 | Ga0207690_10208460 | 3300025932 | Bacteria | 1488 |
| 345 | Ga0207686_10082259 | 3300025934 | Bacteria | 2104 |
| 346 | Ga0207686_10200625 | 3300025934 | Bacteria | 1428 |
| 347 | Ga0207686_10413521 | 3300025934 | Bacteria | 1030 |
| 348 | Ga0207709_10240990 | 3300025935 | Bacteria | 1315 |
| 349 | Ga0207670_10134305 | 3300025936 | Unclassified | 1817 |
| 350 | Ga0207704_10070882 | 3300025938 | Bacteria | 2209 |
| 351 | Ga0207704_10076585 | 3300025938 | Bacteria | 2144 |
| 352 | Ga0207665_10176622 | 3300025939 | Archaea | 1545 |
| 353 | Ga0207691_10014209 | 3300025940 | Bacteria | 7595 |
| 354 | Ga0207691_10016949 | 3300025940 | Bacteria | 6913 |
| 355 | Ga0207691_10137936 | 3300025940 | Bacteria | 2150 |
| 356 | Ga0207711_10690198 | 3300025941 | Unclassified | 952 |
| 357 | Ga0207661_10000568 | 3300025944 | Bacteria | 23560 |
| 358 | Ga0207661_10003126 | 3300025944 | Bacteria | 11472 |
| 359 | Ga0207661_10027246 | 3300025944 | Bacteria | 4364 |
| 360 | Ga0207661_10027612 | 3300025944 | Bacteria | 4337 |
| 361 | Ga0207661_10069121 | 3300025944 | Bacteria | 2878 |
| 362 | Ga0207661_10098774 | 3300025944 | Bacteria | 2447 |
| 363 | Ga0207661_10101491 | 3300025944 | Bacteria | 2417 |
| 364 | Ga0207661_10306640 | 3300025944 | Bacteria | 1424 |
| 365 | Ga0207661_10399948 | 3300025944 | Bacteria | 1245 |
| 366 | Ga0207679_10084762 | 3300025945 | Bacteria | 2433 |
| 367 | Ga0207679_10199559 | 3300025945 | Bacteria | 1670 |
| 368 | Ga0207667_10035104 | 3300025949 | Bacteria | 5381 |
| 369 | Ga0207667_10046369 | 3300025949 | Bacteria | 4602 |
| 370 | Ga0207667_10148329 | 3300025949 | Bacteria | 2414 |
| 371 | Ga0207667_10269677 | 3300025949 | Bacteria | 1740 |
| 372 | Ga0207667_10645184 | 3300025949 | Bacteria | 1065 |
| 373 | Ga0207667_10947140 | 3300025949 | Bacteria | 851 |
| 374 | Ga0207651_10025149 | 3300025960 | Bacteria | 3697 |
| 375 | Ga0207668_10076501 | 3300025972 | Bacteria | 2410 |
| 376 | Ga0207668_10164258 | 3300025972 | Unclassified | 1734 |
| 377 | Ga0207640_10005661 | 3300025981 | Bacteria | 6808 |
| 378 | Ga0207640_10077926 | 3300025981 | Bacteria | 2254 |
| 379 | Ga0207640_10402720 | 3300025981 | Unclassified | 1115 |
| 380 | Ga0207658_10035986 | 3300025986 | Unclassified | 3549 |
| 381 | Ga0207658_10049289 | 3300025986 | Unclassified | 3094 |
| 382 | Ga0207658_10076242 | 3300025986 | Bacteria | 2554 |
| 383 | Ga0207658_10441408 | 3300025986 | Bacteria | 1151 |
| 384 | Ga0207677_10091726 | 3300026023 | Bacteria | 2210 |
| 385 | Ga0207703_10210003 | 3300026035 | Bacteria | 1735 |
| 386 | Ga0207703_10252347 | 3300026035 | Unclassified | 1591 |
| 387 | Ga0207639_10043929 | 3300026041 | Bacteria | 3358 |
| 388 | Ga0207678_10001464 | 3300026067 | Bacteria | 21663 |
| 389 | Ga0207678_10312601 | 3300026067 | Bacteria | 1351 |
| 390 | Ga0207702_10029611 | 3300026078 | Bacteria | 4557 |
| 391 | Ga0207702_10071173 | 3300026078 | Bacteria | 2994 |
| 392 | Ga0207702_10383544 | 3300026078 | Bacteria | 1352 |
| 393 | Ga0207702_10457222 | 3300026078 | Bacteria | 1239 |
| 394 | Ga0207702_10653156 | 3300026078 | Unclassified | 1034 |
| 395 | Ga0207676_10256433 | 3300026095 | Bacteria | 1577 |
| 396 | Ga0207674_10011008 | 3300026116 | Bacteria | 10173 |
| 397 | Ga0207674_10066327 | 3300026116 | Bacteria | 3636 |
| 398 | Ga0207674_10157834 | 3300026116 | Bacteria | 2223 |
| 399 | Ga0207674_10258040 | 3300026116 | Bacteria | 1690 |
| 400 | Ga0207674_10554171 | 3300026116 | Unclassified | 1110 |
| 401 | Ga0207698_10018181 | 3300026142 | Bacteria | 4784 |
| 402 | Ga0207698_10640372 | 3300026142 | Bacteria | 1052 |
| 403 | Ga0268265_10033891 | 3300028380 | Bacteria | 3717 |
| 404 | Ga0268265_10199146 | 3300028380 | Bacteria | 1736 |
| 405 | Ga0268264_10151295 | 3300028381 | Bacteria | 2081 |
| 406 | Ga0307408_100034305 | 3300031548 | Bacteria | 3554 |
| 407 | Ga0307408_100092958 | 3300031548 | Bacteria | 2281 |
| 408 | Ga0307408_100539281 | 3300031548 | Unclassified | 1028 |
| 409 | Ga0307405_10010758 | 3300031731 | Bacteria | 4757 |
| 410 | Ga0307405_10018526 | 3300031731 | Bacteria | 3843 |
| 411 | Ga0307405_10254324 | 3300031731 | Bacteria | 1309 |
| 412 | Ga0307413_10001849 | 3300031824 | Bacteria | 8336 |
| 413 | Ga0307413_10011843 | 3300031824 | Bacteria | 4310 |
| 414 | Ga0307413_10024956 | 3300031824 | Bacteria | 3267 |
| 415 | Ga0307413_10064531 | 3300031824 | Unclassified | 2276 |
| 416 | Ga0307413_10172726 | 3300031824 | Bacteria | 1532 |
| 417 | Ga0307413_10189768 | 3300031824 | Bacteria | 1474 |
| 418 | Ga0307410_10000503 | 3300031852 | Bacteria | 15891 |
| 419 | Ga0307410_10012594 | 3300031852 | Bacteria | 4898 |
| 420 | Ga0307410_10047362 | 3300031852 | Bacteria | 2873 |
| 421 | Ga0307410_10165596 | 3300031852 | Bacteria | 1661 |
| 422 | Ga0307410_10266664 | 3300031852 | Bacteria | 1338 |
| 423 | Ga0307410_10388473 | 3300031852 | Unclassified | 1125 |
| 424 | Ga0307406_10004847 | 3300031901 | Bacteria | 7329 |
| 425 | Ga0307406_10021374 | 3300031901 | Bacteria | 3826 |
| 426 | Ga0307406_10077990 | 3300031901 | Bacteria | 2193 |
| 427 | Ga0307406_10134098 | 3300031901 | Bacteria | 1743 |
| 428 | Ga0307406_10427797 | 3300031901 | Bacteria | 1056 |
| 429 | Ga0307407_10001318 | 3300031903 | Bacteria | 8877 |
| 430 | Ga0307407_10006738 | 3300031903 | Bacteria | 5140 |
| 431 | Ga0307407_10020398 | 3300031903 | Bacteria | 3395 |
| 432 | Ga0307407_10073887 | 3300031903 | Bacteria | 2039 |
| 433 | Ga0307407_10094472 | 3300031903 | Unclassified | 1841 |
| 434 | Ga0307407_10263039 | 3300031903 | Bacteria | 1187 |
| 435 | Ga0307407_10538400 | 3300031903 | Unclassified | 861 |
| 436 | Ga0307412_10013368 | 3300031911 | Bacteria | 4811 |
| 437 | Ga0307412_10027137 | 3300031911 | Bacteria | 3567 |
| 438 | Ga0307412_10193637 | 3300031911 | Bacteria | 1539 |
| 439 | Ga0307412_10430668 | 3300031911 | Bacteria | 1081 |
| 440 | Ga0307412_10660468 | 3300031911 | Bacteria | 893 |
| 441 | Ga0307409_100013992 | 3300031995 | Bacteria | 5194 |
| 442 | Ga0307409_100071539 | 3300031995 | Bacteria | 2758 |
| 443 | Ga0307409_100193344 | 3300031995 | Bacteria | 1813 |
| 444 | Ga0307409_100212014 | 3300031995 | Bacteria | 1741 |
| 445 | Ga0307409_100560623 | 3300031995 | Bacteria | 1123 |
| 446 | Ga0307416_100002176 | 3300032002 | Bacteria | 11111 |
| 447 | Ga0307416_100003596 | 3300032002 | Bacteria | 9145 |
| 448 | Ga0307416_100012696 | 3300032002 | Bacteria | 5688 |
| 449 | Ga0307416_100058707 | 3300032002 | Bacteria | 3121 |
| 450 | Ga0307416_100170483 | 3300032002 | Bacteria | 2025 |
| 451 | Ga0307416_100223354 | 3300032002 | Unclassified | 1809 |
| 452 | Ga0307416_100287224 | 3300032002 | Bacteria | 1626 |
| 453 | Ga0307416_100444887 | 3300032002 | Unclassified | 1347 |
| 454 | Ga0307416_100686939 | 3300032002 | Bacteria | 1111 |
| 455 | Ga0307416_100844306 | 3300032002 | Unclassified | 1014 |
| 456 | Ga0307416_101142057 | 3300032002 | Bacteria | 884 |
| 457 | Ga0307414_10017852 | 3300032004 | Bacteria | 4352 |
| 458 | Ga0307414_10018267 | 3300032004 | Bacteria | 4311 |
| 459 | Ga0307414_10040187 | 3300032004 | Bacteria | 3157 |
| 460 | Ga0307411_10037145 | 3300032005 | Bacteria | 3059 |
| 461 | Ga0307411_10048558 | 3300032005 | Bacteria | 2751 |
| 462 | Ga0307415_100002530 | 3300032126 | Bacteria | 9139 |
| 463 | Ga0307415_100014380 | 3300032126 | Bacteria | 4652 |
| 464 | Ga0307415_100026149 | 3300032126 | Bacteria | 3677 |
| 465 | Ga0307415_100404202 | 3300032126 | Archaea | 1167 |
| 466 | Ga0373959_0003753 | 3300034820 | Unclassified | 2431 |
| 467 | Ga0373929_0084512 | 3300035085 | Unclassified | 778 |
| 468 | Ga0373934_0000064 | 3300035086 | Bacteria | 36073 |
| 469 | Ga0373934_0007666 | 3300035086 | Bacteria | 4009 |
| 470 | Ga0373923_0019296 | 3300035111 | Bacteria | 2638 |
| 471 | Ga0373923_0048442 | 3300035111 | Bacteria | 1774 |
| 472 | Ga0373941_0002720 | 3300035115 | Unclassified | 3922 |
| 473 | Ga0373953_0001938 | 3300035117 | Bacteria | 6153 |
| 474 | Ga0373956_0000381 | 3300035119 | Bacteria | 18142 |
| 475 | Ga0373956_0022153 | 3300035119 | Bacteria | 2716 |
| 476 | Ga0373956_0067800 | 3300035119 | Bacteria | 1625 |
| 477 | Ga0373957_0031354 | 3300035120 | Bacteria | 1953 |
| 478 | Ga0373957_0123513 | 3300035120 | Bacteria | 1049 |
| 479 | Ga0373955_0000995 | 3300035172 | Bacteria | 12012 |
| 480 | Ga0373955_0005959 | 3300035172 | Bacteria | 5522 |
| 481 | Ga0373961_0025819 | 3300035241 | Bacteria | 1601 |
| 482 | Ga0373924_0042853 | 3300035410 | Bacteria | 1857 |
| 483 | Ga0373931_0022133 | 3300035691 | Bacteria | 3196 |
| 484 | Ga0373933_0001064 | 3300035724 | Bacteria | 16565 |
| 485 | Ga0373933_0024556 | 3300035724 | Bacteria | 3450 |
| 486 | Ga0373947_0016511 | 3300035725 | Bacteria | 4243 |
| 487 | Ga0373947_0097201 | 3300035725 | Bacteria | 1845 |
| 488 | Ga0373937_0000558 | 3300036401 | Bacteria | 33042 |
| 489 | Ga0373937_0018717 | 3300036401 | Bacteria | 6189 |
| 490 | Ga0373937_0051886 | 3300036401 | Bacteria | 3759 |
| 491 | Ga0373937_0115090 | 3300036401 | Bacteria | 2504 |
| 492 | Ga0373925_0054882 | 3300037068 | Bacteria | 2981 |
| 493 | Ga0373925_0095161 | 3300037068 | Bacteria | 2281 |
| 494 | Ga0395899_0106317 | 3300037312 | Bacteria | 2021 |
| 495 | Ga0395898_0126652 | 3300037466 | Bacteria | 2447 |
| 496 | Ga0395905_0004795 | 3300037471 | Bacteria | 13972 |
| 497 | Ga0395901_0005991 | 3300038443 | Bacteria | 12311 |
| 498 | Ga0436365_0041325 | 3300039437 | Bacteria | 5371 |
| 499 | Ga0436365_0931492 | 3300039437 | Bacteria | 11326 |
| 500 | Ga0451853_1717090 | 3300041512 | Unclassified | 1370 |
| 501 | Ga0439462_0086906 | 3300042015 | Bacteria | 856 |
| 502 | Ga0466966_0040865 | 3300044684 | Bacteria | 2982 |
| 503 | Ga0466966_0045515 | 3300044684 | Bacteria | 2805 |
| 504 | Ga0466963_0276235 | 3300044694 | Unclassified | 1181 |
| 505 | Ga0466957_0279630 | 3300044842 | Bacteria | 1117 |
| 506 | Ga0466958_0084438 | 3300045836 | Bacteria | 1958 |
| 507 | Ga0466958_0359280 | 3300045836 | Bacteria | 938 |
| 508 | Ga0466967_0027120 | 3300045976 | Bacteria | 4760 |
| 509 | Ga0495592_0000897 | 3300046454 | Bacteria | 20636 |
| 510 | Ga0495592_0059623 | 3300046454 | Bacteria | 2810 |
| 511 | Ga0495629_0023944 | 3300046459 | Bacteria | 4348 |
| 512 | Ga0495629_0062333 | 3300046459 | Bacteria | 2605 |
| 513 | Ga0495638_0290598 | 3300046460 | Unclassified | 884 |
| 514 | Ga0495651_0000171 | 3300046462 | Bacteria | 47887 |
| 515 | Ga0495651_0102124 | 3300046462 | Bacteria | 2133 |
| 516 | Ga0495653_0000065 | 3300046463 | Bacteria | 92073 |
| 517 | Ga0495580_0022995 | 3300046472 | Bacteria | 4584 |
| 518 | Ga0495582_0019649 | 3300046473 | Bacteria | 3694 |
| 519 | Ga0495582_0081482 | 3300046473 | Bacteria | 1797 |
| 520 | Ga0495662_0192426 | 3300046476 | Bacteria | 1006 |
| 521 | Ga0495664_0013060 | 3300046477 | Bacteria | 4709 |
| 522 | Ga0495664_0154740 | 3300046477 | Bacteria | 1391 |
| 523 | Ga0495594_0005649 | 3300046499 | Bacteria | 6432 |
| 524 | Ga0495594_0244070 | 3300046499 | Bacteria | 1023 |
| 525 | Ga0495596_0117237 | 3300046500 | Unclassified | 1034 |
| 526 | Ga0495608_0002630 | 3300046511 | Bacteria | 12898 |
| 527 | Ga0495608_0070939 | 3300046511 | Bacteria | 2273 |
| 528 | Ga0495618_0085422 | 3300046514 | Bacteria | 2017 |
| 529 | Ga0495628_0010298 | 3300046516 | Bacteria | 7948 |
| 530 | Ga0495628_0038398 | 3300046516 | Bacteria | 3833 |
| 531 | Ga0495628_0077325 | 3300046516 | Bacteria | 2589 |
| 532 | Ga0495630_0003226 | 3300046517 | Bacteria | 11356 |
| 533 | Ga0495630_0007885 | 3300046517 | Bacteria | 7635 |
| 534 | Ga0495630_0038958 | 3300046517 | Bacteria | 3555 |
| 535 | Ga0495666_0023106 | 3300046526 | Bacteria | 3076 |
| 536 | Ga0495666_0130026 | 3300046526 | Bacteria | 1177 |
| 537 | Ga0495652_0001144 | 3300046529 | Bacteria | 29882 |
| 538 | Ga0495652_0043468 | 3300046529 | Bacteria | 3869 |
| 539 | Ga0495665_0035766 | 3300046531 | Bacteria | 2652 |
| 540 | Ga0495665_0047420 | 3300046531 | Bacteria | 2279 |
| 541 | Ga0495586_0037632 | 3300046535 | Bacteria | 2598 |
| 542 | Ga0495586_0042921 | 3300046535 | Bacteria | 2435 |
| 543 | Ga0495586_0050475 | 3300046535 | Bacteria | 2251 |
| 544 | Ga0495586_0138016 | 3300046535 | Bacteria | 1367 |
| 545 | Ga0495587_0000721 | 3300046536 | Bacteria | 22088 |
| 546 | Ga0495587_0001658 | 3300046536 | Bacteria | 14860 |
| 547 | Ga0495587_0001702 | 3300046536 | Bacteria | 14688 |
| 548 | Ga0495645_0000127 | 3300046543 | Bacteria | 51432 |
| 549 | Ga0495645_0000616 | 3300046543 | Bacteria | 24563 |
| 550 | Ga0495645_0000737 | 3300046543 | Bacteria | 22347 |
| 551 | Ga0495667_0001871 | 3300046559 | Bacteria | 13968 |
| 552 | Ga0495667_0003111 | 3300046559 | Bacteria | 11129 |
| 553 | Ga0495667_0026907 | 3300046559 | Bacteria | 3876 |
| 554 | Ga0495667_0117156 | 3300046559 | Bacteria | 1720 |
| 555 | Ga0495635_0000248 | 3300046663 | Bacteria | 34264 |
| 556 | Ga0495588_0009726 | 3300046674 | Bacteria | 4457 |
| 557 | Ga0495657_0002731 | 3300046675 | Bacteria | 14738 |
| 558 | Ga0495599_0003594 | 3300046678 | Bacteria | 9093 |
| 559 | Ga0495599_0004132 | 3300046678 | Bacteria | 8573 |
| 560 | Ga0495623_0000399 | 3300046679 | Bacteria | 28720 |
| 561 | Ga0495646_0074190 | 3300046680 | Bacteria | 1997 |
| 562 | Ga0495646_0091400 | 3300046680 | Bacteria | 1756 |
| 563 | Ga0495647_0071208 | 3300046681 | Bacteria | 1392 |
| 564 | Ga0495658_0361922 | 3300046683 | Bacteria | 922 |
| 565 | Ga0495613_0085543 | 3300046689 | Bacteria | 2288 |
| 566 | Ga0495600_0002017 | 3300046809 | Bacteria | 11422 |
| 567 | Ga0495581_0010734 | 3300047315 | Bacteria | 5297 |
| 568 | Ga0495581_0141367 | 3300047315 | Bacteria | 1404 |
| 569 | Ga0495604_0000579 | 3300047317 | Bacteria | 32066 |
| 570 | Ga0495604_0197966 | 3300047317 | Bacteria | 1396 |
| 571 | Ga0495604_0369625 | 3300047317 | Bacteria | 949 |
| 572 | Ga0495674_0003646 | 3300047319 | Bacteria | 14993 |
| 573 | Ga0495674_0097179 | 3300047319 | Bacteria | 2509 |
| 574 | Ga0495674_0250710 | 3300047319 | Bacteria | 1457 |
| 575 | Ga0495672_0005150 | 3300047320 | Bacteria | 10430 |
| 576 | Ga0495680_0002958 | 3300047322 | Bacteria | 17006 |
| 577 | Ga0495680_0245353 | 3300047322 | Bacteria | 1271 |
| 578 | Ga0495675_0000773 | 3300047444 | Bacteria | 19900 |
| 579 | Ga0495675_0072066 | 3300047444 | Bacteria | 2180 |
| 580 | Ga0495684_0000049 | 3300047471 | Bacteria | 87765 |
| 581 | Ga0495684_0030857 | 3300047471 | Bacteria | 4114 |
| 582 | Ga0495684_0234372 | 3300047471 | Bacteria | 1341 |
| 583 | Ga0495593_0036210 | 3300047673 | Bacteria | 2677 |
| 584 | Ga0495593_0123894 | 3300047673 | Bacteria | 1314 |
| 585 | Ga0495602_0023387 | 3300048088 | Bacteria | 6022 |
| 586 | Ga0495602_0033360 | 3300048088 | Bacteria | 4830 |
| 587 | Ga0496100_0188683 | 3300048903 | Bacteria | 1495 |
| 588 | Ga0496101_0237795 | 3300048904 | Bacteria | 1417 |
| 589 | Ga0496104_0581735 | 3300048907 | Bacteria | 1030 |
| 590 | Ga0496105_0104039 | 3300048908 | Bacteria | 2345 |
| 591 | Ga0496106_0163619 | 3300048909 | Bacteria | 1760 |
| 592 | Ga0496107_0036151 | 3300048910 | Bacteria | 3543 |
| 593 | Ga0496108_0164690 | 3300048911 | Bacteria | 1917 |
| 594 | Ga0496112_0014840 | 3300048915 | Bacteria | 7246 |
| 595 | Ga0496112_0209941 | 3300048915 | Bacteria | 1905 |
| 596 | Ga0496115_0278337 | 3300048918 | Unclassified | 1374 |
| 597 | Ga0501032_0209436 | 3300049569 | Bacteria | 1271 |
| 598 | Ga0501032_0337707 | 3300049569 | Unclassified | 971 |
| 599 | Ga0501033_0009285 | 3300049570 | Bacteria | 7577 |
| 600 | Ga0501034_0175496 | 3300049571 | Bacteria | 2109 |
| 601 | Ga0501036_0008351 | 3300049572 | Bacteria | 8486 |
| 602 | Ga0501037_0282084 | 3300049573 | Bacteria | 1157 |
| 603 | Ga0501043_0130805 | 3300049579 | Bacteria | 1967 |
| 604 | Ga0501043_0617623 | 3300049579 | Bacteria | 799 |
| 605 | Ga0501047_0014525 | 3300049581 | Bacteria | 7490 |
| 606 | Ga0501047_0119343 | 3300049581 | Bacteria | 2519 |
| 607 | Ga0501047_0193584 | 3300049581 | Bacteria | 1896 |
| 608 | Ga0501070_0659329 | 3300049586 | Bacteria | 830 |
| 609 | Ga0501202_009468 | 3300049652 | Unclassified | 1792 |
| 610 | Ga0501233_004323 | 3300049668 | Bacteria | 2598 |
| 611 | Ga0501235_005288 | 3300049669 | Unclassified | 2808 |
| 612 | Ga0501251_020900 | 3300049681 | Unclassified | 869 |
| 613 | Ga0501259_003055 | 3300049688 | Unclassified | 2682 |
| 614 | Ga0501225_0004285 | 3300049705 | Bacteria | 4264 |
| 615 | Ga0501234_002527 | 3300049707 | Unclassified | 2879 |
| 616 | Ga0501083_0372205 | 3300049744 | Unclassified | 929 |
| 617 | Ga0501263_000169 | 3300049760 | Unclassified | 3892 |
| 618 | Ga0501035_0073884 | 3300049822 | Bacteria | 3017 |
| 619 | Ga0501035_0087228 | 3300049822 | Bacteria | 2750 |
| 620 | Ga0501044_0118431 | 3300049823 | Bacteria | 2651 |
| 621 | Ga0501044_0131094 | 3300049823 | Bacteria | 2501 |
| 622 | nmdc:mga05p37_201104_c1 | 3300050507 | Bacteria | 2413 |
| 623 | nmdc:mga0n895_13980_c1 | 3300050512 | Bacteria | 7270 |
| 624 | nmdc:mga0rr50_141142_c1 | 3300050513 | Bacteria | 1938 |
| 625 | nmdc:mga08x19_359444_c1 | 3300050514 | Unclassified | 1017 |
| 626 | nmdc:mga08x19_5485_c1 | 3300050514 | Bacteria | 7503 |
| 627 | nmdc:mga0a205_60926_c1 | 3300050515 | Bacteria | 3645 |
| 628 | Ga0495601_0006363 | 3300053077 | Bacteria | 6905 |
| 629 | Ga0495601_0225256 | 3300053077 | Unclassified | 1225 |
| 630 | Ga0495595_0076278 | 3300053084 | Bacteria | 1591 |
| 631 | Ga0495595_0132511 | 3300053084 | Bacteria | 1219 |
| 632 | Ga0495619_0002387 | 3300053085 | Bacteria | 12330 |
| 633 | Ga0495619_0108611 | 3300053085 | Bacteria | 1894 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025893 | Ga0207682_10146308 | Ga0207682_101463081 | 153 |
| 2 | 3300009551 | Ga0105238_10831037 | Ga0105238_108310372 | 187 |
| 3 | 3300031901 | Ga0307406_10134098 | Ga0307406_101340984 | 189 |
| 4 | 3300005353 | Ga0070669_100034397 | Ga0070669_1000343973 | 191 |
| 5 | 3300013296 | Ga0157374_10185267 | Ga0157374_101852672 | 195 |
| 6 | 3300031824 | Ga0307413_10172726 | Ga0307413_101727262 | 196 |
| 7 | 3300005339 | Ga0070660_100438343 | Ga0070660_1004383432 | 198 |
| 8 | 3300005341 | Ga0070691_10037141 | Ga0070691_100371414 | 198 |
| 9 | 3300005344 | Ga0070661_100007670 | Ga0070661_10000767010 | 198 |
| 10 | 3300005366 | Ga0070659_100242241 | Ga0070659_1002422412 | 198 |
| 11 | 3300005435 | Ga0070714_100145189 | Ga0070714_1001451891 | 198 |
| 12 | 3300005546 | Ga0070696_100041503 | Ga0070696_1000415033 | 198 |
| 13 | 3300005563 | Ga0068855_100548618 | Ga0068855_1005486182 | 198 |
| 14 | 3300009551 | Ga0105238_10103026 | Ga0105238_101030264 | 198 |
| 15 | 3300010375 | Ga0105239_10604538 | Ga0105239_106045382 | 198 |
| 16 | 3300020069 | Ga0197907_10335094 | Ga0197907_103350942 | 198 |
| 17 | 3300020082 | Ga0206353_11787594 | Ga0206353_117875942 | 198 |
| 18 | 3300025912 | Ga0207707_10018744 | Ga0207707_100187442 | 198 |
| 19 | 3300025913 | Ga0207695_10025723 | Ga0207695_100257232 | 198 |
| 20 | 3300025919 | Ga0207657_10366525 | Ga0207657_103665252 | 198 |
| 21 | 3300025924 | Ga0207694_10344769 | Ga0207694_103447692 | 198 |
| 22 | 3300025929 | Ga0207664_10047944 | Ga0207664_100479443 | 198 |
| 23 | 3300025932 | Ga0207690_10128083 | Ga0207690_101280832 | 198 |
| 24 | 3300026116 | Ga0207674_10258040 | Ga0207674_102580402 | 198 |
| 25 | 3300005445 | Ga0070708_100053005 | Ga0070708_1000530051 | 199 |
| 26 | 3300005471 | Ga0070698_100366715 | Ga0070698_1003667151 | 199 |
| 27 | 3300005518 | Ga0070699_100072998 | Ga0070699_1000729984 | 199 |
| 28 | 3300031995 | Ga0307409_100193344 | Ga0307409_1001933442 | 200 |
| 29 | 3300032004 | Ga0307414_10040187 | Ga0307414_100401873 | 200 |
| 30 | 3300031548 | Ga0307408_100539281 | Ga0307408_1005392812 | 201 |
| 31 | 3300031852 | Ga0307410_10388473 | Ga0307410_103884731 | 201 |
| 32 | 3300032002 | Ga0307416_100223354 | Ga0307416_1002233542 | 201 |
| 33 | 3300032126 | Ga0307415_100404202 | Ga0307415_1004042022 | 201 |
| 34 | 3300044684 | Ga0466966_0040865 | Ga0466966_0040865_835_1542 | 201 |
| 35 | 3300013297 | Ga0157378_11330383 | Ga0157378_113303831 | 203 |
| 36 | 3300005356 | Ga0070674_100289519 | Ga0070674_1002895192 | 204 |
| 37 | 3300005530 | Ga0070679_100508437 | Ga0070679_1005084372 | 204 |
| 38 | 3300013308 | Ga0157375_10119586 | Ga0157375_101195862 | 204 |
| 39 | 3300025899 | Ga0207642_10056912 | Ga0207642_100569122 | 204 |
| 40 | 3300025934 | Ga0207686_10413521 | Ga0207686_104135212 | 204 |
| 41 | 3300025935 | Ga0207709_10240990 | Ga0207709_102409902 | 204 |
| 42 | 3300025972 | Ga0207668_10076501 | Ga0207668_100765013 | 204 |
| 43 | 3300028381 | Ga0268264_10151295 | Ga0268264_101512954 | 204 |
| 44 | 3300009553 | Ga0105249_11495754 | Ga0105249_114957541 | 205 |
| 45 | 3300014326 | Ga0157380_10737438 | Ga0157380_107374382 | 205 |
| 46 | 3300031903 | Ga0307407_10538400 | Ga0307407_105384002 | 205 |
| 47 | 3300048904 | Ga0496101_0237795 | Ga0496101_0237795_38_742 | 205 |
| 48 | 3300005329 | Ga0070683_100029411 | Ga0070683_1000294115 | 206 |
| 49 | 3300005355 | Ga0070671_100037473 | Ga0070671_1000374734 | 206 |
| 50 | 3300005367 | Ga0070667_100246733 | Ga0070667_1002467332 | 206 |
| 51 | 3300005547 | Ga0070693_100476915 | Ga0070693_1004769152 | 206 |
| 52 | 3300006844 | Ga0075428_100664478 | Ga0075428_1006644782 | 206 |
| 53 | 3300009094 | Ga0111539_10704607 | Ga0111539_107046072 | 206 |
| 54 | 3300013308 | Ga0157375_10234100 | Ga0157375_102341002 | 206 |
| 55 | 3300014968 | Ga0157379_10572962 | Ga0157379_105729622 | 206 |
| 56 | 3300025940 | Ga0207691_10137936 | Ga0207691_101379362 | 206 |
| 57 | 3300025944 | Ga0207661_10101491 | Ga0207661_101014914 | 206 |
| 58 | 3300026035 | Ga0207703_10210003 | Ga0207703_102100032 | 206 |
| 59 | 3300026067 | Ga0207678_10312601 | Ga0207678_103126012 | 206 |
| 60 | 3300036401 | Ga0373937_0115090 | Ga0373937_0115090_396_1067 | 206 |
| 61 | 3300047317 | Ga0495604_0197966 | Ga0495604_0197966_594_1265 | 206 |
| 62 | 3300047444 | Ga0495675_0072066 | Ga0495675_0072066_614_1285 | 206 |
| 63 | 3300048903 | Ga0496100_0188683 | Ga0496100_0188683_141_812 | 206 |
| 64 | 3300048907 | Ga0496104_0581735 | Ga0496104_0581735_292_996 | 206 |
| 65 | 3300048908 | Ga0496105_0104039 | Ga0496105_0104039_1583_2254 | 206 |
| 66 | 3300048909 | Ga0496106_0163619 | Ga0496106_0163619_310_981 | 206 |
| 67 | 3300048910 | Ga0496107_0036151 | Ga0496107_0036151_2735_3406 | 206 |
| 68 | 3300048911 | Ga0496108_0164690 | Ga0496108_0164690_948_1652 | 206 |
| 69 | 3300005458 | Ga0070681_10016025 | Ga0070681_100160256 | 207 |
| 70 | 3300005530 | Ga0070679_100001679 | Ga0070679_10000167914 | 207 |
| 71 | 3300005614 | Ga0068856_100257352 | Ga0068856_1002573522 | 207 |
| 72 | 3300006914 | Ga0075436_100104820 | Ga0075436_1001048202 | 207 |
| 73 | 3300009093 | Ga0105240_10002404 | Ga0105240_1000240414 | 207 |
| 74 | 3300013104 | Ga0157370_10004399 | Ga0157370_1000439911 | 207 |
| 75 | 3300013104 | Ga0157370_10209269 | Ga0157370_102092693 | 207 |
| 76 | 3300013307 | Ga0157372_10103477 | Ga0157372_101034771 | 207 |
| 77 | 3300013307 | Ga0157372_10448099 | Ga0157372_104480992 | 207 |
| 78 | 3300025912 | Ga0207707_10002022 | Ga0207707_100020227 | 207 |
| 79 | 3300025913 | Ga0207695_10014926 | Ga0207695_100149264 | 207 |
| 80 | 3300025949 | Ga0207667_10947140 | Ga0207667_109471401 | 207 |
| 81 | 3300026078 | Ga0207702_10071173 | Ga0207702_100711733 | 207 |
| 82 | 3300050514 | nmdc:mga08x19_5485_c1 | nmdc:mga08x19_5485_c1_5197_5883 | 207 |
| 83 | 3300005439 | Ga0070711_100139992 | Ga0070711_1001399922 | 208 |
| 84 | 3300009545 | Ga0105237_10908706 | Ga0105237_109087062 | 208 |
| 85 | 3300021384 | Ga0213876_10026623 | Ga0213876_100266232 | 208 |
| 86 | 3300025916 | Ga0207663_10307051 | Ga0207663_103070512 | 208 |
| 87 | 3300039437 | Ga0436365_0041325 | Ga0436365_0041325_863_1555 | 208 |
| 88 | 3300005333 | Ga0070677_10152472 | Ga0070677_101524722 | 209 |
| 89 | 3300005614 | Ga0068856_100704776 | Ga0068856_1007047762 | 209 |
| 90 | 3300014326 | Ga0157380_10393769 | Ga0157380_103937692 | 209 |
| 91 | 3300026078 | Ga0207702_10383544 | Ga0207702_103835441 | 209 |
| 92 | 3300045836 | Ga0466958_0359280 | Ga0466958_0359280_148_831 | 209 |
| 93 | 3300005290 | Ga0065712_10082566 | Ga0065712_100825662 | 210 |
| 94 | 3300005329 | Ga0070683_100252583 | Ga0070683_1002525832 | 210 |
| 95 | 3300005330 | Ga0070690_100014309 | Ga0070690_1000143094 | 210 |
| 96 | 3300005331 | Ga0070670_100088295 | Ga0070670_1000882953 | 210 |
| 97 | 3300005338 | Ga0068868_100559362 | Ga0068868_1005593621 | 210 |
| 98 | 3300005354 | Ga0070675_100024357 | Ga0070675_1000243575 | 210 |
| 99 | 3300005355 | Ga0070671_100052254 | Ga0070671_1000522543 | 210 |
| 100 | 3300005365 | Ga0070688_100005628 | Ga0070688_1000056283 | 210 |
| 101 | 3300005367 | Ga0070667_100792639 | Ga0070667_1007926392 | 210 |
| 102 | 3300005543 | Ga0070672_100075885 | Ga0070672_1000758851 | 210 |
| 103 | 3300005563 | Ga0068855_100258194 | Ga0068855_1002581942 | 210 |
| 104 | 3300005564 | Ga0070664_100297289 | Ga0070664_1002972892 | 210 |
| 105 | 3300005577 | Ga0068857_100459257 | Ga0068857_1004592572 | 210 |
| 106 | 3300005617 | Ga0068859_100132360 | Ga0068859_1001323603 | 210 |
| 107 | 3300005840 | Ga0068870_10073588 | Ga0068870_100735882 | 210 |
| 108 | 3300005843 | Ga0068860_100315861 | Ga0068860_1003158612 | 210 |
| 109 | 3300005844 | Ga0068862_100179745 | Ga0068862_1001797452 | 210 |
| 110 | 3300006931 | Ga0097620_100132352 | Ga0097620_1001323523 | 210 |
| 111 | 3300009174 | Ga0105241_10002439 | Ga0105241_100024393 | 210 |
| 112 | 3300011119 | Ga0105246_10622876 | Ga0105246_106228762 | 210 |
| 113 | 3300011119 | Ga0105246_10903564 | Ga0105246_109035641 | 210 |
| 114 | 3300013105 | Ga0157369_10384223 | Ga0157369_103842232 | 210 |
| 115 | 3300013297 | Ga0157378_10356705 | Ga0157378_103567052 | 210 |
| 116 | 3300013308 | Ga0157375_10029480 | Ga0157375_100294802 | 210 |
| 117 | 3300014745 | Ga0157377_10058658 | Ga0157377_100586582 | 210 |
| 118 | 3300025901 | Ga0207688_10163360 | Ga0207688_101633602 | 210 |
| 119 | 3300025908 | Ga0207643_10052595 | Ga0207643_100525952 | 210 |
| 120 | 3300025911 | Ga0207654_10017982 | Ga0207654_100179824 | 210 |
| 121 | 3300025919 | Ga0207657_10106432 | Ga0207657_101064324 | 210 |
| 122 | 3300025926 | Ga0207659_10071449 | Ga0207659_100714492 | 210 |
| 123 | 3300025931 | Ga0207644_10062127 | Ga0207644_100621272 | 210 |
| 124 | 3300025940 | Ga0207691_10016949 | Ga0207691_100169495 | 210 |
| 125 | 3300025944 | Ga0207661_10306640 | Ga0207661_103066402 | 210 |
| 126 | 3300025949 | Ga0207667_10269677 | Ga0207667_102696772 | 210 |
| 127 | 3300025960 | Ga0207651_10025149 | Ga0207651_100251494 | 210 |
| 128 | 3300025986 | Ga0207658_10076242 | Ga0207658_100762423 | 210 |
| 129 | 3300026116 | Ga0207674_10066327 | Ga0207674_100663272 | 210 |
| 130 | 3300028380 | Ga0268265_10199146 | Ga0268265_101991462 | 210 |
| 131 | 3300035086 | Ga0373934_0000064 | Ga0373934_0000064_30587_31270 | 210 |
| 132 | 3300035111 | Ga0373923_0019296 | Ga0373923_0019296_1080_1763 | 210 |
| 133 | 3300035117 | Ga0373953_0001938 | Ga0373953_0001938_2203_2886 | 210 |
| 134 | 3300035119 | Ga0373956_0000381 | Ga0373956_0000381_9824_10507 | 210 |
| 135 | 3300035120 | Ga0373957_0031354 | Ga0373957_0031354_628_1311 | 210 |
| 136 | 3300035172 | Ga0373955_0000995 | Ga0373955_0000995_11060_11743 | 210 |
| 137 | 3300035410 | Ga0373924_0042853 | Ga0373924_0042853_795_1478 | 210 |
| 138 | 3300035724 | Ga0373933_0001064 | Ga0373933_0001064_15240_15923 | 210 |
| 139 | 3300036401 | Ga0373937_0000558 | Ga0373937_0000558_32179_32862 | 210 |
| 140 | 3300046454 | Ga0495592_0000897 | Ga0495592_0000897_2374_3057 | 210 |
| 141 | 3300046459 | Ga0495629_0023944 | Ga0495629_0023944_3545_4228 | 210 |
| 142 | 3300046462 | Ga0495651_0000171 | Ga0495651_0000171_10021_10704 | 210 |
| 143 | 3300046463 | Ga0495653_0000065 | Ga0495653_0000065_57978_58661 | 210 |
| 144 | 3300046500 | Ga0495596_0117237 | Ga0495596_0117237_97_786 | 210 |
| 145 | 3300046511 | Ga0495608_0002630 | Ga0495608_0002630_5844_6527 | 210 |
| 146 | 3300046516 | Ga0495628_0010298 | Ga0495628_0010298_4923_5606 | 210 |
| 147 | 3300046517 | Ga0495630_0007885 | Ga0495630_0007885_3112_3795 | 210 |
| 148 | 3300046529 | Ga0495652_0001144 | Ga0495652_0001144_6669_7352 | 210 |
| 149 | 3300046535 | Ga0495586_0037632 | Ga0495586_0037632_1452_2135 | 210 |
| 150 | 3300046536 | Ga0495587_0000721 | Ga0495587_0000721_6513_7196 | 210 |
| 151 | 3300046543 | Ga0495645_0000616 | Ga0495645_0000616_13664_14347 | 210 |
| 152 | 3300046559 | Ga0495667_0001871 | Ga0495667_0001871_10472_11155 | 210 |
| 153 | 3300046663 | Ga0495635_0000248 | Ga0495635_0000248_17751_18434 | 210 |
| 154 | 3300046675 | Ga0495657_0002731 | Ga0495657_0002731_7518_8201 | 210 |
| 155 | 3300046678 | Ga0495599_0003594 | Ga0495599_0003594_514_1197 | 210 |
| 156 | 3300046679 | Ga0495623_0000399 | Ga0495623_0000399_5766_6449 | 210 |
| 157 | 3300046680 | Ga0495646_0091400 | Ga0495646_0091400_653_1336 | 210 |
| 158 | 3300046689 | Ga0495613_0085543 | Ga0495613_0085543_1533_2216 | 210 |
| 159 | 3300046809 | Ga0495600_0002017 | Ga0495600_0002017_6669_7352 | 210 |
| 160 | 3300047317 | Ga0495604_0000579 | Ga0495604_0000579_18032_18715 | 210 |
| 161 | 3300047319 | Ga0495674_0003646 | Ga0495674_0003646_6643_7326 | 210 |
| 162 | 3300047322 | Ga0495680_0002958 | Ga0495680_0002958_751_1434 | 210 |
| 163 | 3300047444 | Ga0495675_0000773 | Ga0495675_0000773_279_962 | 210 |
| 164 | 3300047471 | Ga0495684_0000049 | Ga0495684_0000049_50942_51625 | 210 |
| 165 | 3300047673 | Ga0495593_0123894 | Ga0495593_0123894_315_998 | 210 |
| 166 | 3300048088 | Ga0495602_0023387 | Ga0495602_0023387_2015_2698 | 210 |
| 167 | 3300053077 | Ga0495601_0006363 | Ga0495601_0006363_5652_6335 | 210 |
| 168 | 3300053084 | Ga0495595_0076278 | Ga0495595_0076278_187_870 | 210 |
| 169 | 3300053085 | Ga0495619_0002387 | Ga0495619_0002387_3635_4318 | 210 |
| 170 | 3300005353 | Ga0070669_100463277 | Ga0070669_1004632771 | 211 |
| 171 | 3300013308 | Ga0157375_10084945 | Ga0157375_100849454 | 211 |
| 172 | 3300041512 | Ga0451853_1717090 | Ga0451853_1717090_223_903 | 211 |
| 173 | 3300005530 | Ga0070679_100089657 | Ga0070679_1000896572 | 212 |
| 174 | 3300005546 | Ga0070696_100002712 | Ga0070696_1000027129 | 212 |
| 175 | 3300005547 | Ga0070693_100000716 | Ga0070693_1000007163 | 212 |
| 176 | 3300025921 | Ga0207652_10200744 | Ga0207652_102007442 | 212 |
| 177 | 3300031852 | Ga0307410_10165596 | Ga0307410_101655962 | 212 |
| 178 | 3300032002 | Ga0307416_100844306 | Ga0307416_1008443062 | 212 |
| 179 | 3300032126 | Ga0307415_100026149 | Ga0307415_1000261494 | 212 |
| 180 | 3300005330 | Ga0070690_100126557 | Ga0070690_1001265572 | 213 |
| 181 | 3300005468 | Ga0070707_100265640 | Ga0070707_1002656402 | 213 |
| 182 | 3300005336 | Ga0070680_100000187 | Ga0070680_10000018733 | 214 |
| 183 | 3300005458 | Ga0070681_10034983 | Ga0070681_100349832 | 214 |
| 184 | 3300005530 | Ga0070679_100003788 | Ga0070679_1000037887 | 214 |
| 185 | 3300005535 | Ga0070684_100046228 | Ga0070684_1000462283 | 214 |
| 186 | 3300013104 | Ga0157370_10000540 | Ga0157370_1000054035 | 214 |
| 187 | 3300013105 | Ga0157369_10015801 | Ga0157369_100158012 | 214 |
| 188 | 3300025917 | Ga0207660_10011949 | Ga0207660_100119493 | 214 |
| 189 | 3300025921 | Ga0207652_10012829 | Ga0207652_100128295 | 214 |
| 190 | 3300025949 | Ga0207667_10046369 | Ga0207667_100463694 | 214 |
| 191 | 3300005467 | Ga0070706_100525910 | Ga0070706_1005259102 | 215 |
| 192 | 3300005468 | Ga0070707_100021715 | Ga0070707_1000217155 | 215 |
| 193 | 3300005840 | Ga0068870_10338599 | Ga0068870_103385992 | 215 |
| 194 | 3300025910 | Ga0207684_10451994 | Ga0207684_104519942 | 215 |
| 195 | 3300025940 | Ga0207691_10014209 | Ga0207691_100142096 | 215 |
| 196 | 3300049586 | Ga0501070_0659329 | Ga0501070_0659329_60_746 | 215 |
| 197 | 3300005444 | Ga0070694_100063519 | Ga0070694_1000635193 | 216 |
| 198 | 3300013100 | Ga0157373_10208247 | Ga0157373_102082472 | 216 |
| 199 | 3300013297 | Ga0157378_10026888 | Ga0157378_100268886 | 216 |
| 200 | 3300031852 | Ga0307410_10266664 | Ga0307410_102666642 | 216 |
| 201 | 3300007076 | Ga0075435_100156648 | Ga0075435_1001566483 | 217 |
| 202 | 3300009093 | Ga0105240_10007054 | Ga0105240_1000705417 | 217 |
| 203 | 3300013104 | Ga0157370_10125431 | Ga0157370_101254312 | 217 |
| 204 | 3300013307 | Ga0157372_10041502 | Ga0157372_100415024 | 217 |
| 205 | 3300025913 | Ga0207695_10002822 | Ga0207695_1000282229 | 217 |
| 206 | 3300025949 | Ga0207667_10645184 | Ga0207667_106451842 | 217 |
| 207 | 3300005330 | Ga0070690_100028789 | Ga0070690_1000287892 | 218 |
| 208 | 3300005355 | Ga0070671_100014627 | Ga0070671_1000146272 | 218 |
| 209 | 3300025931 | Ga0207644_10026125 | Ga0207644_100261253 | 218 |
| 210 | 3300013104 | Ga0157370_10307768 | Ga0157370_103077682 | 219 |
| 211 | 3300005937 | Ga0081455_10041058 | Ga0081455_100410584 | 222 |
| 212 | 3300026095 | Ga0207676_10256433 | Ga0207676_102564332 | 222 |
| 213 | 3300032002 | Ga0307416_100287224 | Ga0307416_1002872242 | 222 |
| 214 | 3300035241 | Ga0373961_0025819 | Ga0373961_0025819_344_1012 | 222 |
| 215 | 3300037312 | Ga0395899_0106317 | Ga0395899_0106317_109_792 | 222 |
| 216 | 3300037466 | Ga0395898_0126652 | Ga0395898_0126652_922_1605 | 222 |
| 217 | 3300037471 | Ga0395905_0004795 | Ga0395905_0004795_8866_9549 | 222 |
| 218 | 3300038443 | Ga0395901_0005991 | Ga0395901_0005991_8899_9582 | 222 |
| 219 | 3300045976 | Ga0466967_0027120 | Ga0466967_0027120_328_996 | 222 |
| 220 | 3300046559 | Ga0495667_0026907 | Ga0495667_0026907_2733_3401 | 222 |
| 221 | 3300047320 | Ga0495672_0005150 | Ga0495672_0005150_9015_9683 | 222 |
| 222 | 3300049760 | Ga0501263_000169 | Ga0501263_000169_790_1467 | 222 |
| 223 | 2162886012 | MBSR1b_contig_4672892 | MBSR1b_0064.00002850 | 223 |
| 224 | 3300005293 | Ga0065715_10093395 | Ga0065715_100933954 | 223 |
| 225 | 3300005327 | Ga0070658_10001684 | Ga0070658_100016849 | 223 |
| 226 | 3300005327 | Ga0070658_10005474 | Ga0070658_100054742 | 223 |
| 227 | 3300005327 | Ga0070658_10118904 | Ga0070658_101189042 | 223 |
| 228 | 3300005327 | Ga0070658_10128251 | Ga0070658_101282512 | 223 |
| 229 | 3300005329 | Ga0070683_100006630 | Ga0070683_1000066308 | 223 |
| 230 | 3300005329 | Ga0070683_100015822 | Ga0070683_1000158226 | 223 |
| 231 | 3300005329 | Ga0070683_100021358 | Ga0070683_1000213584 | 223 |
| 232 | 3300005329 | Ga0070683_100023805 | Ga0070683_1000238056 | 223 |
| 233 | 3300005329 | Ga0070683_100037963 | Ga0070683_1000379634 | 223 |
| 234 | 3300005329 | Ga0070683_100045724 | Ga0070683_1000457244 | 223 |
| 235 | 3300005329 | Ga0070683_100091934 | Ga0070683_1000919342 | 223 |
| 236 | 3300005329 | Ga0070683_100130762 | Ga0070683_1001307622 | 223 |
| 237 | 3300005329 | Ga0070683_100178090 | Ga0070683_1001780902 | 223 |
| 238 | 3300005329 | Ga0070683_100188530 | Ga0070683_1001885302 | 223 |
| 239 | 3300005330 | Ga0070690_100102149 | Ga0070690_1001021493 | 223 |
| 240 | 3300005334 | Ga0068869_100135235 | Ga0068869_1001352353 | 223 |
| 241 | 3300005336 | Ga0070680_100000740 | Ga0070680_10000074020 | 223 |
| 242 | 3300005336 | Ga0070680_100002251 | Ga0070680_1000022517 | 223 |
| 243 | 3300005336 | Ga0070680_100010964 | Ga0070680_1000109643 | 223 |
| 244 | 3300005336 | Ga0070680_100054279 | Ga0070680_1000542792 | 223 |
| 245 | 3300005336 | Ga0070680_100210191 | Ga0070680_1002101912 | 223 |
| 246 | 3300005336 | Ga0070680_100225977 | Ga0070680_1002259772 | 223 |
| 247 | 3300005337 | Ga0070682_100089269 | Ga0070682_1000892691 | 223 |
| 248 | 3300005337 | Ga0070682_100173712 | Ga0070682_1001737122 | 223 |
| 249 | 3300005338 | Ga0068868_100013966 | Ga0068868_1000139665 | 223 |
| 250 | 3300005338 | Ga0068868_100056027 | Ga0068868_1000560274 | 223 |
| 251 | 3300005339 | Ga0070660_100016690 | Ga0070660_1000166904 | 223 |
| 252 | 3300005339 | Ga0070660_100080282 | Ga0070660_1000802824 | 223 |
| 253 | 3300005340 | Ga0070689_100056549 | Ga0070689_1000565493 | 223 |
| 254 | 3300005341 | Ga0070691_10004179 | Ga0070691_100041793 | 223 |
| 255 | 3300005341 | Ga0070691_10010004 | Ga0070691_100100043 | 223 |
| 256 | 3300005343 | Ga0070687_100022622 | Ga0070687_1000226222 | 223 |
| 257 | 3300005344 | Ga0070661_100049184 | Ga0070661_1000491845 | 223 |
| 258 | 3300005344 | Ga0070661_100057094 | Ga0070661_1000570942 | 223 |
| 259 | 3300005345 | Ga0070692_10148848 | Ga0070692_101488482 | 223 |
| 260 | 3300005347 | Ga0070668_100268726 | Ga0070668_1002687262 | 223 |
| 261 | 3300005354 | Ga0070675_100525993 | Ga0070675_1005259931 | 223 |
| 262 | 3300005364 | Ga0070673_100068503 | Ga0070673_1000685033 | 223 |
| 263 | 3300005365 | Ga0070688_100090788 | Ga0070688_1000907882 | 223 |
| 264 | 3300005366 | Ga0070659_100165992 | Ga0070659_1001659922 | 223 |
| 265 | 3300005367 | Ga0070667_100082900 | Ga0070667_1000829003 | 223 |
| 266 | 3300005434 | Ga0070709_10503685 | Ga0070709_105036852 | 223 |
| 267 | 3300005436 | Ga0070713_100012772 | Ga0070713_1000127727 | 223 |
| 268 | 3300005438 | Ga0070701_10055034 | Ga0070701_100550342 | 223 |
| 269 | 3300005439 | Ga0070711_100047808 | Ga0070711_1000478083 | 223 |
| 270 | 3300005444 | Ga0070694_100068455 | Ga0070694_1000684552 | 223 |
| 271 | 3300005444 | Ga0070694_100214476 | Ga0070694_1002144762 | 223 |
| 272 | 3300005445 | Ga0070708_100000089 | Ga0070708_10000008921 | 223 |
| 273 | 3300005445 | Ga0070708_100004987 | Ga0070708_1000049872 | 223 |
| 274 | 3300005455 | Ga0070663_100064728 | Ga0070663_1000647282 | 223 |
| 275 | 3300005456 | Ga0070678_100541771 | Ga0070678_1005417712 | 223 |
| 276 | 3300005457 | Ga0070662_100296759 | Ga0070662_1002967592 | 223 |
| 277 | 3300005458 | Ga0070681_10005730 | Ga0070681_1000573011 | 223 |
| 278 | 3300005458 | Ga0070681_10006463 | Ga0070681_100064633 | 223 |
| 279 | 3300005458 | Ga0070681_10067660 | Ga0070681_100676601 | 223 |
| 280 | 3300005458 | Ga0070681_10174531 | Ga0070681_101745312 | 223 |
| 281 | 3300005458 | Ga0070681_10291638 | Ga0070681_102916381 | 223 |
| 282 | 3300005458 | Ga0070681_10483622 | Ga0070681_104836222 | 223 |
| 283 | 3300005466 | Ga0070685_10070273 | Ga0070685_100702732 | 223 |
| 284 | 3300005468 | Ga0070707_100038876 | Ga0070707_1000388765 | 223 |
| 285 | 3300005468 | Ga0070707_100057738 | Ga0070707_1000577383 | 223 |
| 286 | 3300005471 | Ga0070698_100167902 | Ga0070698_1001679022 | 223 |
| 287 | 3300005471 | Ga0070698_100829293 | Ga0070698_1008292931 | 223 |
| 288 | 3300005518 | Ga0070699_100084762 | Ga0070699_1000847624 | 223 |
| 289 | 3300005530 | Ga0070679_100002452 | Ga0070679_10000245217 | 223 |
| 290 | 3300005530 | Ga0070679_100005794 | Ga0070679_1000057943 | 223 |
| 291 | 3300005530 | Ga0070679_100016947 | Ga0070679_1000169478 | 223 |
| 292 | 3300005530 | Ga0070679_100033701 | Ga0070679_1000337013 | 223 |
| 293 | 3300005530 | Ga0070679_100065523 | Ga0070679_1000655231 | 223 |
| 294 | 3300005530 | Ga0070679_100111942 | Ga0070679_1001119423 | 223 |
| 295 | 3300005530 | Ga0070679_100170635 | Ga0070679_1001706352 | 223 |
| 296 | 3300005530 | Ga0070679_100171017 | Ga0070679_1001710174 | 223 |
| 297 | 3300005530 | Ga0070679_100508197 | Ga0070679_1005081972 | 223 |
| 298 | 3300005535 | Ga0070684_100000778 | Ga0070684_10000077825 | 223 |
| 299 | 3300005535 | Ga0070684_100008531 | Ga0070684_1000085312 | 223 |
| 300 | 3300005535 | Ga0070684_100028726 | Ga0070684_1000287265 | 223 |
| 301 | 3300005535 | Ga0070684_100043276 | Ga0070684_1000432762 | 223 |
| 302 | 3300005535 | Ga0070684_100069207 | Ga0070684_1000692073 | 223 |
| 303 | 3300005535 | Ga0070684_100170208 | Ga0070684_1001702082 | 223 |
| 304 | 3300005535 | Ga0070684_100207883 | Ga0070684_1002078833 | 223 |
| 305 | 3300005535 | Ga0070684_100341923 | Ga0070684_1003419232 | 223 |
| 306 | 3300005536 | Ga0070697_100138475 | Ga0070697_1001384752 | 223 |
| 307 | 3300005545 | Ga0070695_100436880 | Ga0070695_1004368802 | 223 |
| 308 | 3300005546 | Ga0070696_100100787 | Ga0070696_1001007873 | 223 |
| 309 | 3300005546 | Ga0070696_100180670 | Ga0070696_1001806702 | 223 |
| 310 | 3300005547 | Ga0070693_100379996 | Ga0070693_1003799962 | 223 |
| 311 | 3300005547 | Ga0070693_100482831 | Ga0070693_1004828311 | 223 |
| 312 | 3300005549 | Ga0070704_100025997 | Ga0070704_1000259973 | 223 |
| 313 | 3300005549 | Ga0070704_100123009 | Ga0070704_1001230092 | 223 |
| 314 | 3300005549 | Ga0070704_100267075 | Ga0070704_1002670752 | 223 |
| 315 | 3300005549 | Ga0070704_100667037 | Ga0070704_1006670372 | 223 |
| 316 | 3300005563 | Ga0068855_100021185 | Ga0068855_1000211854 | 223 |
| 317 | 3300005563 | Ga0068855_100332298 | Ga0068855_1003322983 | 223 |
| 318 | 3300005563 | Ga0068855_100515950 | Ga0068855_1005159502 | 223 |
| 319 | 3300005564 | Ga0070664_100092703 | Ga0070664_1000927034 | 223 |
| 320 | 3300005564 | Ga0070664_100798296 | Ga0070664_1007982962 | 223 |
| 321 | 3300005577 | Ga0068857_100073137 | Ga0068857_1000731373 | 223 |
| 322 | 3300005578 | Ga0068854_100315787 | Ga0068854_1003157872 | 223 |
| 323 | 3300005578 | Ga0068854_100393084 | Ga0068854_1003930842 | 223 |
| 324 | 3300005578 | Ga0068854_100420183 | Ga0068854_1004201832 | 223 |
| 325 | 3300005614 | Ga0068856_100054366 | Ga0068856_1000543664 | 223 |
| 326 | 3300005614 | Ga0068856_100214180 | Ga0068856_1002141803 | 223 |
| 327 | 3300005614 | Ga0068856_100248575 | Ga0068856_1002485752 | 223 |
| 328 | 3300005614 | Ga0068856_100483823 | Ga0068856_1004838232 | 223 |
| 329 | 3300005615 | Ga0070702_100179772 | Ga0070702_1001797722 | 223 |
| 330 | 3300005616 | Ga0068852_100005679 | Ga0068852_1000056797 | 223 |
| 331 | 3300005616 | Ga0068852_100035272 | Ga0068852_1000352727 | 223 |
| 332 | 3300005616 | Ga0068852_100104535 | Ga0068852_1001045353 | 223 |
| 333 | 3300005617 | Ga0068859_100085745 | Ga0068859_1000857453 | 223 |
| 334 | 3300005617 | Ga0068859_100086502 | Ga0068859_1000865022 | 223 |
| 335 | 3300005617 | Ga0068859_100191537 | Ga0068859_1001915372 | 223 |
| 336 | 3300005618 | Ga0068864_100098422 | Ga0068864_1000984222 | 223 |
| 337 | 3300006173 | Ga0070716_100081146 | Ga0070716_1000811462 | 223 |
| 338 | 3300006173 | Ga0070716_100184270 | Ga0070716_1001842702 | 223 |
| 339 | 3300006237 | Ga0097621_100215972 | Ga0097621_1002159722 | 223 |
| 340 | 3300006237 | Ga0097621_100334787 | Ga0097621_1003347872 | 223 |
| 341 | 3300006871 | Ga0075434_100033783 | Ga0075434_1000337832 | 223 |
| 342 | 3300006914 | Ga0075436_100496457 | Ga0075436_1004964572 | 223 |
| 343 | 3300006931 | Ga0097620_100085740 | Ga0097620_1000857401 | 223 |
| 344 | 3300006931 | Ga0097620_100086508 | Ga0097620_1000865082 | 223 |
| 345 | 3300006931 | Ga0097620_100191511 | Ga0097620_1001915112 | 223 |
| 346 | 3300007076 | Ga0075435_100187457 | Ga0075435_1001874573 | 223 |
| 347 | 3300009093 | Ga0105240_10035417 | Ga0105240_100354173 | 223 |
| 348 | 3300009093 | Ga0105240_10039700 | Ga0105240_100397003 | 223 |
| 349 | 3300009093 | Ga0105240_10109606 | Ga0105240_101096061 | 223 |
| 350 | 3300009093 | Ga0105240_10114766 | Ga0105240_101147664 | 223 |
| 351 | 3300009093 | Ga0105240_10290028 | Ga0105240_102900282 | 223 |
| 352 | 3300009098 | Ga0105245_10155871 | Ga0105245_101558713 | 223 |
| 353 | 3300009098 | Ga0105245_10864373 | Ga0105245_108643732 | 223 |
| 354 | 3300009147 | Ga0114129_10067730 | Ga0114129_100677302 | 223 |
| 355 | 3300009148 | Ga0105243_10110796 | Ga0105243_101107963 | 223 |
| 356 | 3300009174 | Ga0105241_10206830 | Ga0105241_102068302 | 223 |
| 357 | 3300009174 | Ga0105241_10570182 | Ga0105241_105701822 | 223 |
| 358 | 3300009176 | Ga0105242_10172514 | Ga0105242_101725141 | 223 |
| 359 | 3300009177 | Ga0105248_10219449 | Ga0105248_102194492 | 223 |
| 360 | 3300009177 | Ga0105248_11163791 | Ga0105248_111637911 | 223 |
| 361 | 3300009545 | Ga0105237_10043671 | Ga0105237_100436714 | 223 |
| 362 | 3300009551 | Ga0105238_10056905 | Ga0105238_100569055 | 223 |
| 363 | 3300009551 | Ga0105238_10424973 | Ga0105238_104249732 | 223 |
| 364 | 3300010375 | Ga0105239_10088619 | Ga0105239_100886193 | 223 |
| 365 | 3300011119 | Ga0105246_10154882 | Ga0105246_101548822 | 223 |
| 366 | 3300011119 | Ga0105246_10300626 | Ga0105246_103006262 | 223 |
| 367 | 3300013100 | Ga0157373_10060511 | Ga0157373_100605114 | 223 |
| 368 | 3300013100 | Ga0157373_10418774 | Ga0157373_104187742 | 223 |
| 369 | 3300013102 | Ga0157371_10082313 | Ga0157371_100823131 | 223 |
| 370 | 3300013102 | Ga0157371_10161941 | Ga0157371_101619412 | 223 |
| 371 | 3300013104 | Ga0157370_10003694 | Ga0157370_100036943 | 223 |
| 372 | 3300013104 | Ga0157370_10040372 | Ga0157370_100403724 | 223 |
| 373 | 3300013105 | Ga0157369_10002739 | Ga0157369_1000273918 | 223 |
| 374 | 3300013105 | Ga0157369_10083959 | Ga0157369_100839595 | 223 |
| 375 | 3300013105 | Ga0157369_10151149 | Ga0157369_101511492 | 223 |
| 376 | 3300013105 | Ga0157369_10214724 | Ga0157369_102147243 | 223 |
| 377 | 3300013105 | Ga0157369_11183013 | Ga0157369_111830131 | 223 |
| 378 | 3300013306 | Ga0163162_10069273 | Ga0163162_100692733 | 223 |
| 379 | 3300013306 | Ga0163162_10468854 | Ga0163162_104688542 | 223 |
| 380 | 3300013307 | Ga0157372_10001743 | Ga0157372_100017435 | 223 |
| 381 | 3300013307 | Ga0157372_10003651 | Ga0157372_100036513 | 223 |
| 382 | 3300013307 | Ga0157372_10007923 | Ga0157372_100079235 | 223 |
| 383 | 3300013307 | Ga0157372_10009451 | Ga0157372_1000945112 | 223 |
| 384 | 3300013307 | Ga0157372_10080645 | Ga0157372_100806453 | 223 |
| 385 | 3300013307 | Ga0157372_10104797 | Ga0157372_101047972 | 223 |
| 386 | 3300013307 | Ga0157372_10199573 | Ga0157372_101995734 | 223 |
| 387 | 3300013307 | Ga0157372_10214939 | Ga0157372_102149392 | 223 |
| 388 | 3300013307 | Ga0157372_10253381 | Ga0157372_102533814 | 223 |
| 389 | 3300013307 | Ga0157372_10369537 | Ga0157372_103695372 | 223 |
| 390 | 3300013307 | Ga0157372_10876762 | Ga0157372_108767622 | 223 |
| 391 | 3300013308 | Ga0157375_10157166 | Ga0157375_101571664 | 223 |
| 392 | 3300014745 | Ga0157377_10140413 | Ga0157377_101404132 | 223 |
| 393 | 3300014969 | Ga0157376_10056588 | Ga0157376_100565883 | 223 |
| 394 | 3300025903 | Ga0207680_10054574 | Ga0207680_100545742 | 223 |
| 395 | 3300025906 | Ga0207699_10261714 | Ga0207699_102617142 | 223 |
| 396 | 3300025907 | Ga0207645_10056374 | Ga0207645_100563743 | 223 |
| 397 | 3300025907 | Ga0207645_10349702 | Ga0207645_103497022 | 223 |
| 398 | 3300025909 | Ga0207705_10003698 | Ga0207705_100036986 | 223 |
| 399 | 3300025909 | Ga0207705_10014773 | Ga0207705_100147734 | 223 |
| 400 | 3300025909 | Ga0207705_10184728 | Ga0207705_101847282 | 223 |
| 401 | 3300025912 | Ga0207707_10011617 | Ga0207707_100116177 | 223 |
| 402 | 3300025912 | Ga0207707_10037243 | Ga0207707_100372434 | 223 |
| 403 | 3300025912 | Ga0207707_10093867 | Ga0207707_100938674 | 223 |
| 404 | 3300025912 | Ga0207707_10131280 | Ga0207707_101312803 | 223 |
| 405 | 3300025912 | Ga0207707_10198967 | Ga0207707_101989672 | 223 |
| 406 | 3300025913 | Ga0207695_10001840 | Ga0207695_1000184016 | 223 |
| 407 | 3300025913 | Ga0207695_10009902 | Ga0207695_1000990210 | 223 |
| 408 | 3300025913 | Ga0207695_10044047 | Ga0207695_100440474 | 223 |
| 409 | 3300025913 | Ga0207695_10096842 | Ga0207695_100968422 | 223 |
| 410 | 3300025913 | Ga0207695_10133735 | Ga0207695_101337353 | 223 |
| 411 | 3300025914 | Ga0207671_10045989 | Ga0207671_100459893 | 223 |
| 412 | 3300025916 | Ga0207663_10029987 | Ga0207663_100299871 | 223 |
| 413 | 3300025917 | Ga0207660_10000071 | Ga0207660_1000007144 | 223 |
| 414 | 3300025917 | Ga0207660_10009685 | Ga0207660_100096857 | 223 |
| 415 | 3300025917 | Ga0207660_10075828 | Ga0207660_100758283 | 223 |
| 416 | 3300025917 | Ga0207660_10109902 | Ga0207660_101099022 | 223 |
| 417 | 3300025917 | Ga0207660_10116611 | Ga0207660_101166113 | 223 |
| 418 | 3300025917 | Ga0207660_10503591 | Ga0207660_105035912 | 223 |
| 419 | 3300025918 | Ga0207662_10006600 | Ga0207662_100066004 | 223 |
| 420 | 3300025919 | Ga0207657_10001748 | Ga0207657_1000174814 | 223 |
| 421 | 3300025919 | Ga0207657_10002151 | Ga0207657_100021514 | 223 |
| 422 | 3300025919 | Ga0207657_10040525 | Ga0207657_100405253 | 223 |
| 423 | 3300025919 | Ga0207657_10116166 | Ga0207657_101161664 | 223 |
| 424 | 3300025920 | Ga0207649_10089241 | Ga0207649_100892413 | 223 |
| 425 | 3300025921 | Ga0207652_10009562 | Ga0207652_100095624 | 223 |
| 426 | 3300025921 | Ga0207652_10023518 | Ga0207652_100235183 | 223 |
| 427 | 3300025921 | Ga0207652_10043502 | Ga0207652_100435025 | 223 |
| 428 | 3300025921 | Ga0207652_10044813 | Ga0207652_100448133 | 223 |
| 429 | 3300025921 | Ga0207652_10049713 | Ga0207652_100497133 | 223 |
| 430 | 3300025921 | Ga0207652_10086227 | Ga0207652_100862273 | 223 |
| 431 | 3300025921 | Ga0207652_10139699 | Ga0207652_101396994 | 223 |
| 432 | 3300025921 | Ga0207652_10186696 | Ga0207652_101866963 | 223 |
| 433 | 3300025921 | Ga0207652_10263202 | Ga0207652_102632022 | 223 |
| 434 | 3300025922 | Ga0207646_10043630 | Ga0207646_100436303 | 223 |
| 435 | 3300025922 | Ga0207646_10053295 | Ga0207646_100532954 | 223 |
| 436 | 3300025924 | Ga0207694_10076618 | Ga0207694_100766183 | 223 |
| 437 | 3300025924 | Ga0207694_10548625 | Ga0207694_105486252 | 223 |
| 438 | 3300025926 | Ga0207659_10065029 | Ga0207659_100650292 | 223 |
| 439 | 3300025927 | Ga0207687_10719203 | Ga0207687_107192031 | 223 |
| 440 | 3300025927 | Ga0207687_10755258 | Ga0207687_107552582 | 223 |
| 441 | 3300025928 | Ga0207700_10089487 | Ga0207700_100894872 | 223 |
| 442 | 3300025931 | Ga0207644_10425154 | Ga0207644_104251542 | 223 |
| 443 | 3300025932 | Ga0207690_10007736 | Ga0207690_100077363 | 223 |
| 444 | 3300025932 | Ga0207690_10018034 | Ga0207690_100180344 | 223 |
| 445 | 3300025932 | Ga0207690_10208460 | Ga0207690_102084602 | 223 |
| 446 | 3300025934 | Ga0207686_10082259 | Ga0207686_100822592 | 223 |
| 447 | 3300025934 | Ga0207686_10200625 | Ga0207686_102006252 | 223 |
| 448 | 3300025936 | Ga0207670_10134305 | Ga0207670_101343052 | 223 |
| 449 | 3300025938 | Ga0207704_10070882 | Ga0207704_100708822 | 223 |
| 450 | 3300025938 | Ga0207704_10076585 | Ga0207704_100765853 | 223 |
| 451 | 3300025939 | Ga0207665_10176622 | Ga0207665_101766221 | 223 |
| 452 | 3300025941 | Ga0207711_10690198 | Ga0207711_106901982 | 223 |
| 453 | 3300025944 | Ga0207661_10000568 | Ga0207661_100005683 | 223 |
| 454 | 3300025944 | Ga0207661_10003126 | Ga0207661_100031263 | 223 |
| 455 | 3300025944 | Ga0207661_10027246 | Ga0207661_100272464 | 223 |
| 456 | 3300025944 | Ga0207661_10027612 | Ga0207661_100276123 | 223 |
| 457 | 3300025944 | Ga0207661_10069121 | Ga0207661_100691213 | 223 |
| 458 | 3300025944 | Ga0207661_10098774 | Ga0207661_100987742 | 223 |
| 459 | 3300025944 | Ga0207661_10399948 | Ga0207661_103999482 | 223 |
| 460 | 3300025945 | Ga0207679_10084762 | Ga0207679_100847623 | 223 |
| 461 | 3300025945 | Ga0207679_10199559 | Ga0207679_101995593 | 223 |
| 462 | 3300025949 | Ga0207667_10035104 | Ga0207667_100351044 | 223 |
| 463 | 3300025949 | Ga0207667_10148329 | Ga0207667_101483292 | 223 |
| 464 | 3300025972 | Ga0207668_10164258 | Ga0207668_101642582 | 223 |
| 465 | 3300025981 | Ga0207640_10005661 | Ga0207640_100056619 | 223 |
| 466 | 3300025981 | Ga0207640_10077926 | Ga0207640_100779263 | 223 |
| 467 | 3300025981 | Ga0207640_10402720 | Ga0207640_104027201 | 223 |
| 468 | 3300025986 | Ga0207658_10035986 | Ga0207658_100359863 | 223 |
| 469 | 3300025986 | Ga0207658_10049289 | Ga0207658_100492892 | 223 |
| 470 | 3300025986 | Ga0207658_10441408 | Ga0207658_104414082 | 223 |
| 471 | 3300026023 | Ga0207677_10091726 | Ga0207677_100917263 | 223 |
| 472 | 3300026035 | Ga0207703_10252347 | Ga0207703_102523472 | 223 |
| 473 | 3300026041 | Ga0207639_10043929 | Ga0207639_100439293 | 223 |
| 474 | 3300026067 | Ga0207678_10001464 | Ga0207678_100014644 | 223 |
| 475 | 3300026078 | Ga0207702_10029611 | Ga0207702_100296114 | 223 |
| 476 | 3300026078 | Ga0207702_10457222 | Ga0207702_104572222 | 223 |
| 477 | 3300026078 | Ga0207702_10653156 | Ga0207702_106531562 | 223 |
| 478 | 3300026116 | Ga0207674_10011008 | Ga0207674_100110087 | 223 |
| 479 | 3300026116 | Ga0207674_10157834 | Ga0207674_101578343 | 223 |
| 480 | 3300026116 | Ga0207674_10554171 | Ga0207674_105541712 | 223 |
| 481 | 3300026142 | Ga0207698_10018181 | Ga0207698_100181812 | 223 |
| 482 | 3300026142 | Ga0207698_10640372 | Ga0207698_106403722 | 223 |
| 483 | 3300028380 | Ga0268265_10033891 | Ga0268265_100338913 | 223 |
| 484 | 3300031548 | Ga0307408_100034305 | Ga0307408_1000343052 | 223 |
| 485 | 3300031548 | Ga0307408_100092958 | Ga0307408_1000929582 | 223 |
| 486 | 3300031731 | Ga0307405_10010758 | Ga0307405_100107583 | 223 |
| 487 | 3300031731 | Ga0307405_10018526 | Ga0307405_100185264 | 223 |
| 488 | 3300031731 | Ga0307405_10254324 | Ga0307405_102543242 | 223 |
| 489 | 3300031824 | Ga0307413_10001849 | Ga0307413_100018492 | 223 |
| 490 | 3300031824 | Ga0307413_10011843 | Ga0307413_100118433 | 223 |
| 491 | 3300031824 | Ga0307413_10024956 | Ga0307413_100249562 | 223 |
| 492 | 3300031824 | Ga0307413_10064531 | Ga0307413_100645313 | 223 |
| 493 | 3300031824 | Ga0307413_10189768 | Ga0307413_101897681 | 223 |
| 494 | 3300031852 | Ga0307410_10000503 | Ga0307410_100005036 | 223 |
| 495 | 3300031852 | Ga0307410_10012594 | Ga0307410_100125944 | 223 |
| 496 | 3300031852 | Ga0307410_10047362 | Ga0307410_100473624 | 223 |
| 497 | 3300031901 | Ga0307406_10004847 | Ga0307406_100048476 | 223 |
| 498 | 3300031901 | Ga0307406_10021374 | Ga0307406_100213741 | 223 |
| 499 | 3300031901 | Ga0307406_10077990 | Ga0307406_100779902 | 223 |
| 500 | 3300031901 | Ga0307406_10427797 | Ga0307406_104277972 | 223 |
| 501 | 3300031903 | Ga0307407_10001318 | Ga0307407_1000131810 | 223 |
| 502 | 3300031903 | Ga0307407_10006738 | Ga0307407_100067384 | 223 |
| 503 | 3300031903 | Ga0307407_10020398 | Ga0307407_100203982 | 223 |
| 504 | 3300031903 | Ga0307407_10073887 | Ga0307407_100738872 | 223 |
| 505 | 3300031903 | Ga0307407_10094472 | Ga0307407_100944722 | 223 |
| 506 | 3300031903 | Ga0307407_10263039 | Ga0307407_102630391 | 223 |
| 507 | 3300031911 | Ga0307412_10013368 | Ga0307412_100133685 | 223 |
| 508 | 3300031911 | Ga0307412_10027137 | Ga0307412_100271373 | 223 |
| 509 | 3300031911 | Ga0307412_10193637 | Ga0307412_101936371 | 223 |
| 510 | 3300031911 | Ga0307412_10430668 | Ga0307412_104306682 | 223 |
| 511 | 3300031911 | Ga0307412_10660468 | Ga0307412_106604681 | 223 |
| 512 | 3300031995 | Ga0307409_100013992 | Ga0307409_1000139925 | 223 |
| 513 | 3300031995 | Ga0307409_100071539 | Ga0307409_1000715391 | 223 |
| 514 | 3300031995 | Ga0307409_100212014 | Ga0307409_1002120142 | 223 |
| 515 | 3300031995 | Ga0307409_100560623 | Ga0307409_1005606232 | 223 |
| 516 | 3300032002 | Ga0307416_100002176 | Ga0307416_1000021761 | 223 |
| 517 | 3300032002 | Ga0307416_100003596 | Ga0307416_1000035966 | 223 |
| 518 | 3300032002 | Ga0307416_100012696 | Ga0307416_1000126967 | 223 |
| 519 | 3300032002 | Ga0307416_100058707 | Ga0307416_1000587071 | 223 |
| 520 | 3300032002 | Ga0307416_100170483 | Ga0307416_1001704832 | 223 |
| 521 | 3300032002 | Ga0307416_100444887 | Ga0307416_1004448872 | 223 |
| 522 | 3300032002 | Ga0307416_100686939 | Ga0307416_1006869391 | 223 |
| 523 | 3300032002 | Ga0307416_101142057 | Ga0307416_1011420571 | 223 |
| 524 | 3300032004 | Ga0307414_10017852 | Ga0307414_100178524 | 223 |
| 525 | 3300032004 | Ga0307414_10018267 | Ga0307414_100182673 | 223 |
| 526 | 3300032005 | Ga0307411_10037145 | Ga0307411_100371453 | 223 |
| 527 | 3300032005 | Ga0307411_10048558 | Ga0307411_100485583 | 223 |
| 528 | 3300032126 | Ga0307415_100002530 | Ga0307415_1000025308 | 223 |
| 529 | 3300032126 | Ga0307415_100014380 | Ga0307415_1000143802 | 223 |
| 530 | 3300034820 | Ga0373959_0003753 | Ga0373959_0003753_1578_2249 | 223 |
| 531 | 3300035085 | Ga0373929_0084512 | Ga0373929_0084512_17_688 | 223 |
| 532 | 3300035086 | Ga0373934_0007666 | Ga0373934_0007666_2610_3302 | 223 |
| 533 | 3300035111 | Ga0373923_0048442 | Ga0373923_0048442_722_1435 | 223 |
| 534 | 3300035115 | Ga0373941_0002720 | Ga0373941_0002720_1990_2661 | 223 |
| 535 | 3300035119 | Ga0373956_0022153 | Ga0373956_0022153_1649_2344 | 223 |
| 536 | 3300035119 | Ga0373956_0067800 | Ga0373956_0067800_696_1388 | 223 |
| 537 | 3300035120 | Ga0373957_0123513 | Ga0373957_0123513_298_993 | 223 |
| 538 | 3300035172 | Ga0373955_0005959 | Ga0373955_0005959_1636_2331 | 223 |
| 539 | 3300035691 | Ga0373931_0022133 | Ga0373931_0022133_1387_2058 | 223 |
| 540 | 3300035724 | Ga0373933_0024556 | Ga0373933_0024556_1384_2079 | 223 |
| 541 | 3300035725 | Ga0373947_0016511 | Ga0373947_0016511_2011_2706 | 223 |
| 542 | 3300035725 | Ga0373947_0097201 | Ga0373947_0097201_34_729 | 223 |
| 543 | 3300036401 | Ga0373937_0018717 | Ga0373937_0018717_3068_3763 | 223 |
| 544 | 3300036401 | Ga0373937_0051886 | Ga0373937_0051886_3049_3741 | 223 |
| 545 | 3300037068 | Ga0373925_0054882 | Ga0373925_0054882_1819_2514 | 223 |
| 546 | 3300037068 | Ga0373925_0095161 | Ga0373925_0095161_630_1322 | 223 |
| 547 | 3300039437 | Ga0436365_0931492 | Ga0436365_0931492_8043_8729 | 223 |
| 548 | 3300042015 | Ga0439462_0086906 | Ga0439462_0086906_32_718 | 223 |
| 549 | 3300044684 | Ga0466966_0045515 | Ga0466966_0045515_797_1507 | 223 |
| 550 | 3300044694 | Ga0466963_0276235 | Ga0466963_0276235_337_1020 | 223 |
| 551 | 3300044842 | Ga0466957_0279630 | Ga0466957_0279630_371_1087 | 223 |
| 552 | 3300045836 | Ga0466958_0084438 | Ga0466958_0084438_55_738 | 223 |
| 553 | 3300046454 | Ga0495592_0059623 | Ga0495592_0059623_367_1059 | 223 |
| 554 | 3300046459 | Ga0495629_0062333 | Ga0495629_0062333_601_1296 | 223 |
| 555 | 3300046460 | Ga0495638_0290598 | Ga0495638_0290598_118_807 | 223 |
| 556 | 3300046462 | Ga0495651_0102124 | Ga0495651_0102124_1117_1812 | 223 |
| 557 | 3300046472 | Ga0495580_0022995 | Ga0495580_0022995_1212_1904 | 223 |
| 558 | 3300046473 | Ga0495582_0019649 | Ga0495582_0019649_1970_2662 | 223 |
| 559 | 3300046473 | Ga0495582_0081482 | Ga0495582_0081482_1074_1769 | 223 |
| 560 | 3300046476 | Ga0495662_0192426 | Ga0495662_0192426_189_884 | 223 |
| 561 | 3300046477 | Ga0495664_0013060 | Ga0495664_0013060_529_1221 | 223 |
| 562 | 3300046477 | Ga0495664_0154740 | Ga0495664_0154740_336_1031 | 223 |
| 563 | 3300046499 | Ga0495594_0005649 | Ga0495594_0005649_489_1184 | 223 |
| 564 | 3300046499 | Ga0495594_0244070 | Ga0495594_0244070_144_836 | 223 |
| 565 | 3300046511 | Ga0495608_0070939 | Ga0495608_0070939_809_1522 | 223 |
| 566 | 3300046514 | Ga0495618_0085422 | Ga0495618_0085422_163_855 | 223 |
| 567 | 3300046516 | Ga0495628_0038398 | Ga0495628_0038398_1835_2527 | 223 |
| 568 | 3300046516 | Ga0495628_0077325 | Ga0495628_0077325_854_1549 | 223 |
| 569 | 3300046517 | Ga0495630_0003226 | Ga0495630_0003226_8776_9471 | 223 |
| 570 | 3300046517 | Ga0495630_0038958 | Ga0495630_0038958_2373_3065 | 223 |
| 571 | 3300046526 | Ga0495666_0023106 | Ga0495666_0023106_1045_1740 | 223 |
| 572 | 3300046526 | Ga0495666_0130026 | Ga0495666_0130026_447_1139 | 223 |
| 573 | 3300046529 | Ga0495652_0043468 | Ga0495652_0043468_2125_2817 | 223 |
| 574 | 3300046531 | Ga0495665_0035766 | Ga0495665_0035766_1286_1978 | 223 |
| 575 | 3300046531 | Ga0495665_0047420 | Ga0495665_0047420_1423_2118 | 223 |
| 576 | 3300046535 | Ga0495586_0042921 | Ga0495586_0042921_316_1011 | 223 |
| 577 | 3300046535 | Ga0495586_0050475 | Ga0495586_0050475_846_1541 | 223 |
| 578 | 3300046535 | Ga0495586_0138016 | Ga0495586_0138016_192_887 | 223 |
| 579 | 3300046536 | Ga0495587_0001658 | Ga0495587_0001658_6399_7094 | 223 |
| 580 | 3300046536 | Ga0495587_0001702 | Ga0495587_0001702_1616_2308 | 223 |
| 581 | 3300046543 | Ga0495645_0000127 | Ga0495645_0000127_41397_42092 | 223 |
| 582 | 3300046543 | Ga0495645_0000737 | Ga0495645_0000737_4038_4730 | 223 |
| 583 | 3300046559 | Ga0495667_0003111 | Ga0495667_0003111_5053_5766 | 223 |
| 584 | 3300046559 | Ga0495667_0117156 | Ga0495667_0117156_214_909 | 223 |
| 585 | 3300046674 | Ga0495588_0009726 | Ga0495588_0009726_2093_2788 | 223 |
| 586 | 3300046678 | Ga0495599_0004132 | Ga0495599_0004132_6518_7210 | 223 |
| 587 | 3300046680 | Ga0495646_0074190 | Ga0495646_0074190_1203_1895 | 223 |
| 588 | 3300046681 | Ga0495647_0071208 | Ga0495647_0071208_373_1068 | 223 |
| 589 | 3300046683 | Ga0495658_0361922 | Ga0495658_0361922_135_827 | 223 |
| 590 | 3300047315 | Ga0495581_0010734 | Ga0495581_0010734_1612_2307 | 223 |
| 591 | 3300047315 | Ga0495581_0141367 | Ga0495581_0141367_328_1023 | 223 |
| 592 | 3300047317 | Ga0495604_0369625 | Ga0495604_0369625_210_923 | 223 |
| 593 | 3300047319 | Ga0495674_0097179 | Ga0495674_0097179_819_1514 | 223 |
| 594 | 3300047319 | Ga0495674_0250710 | Ga0495674_0250710_687_1379 | 223 |
| 595 | 3300047322 | Ga0495680_0245353 | Ga0495680_0245353_525_1217 | 223 |
| 596 | 3300047471 | Ga0495684_0030857 | Ga0495684_0030857_3110_3802 | 223 |
| 597 | 3300047471 | Ga0495684_0234372 | Ga0495684_0234372_313_1005 | 223 |
| 598 | 3300047673 | Ga0495593_0036210 | Ga0495593_0036210_1071_1766 | 223 |
| 599 | 3300048088 | Ga0495602_0033360 | Ga0495602_0033360_3897_4589 | 223 |
| 600 | 3300048915 | Ga0496112_0014840 | Ga0496112_0014840_4002_4673 | 223 |
| 601 | 3300048915 | Ga0496112_0209941 | Ga0496112_0209941_1172_1867 | 223 |
| 602 | 3300048918 | Ga0496115_0278337 | Ga0496115_0278337_477_1166 | 223 |
| 603 | 3300049569 | Ga0501032_0209436 | Ga0501032_0209436_252_983 | 223 |
| 604 | 3300049569 | Ga0501032_0337707 | Ga0501032_0337707_255_941 | 223 |
| 605 | 3300049570 | Ga0501033_0009285 | Ga0501033_0009285_6328_7014 | 223 |
| 606 | 3300049571 | Ga0501034_0175496 | Ga0501034_0175496_141_872 | 223 |
| 607 | 3300049572 | Ga0501036_0008351 | Ga0501036_0008351_3558_4244 | 223 |
| 608 | 3300049573 | Ga0501037_0282084 | Ga0501037_0282084_50_736 | 223 |
| 609 | 3300049579 | Ga0501043_0130805 | Ga0501043_0130805_911_1606 | 223 |
| 610 | 3300049579 | Ga0501043_0617623 | Ga0501043_0617623_28_714 | 223 |
| 611 | 3300049581 | Ga0501047_0014525 | Ga0501047_0014525_6578_7264 | 223 |
| 612 | 3300049581 | Ga0501047_0119343 | Ga0501047_0119343_766_1497 | 223 |
| 613 | 3300049581 | Ga0501047_0193584 | Ga0501047_0193584_429_1115 | 223 |
| 614 | 3300049652 | Ga0501202_009468 | Ga0501202_009468_11_691 | 223 |
| 615 | 3300049668 | Ga0501233_004323 | Ga0501233_004323_184_864 | 223 |
| 616 | 3300049669 | Ga0501235_005288 | Ga0501235_005288_292_972 | 223 |
| 617 | 3300049681 | Ga0501251_020900 | Ga0501251_020900_145_825 | 223 |
| 618 | 3300049688 | Ga0501259_003055 | Ga0501259_003055_1304_1984 | 223 |
| 619 | 3300049705 | Ga0501225_0004285 | Ga0501225_0004285_1620_2300 | 223 |
| 620 | 3300049707 | Ga0501234_002527 | Ga0501234_002527_579_1259 | 223 |
| 621 | 3300049744 | Ga0501083_0372205 | Ga0501083_0372205_163_858 | 223 |
| 622 | 3300049822 | Ga0501035_0073884 | Ga0501035_0073884_588_1319 | 223 |
| 623 | 3300049822 | Ga0501035_0087228 | Ga0501035_0087228_771_1457 | 223 |
| 624 | 3300049823 | Ga0501044_0118431 | Ga0501044_0118431_1141_1827 | 223 |
| 625 | 3300049823 | Ga0501044_0131094 | Ga0501044_0131094_746_1477 | 223 |
| 626 | 3300050507 | nmdc:mga05p37_201104_c1 | nmdc:mga05p37_201104_c1_237_917 | 223 |
| 627 | 3300050512 | nmdc:mga0n895_13980_c1 | nmdc:mga0n895_13980_c1_6255_6926 | 223 |
| 628 | 3300050513 | nmdc:mga0rr50_141142_c1 | nmdc:mga0rr50_141142_c1_170_850 | 223 |
| 629 | 3300050514 | nmdc:mga08x19_359444_c1 | nmdc:mga08x19_359444_c1_309_989 | 223 |
| 630 | 3300050515 | nmdc:mga0a205_60926_c1 | nmdc:mga0a205_60926_c1_167_838 | 223 |
| 631 | 3300053077 | Ga0495601_0225256 | Ga0495601_0225256_474_1178 | 223 |
| 632 | 3300053084 | Ga0495595_0132511 | Ga0495595_0132511_187_882 | 223 |
| 633 | 3300053085 | Ga0495619_0108611 | Ga0495619_0108611_337_1029 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f02-assembly1.cif.gz_F | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.848 | 5 | 222 |
| 7vfj-assembly1.cif.gz_B | cytochrome c-type biogenesis protein ccmabcd | 0.8318 | 5 | 222 |
| 7f02-assembly1.cif.gz_F | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8236 | 5 | 222 |
| 7vfj-assembly1.cif.gz_B | cytochrome c-type biogenesis protein ccmabcd | 0.8079 | 5 | 222 |
| 8ce1-assembly1.cif.gz_B | cytochrome c maturation complex ccmabcd | 0.7938 | 5 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6799 | 52 | 215 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6545 | 52 | 218 | 3.40.1710.10 |
| af_P90947_382_500_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.5787 | 142 | 220 | 1.20.120.230 |
| af_Q96JW4_154_338_1.10.357.20 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.5411 | 15 | 185 | 1.10.357.20 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5231 | 52 | 215 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7LIW2-F1-model_v4 | Heme ABC transporter permease | 0.9743 | 2 | 223 |
GO:0005886
GO:0015232 GO:0017004 GO:1903607 |
| AF-A0A2V7M770-F1-model_v4 | Heme exporter protein B | 0.9719 | 2 | 223 |
GO:0005886
GO:0015232 GO:0017004 GO:1903607 |
| AF-A0A2G4FVT3-F1-model_v4 | Heme exporter protein B | 0.9699 | 3 | 223 |
GO:0005886
GO:0015232 GO:0017004 GO:1903607 |
| AF-A0A6J4LHY0-F1-model_v4 | Heme exporter protein B | 0.9669 | 2 | 223 |
GO:0005886
GO:0015232 GO:0017004 GO:1903607 |
| AF-A0A2V7PNX8-F1-model_v4 | Heme exporter protein B | 0.966 | 2 | 223 |
GO:0005886
GO:0015232 GO:0017004 GO:1903607 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar