F471077

General Info

Members Datasets Scaffolds Average Seq Length
633 268 633 226

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10418774|Ga0157373_104187742
Length 264
Sequence MSETTLVPPAGLEFDAPHVPGLLRATWLVARKDLAIEFRTRSAFFSAVVFALLALAIFYYAWDPTAVTATDLAPGVLWVIFTFSGLLGLHRSFGVEMSDRAIDGLLASPASREAIFLGKALANLIFVAAVQLVAIPALVLFYNLPLTSIAGPLIAIAALAAIGXXXVGTLFSAMAVNTRLAELLLPMLALPFFVPIVTAAAQATAKLLSGRPVVEISAWLKLLVAFDLVFVVACTVAFPFTVEDELVTATATERVRDVSGIVPS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
165 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4672892 2162886012 Bacteria 3150
2 Ga0065712_10082566 3300005290 Bacteria 2906
3 Ga0065715_10093395 3300005293 Bacteria 4701
4 Ga0070658_10001684 3300005327 Bacteria 18659
5 Ga0070658_10005474 3300005327 Bacteria 10300
6 Ga0070658_10118904 3300005327 Bacteria 2195
7 Ga0070658_10128251 3300005327 Bacteria 2113
8 Ga0070683_100006630 3300005329 Bacteria 9721
9 Ga0070683_100015822 3300005329 Bacteria 6633
10 Ga0070683_100021358 3300005329 Bacteria 5778
11 Ga0070683_100023805 3300005329 Bacteria 5481
12 Ga0070683_100029411 3300005329 Bacteria 4973
13 Ga0070683_100037963 3300005329 Bacteria 4412
14 Ga0070683_100045724 3300005329 Bacteria 4041
15 Ga0070683_100091934 3300005329 Bacteria 2850
16 Ga0070683_100130762 3300005329 Unclassified 2376
17 Ga0070683_100178090 3300005329 Bacteria 2018
18 Ga0070683_100188530 3300005329 Bacteria 1958
19 Ga0070683_100252583 3300005329 Unclassified 1677
20 Ga0070690_100014309 3300005330 Bacteria 4707
21 Ga0070690_100028789 3300005330 Bacteria 3442
22 Ga0070690_100102149 3300005330 Bacteria 1902
23 Ga0070690_100126557 3300005330 Unclassified 1721
24 Ga0070670_100088295 3300005331 Bacteria 2665
25 Ga0070677_10152472 3300005333 Bacteria 1077
26 Ga0068869_100135235 3300005334 Unclassified 1898
27 Ga0070680_100000187 3300005336 Bacteria 40138
28 Ga0070680_100000740 3300005336 Bacteria 22791
29 Ga0070680_100002251 3300005336 Bacteria 14251
30 Ga0070680_100010964 3300005336 Bacteria 7007
31 Ga0070680_100054279 3300005336 Bacteria 3272
32 Ga0070680_100210191 3300005336 Bacteria 1642
33 Ga0070680_100225977 3300005336 Unclassified 1580
34 Ga0070682_100089269 3300005337 Bacteria 2013
35 Ga0070682_100173712 3300005337 Unclassified 1499
36 Ga0068868_100013966 3300005338 Bacteria 5908
37 Ga0068868_100056027 3300005338 Bacteria 3112
38 Ga0068868_100559362 3300005338 Bacteria 1009
39 Ga0070660_100016690 3300005339 Bacteria 5336
40 Ga0070660_100080282 3300005339 Bacteria 2559
41 Ga0070660_100438343 3300005339 Bacteria 1083
42 Ga0070689_100056549 3300005340 Unclassified 3042
43 Ga0070691_10004179 3300005341 Bacteria 6559
44 Ga0070691_10010004 3300005341 Unclassified 4321
45 Ga0070691_10037141 3300005341 Bacteria 2298
46 Ga0070687_100022622 3300005343 Unclassified 2975
47 Ga0070661_100007670 3300005344 Bacteria 7451
48 Ga0070661_100049184 3300005344 Bacteria 3087
49 Ga0070661_100057094 3300005344 Bacteria 2861
50 Ga0070692_10148848 3300005345 Unclassified 1331
51 Ga0070668_100268726 3300005347 Unclassified 1421
52 Ga0070669_100034397 3300005353 Bacteria 3669
53 Ga0070669_100463277 3300005353 Bacteria 1046
54 Ga0070675_100024357 3300005354 Bacteria 4847
55 Ga0070675_100525993 3300005354 Unclassified 1067
56 Ga0070671_100014627 3300005355 Bacteria 6344
57 Ga0070671_100037473 3300005355 Bacteria 4021
58 Ga0070671_100052254 3300005355 Bacteria 3398
59 Ga0070674_100289519 3300005356 Bacteria 1301
60 Ga0070673_100068503 3300005364 Unclassified 2842
61 Ga0070688_100005628 3300005365 Bacteria 6612
62 Ga0070688_100090788 3300005365 Unclassified 1995
63 Ga0070659_100165992 3300005366 Bacteria 1807
64 Ga0070659_100242241 3300005366 Bacteria 1493
65 Ga0070667_100082900 3300005367 Unclassified 2746
66 Ga0070667_100246733 3300005367 Bacteria 1596
67 Ga0070667_100792639 3300005367 Unclassified 879
68 Ga0070709_10503685 3300005434 Bacteria 920
69 Ga0070714_100145189 3300005435 Bacteria 2133
70 Ga0070713_100012772 3300005436 Bacteria 6173
71 Ga0070701_10055034 3300005438 Bacteria 2077
72 Ga0070711_100047808 3300005439 Bacteria 2922
73 Ga0070711_100139992 3300005439 Bacteria 1813
74 Ga0070694_100063519 3300005444 Bacteria 2525
75 Ga0070694_100068455 3300005444 Bacteria 2440
76 Ga0070694_100214476 3300005444 Bacteria 1441
77 Ga0070708_100000089 3300005445 Bacteria 59378
78 Ga0070708_100004987 3300005445 Bacteria 10492
79 Ga0070708_100053005 3300005445 Bacteria 3598
80 Ga0070663_100064728 3300005455 Bacteria 2643
81 Ga0070678_100541771 3300005456 Unclassified 1032
82 Ga0070662_100296759 3300005457 Unclassified 1312
83 Ga0070681_10005730 3300005458 Bacteria 12008
84 Ga0070681_10006463 3300005458 Bacteria 11408
85 Ga0070681_10016025 3300005458 Bacteria 7473
86 Ga0070681_10034983 3300005458 Bacteria 5045
87 Ga0070681_10067660 3300005458 Bacteria 3539
88 Ga0070681_10174531 3300005458 Bacteria 2071
89 Ga0070681_10291638 3300005458 Bacteria 1541
90 Ga0070681_10483622 3300005458 Bacteria 1151
91 Ga0070685_10070273 3300005466 Unclassified 2072
92 Ga0070706_100525910 3300005467 Bacteria 1100
93 Ga0070707_100021715 3300005468 Bacteria 6067
94 Ga0070707_100038876 3300005468 Bacteria 4546
95 Ga0070707_100057738 3300005468 Bacteria 3723
96 Ga0070707_100265640 3300005468 Bacteria 1669
97 Ga0070698_100167902 3300005471 Bacteria 2136
98 Ga0070698_100366715 3300005471 Bacteria 1372
99 Ga0070698_100829293 3300005471 Bacteria 869
100 Ga0070699_100072998 3300005518 Bacteria 2985
101 Ga0070699_100084762 3300005518 Bacteria 2765
102 Ga0070679_100001679 3300005530 Bacteria 19948
103 Ga0070679_100002452 3300005530 Bacteria 16819
104 Ga0070679_100003788 3300005530 Bacteria 13877
105 Ga0070679_100005794 3300005530 Bacteria 11467
106 Ga0070679_100016947 3300005530 Bacteria 7042
107 Ga0070679_100033701 3300005530 Bacteria 5071
108 Ga0070679_100065523 3300005530 Bacteria 3621
109 Ga0070679_100089657 3300005530 Bacteria 3062
110 Ga0070679_100111942 3300005530 Bacteria 2716
111 Ga0070679_100170635 3300005530 Bacteria 2148
112 Ga0070679_100171017 3300005530 Unclassified 2146
113 Ga0070679_100508197 3300005530 Unclassified 1149
114 Ga0070679_100508437 3300005530 Unclassified 1149
115 Ga0070684_100000778 3300005535 Bacteria 22137
116 Ga0070684_100008531 3300005535 Bacteria 8018
117 Ga0070684_100028726 3300005535 Bacteria 4705
118 Ga0070684_100043276 3300005535 Bacteria 3888
119 Ga0070684_100046228 3300005535 Bacteria 3771
120 Ga0070684_100069207 3300005535 Bacteria 3104
121 Ga0070684_100170208 3300005535 Bacteria 1978
122 Ga0070684_100207883 3300005535 Bacteria 1784
123 Ga0070684_100341923 3300005535 Bacteria 1376
124 Ga0070697_100138475 3300005536 Bacteria 2045
125 Ga0070672_100075885 3300005543 Bacteria 2684
126 Ga0070695_100436880 3300005545 Unclassified 1000
127 Ga0070696_100002712 3300005546 Bacteria 11748
128 Ga0070696_100041503 3300005546 Bacteria 3179
129 Ga0070696_100100787 3300005546 Bacteria 2069
130 Ga0070696_100180670 3300005546 Bacteria 1565
131 Ga0070693_100000716 3300005547 Bacteria 14629
132 Ga0070693_100379996 3300005547 Bacteria 974
133 Ga0070693_100476915 3300005547 Bacteria 881
134 Ga0070693_100482831 3300005547 Bacteria 876
135 Ga0070704_100025997 3300005549 Bacteria 3861
136 Ga0070704_100123009 3300005549 Unclassified 1997
137 Ga0070704_100267075 3300005549 Bacteria 1412
138 Ga0070704_100667037 3300005549 Bacteria 919
139 Ga0068855_100021185 3300005563 Bacteria 7793
140 Ga0068855_100258194 3300005563 Bacteria 1942
141 Ga0068855_100332298 3300005563 Bacteria 1677
142 Ga0068855_100515950 3300005563 Bacteria 1297
143 Ga0068855_100548618 3300005563 Bacteria 1251
144 Ga0070664_100092703 3300005564 Bacteria 2616
145 Ga0070664_100297289 3300005564 Bacteria 1458
146 Ga0070664_100798296 3300005564 Unclassified 882
147 Ga0068857_100073137 3300005577 Bacteria 3054
148 Ga0068857_100459257 3300005577 Bacteria 1191
149 Ga0068854_100315787 3300005578 Bacteria 1268
150 Ga0068854_100393084 3300005578 Bacteria 1145
151 Ga0068854_100420183 3300005578 Unclassified 1110
152 Ga0068856_100054366 3300005614 Bacteria 3949
153 Ga0068856_100214180 3300005614 Bacteria 1942
154 Ga0068856_100248575 3300005614 Unclassified 1793
155 Ga0068856_100257352 3300005614 Bacteria 1761
156 Ga0068856_100483823 3300005614 Bacteria 1259
157 Ga0068856_100704776 3300005614 Bacteria 1030
158 Ga0070702_100179772 3300005615 Bacteria 1383
159 Ga0068852_100005679 3300005616 Bacteria 8948
160 Ga0068852_100035272 3300005616 Unclassified 4171
161 Ga0068852_100104535 3300005616 Bacteria 2563
162 Ga0068859_100085745 3300005617 Unclassified 3195
163 Ga0068859_100086502 3300005617 Unclassified 3181
164 Ga0068859_100132360 3300005617 Bacteria 2566
165 Ga0068859_100191537 3300005617 Bacteria 2129
166 Ga0068864_100098422 3300005618 Unclassified 2591
167 Ga0068870_10073588 3300005840 Bacteria 1869
168 Ga0068870_10338599 3300005840 Unclassified 961
169 Ga0068860_100315861 3300005843 Unclassified 1533
170 Ga0068862_100179745 3300005844 Bacteria 1898
171 Ga0081455_10041058 3300005937 Bacteria 4074
172 Ga0070716_100081146 3300006173 Bacteria 1936
173 Ga0070716_100184270 3300006173 Bacteria 1374
174 Ga0097621_100215972 3300006237 Bacteria 1669
175 Ga0097621_100334787 3300006237 Bacteria 1343
176 Ga0075428_100664478 3300006844 Unclassified 1111
177 Ga0075434_100033783 3300006871 Bacteria 5049
178 Ga0075436_100104820 3300006914 Bacteria 1971
179 Ga0075436_100496457 3300006914 Bacteria 892
180 Ga0097620_100085740 3300006931 Unclassified 3195
181 Ga0097620_100086508 3300006931 Unclassified 3181
182 Ga0097620_100132352 3300006931 Bacteria 2566
183 Ga0097620_100191511 3300006931 Bacteria 2129
184 Ga0075435_100156648 3300007076 Bacteria 1917
185 Ga0075435_100187457 3300007076 Unclassified 1750
186 Ga0105240_10002404 3300009093 Bacteria 30105
187 Ga0105240_10007054 3300009093 Bacteria 16382
188 Ga0105240_10035417 3300009093 Bacteria 6433
189 Ga0105240_10039700 3300009093 Bacteria 6025
190 Ga0105240_10109606 3300009093 Bacteria 3343
191 Ga0105240_10114766 3300009093 Unclassified 3253
192 Ga0105240_10290028 3300009093 Unclassified 1876
193 Ga0111539_10704607 3300009094 Unclassified 1175
194 Ga0105245_10155871 3300009098 Bacteria 2163
195 Ga0105245_10864373 3300009098 Unclassified 945
196 Ga0114129_10067730 3300009147 Bacteria 4978
197 Ga0105243_10110796 3300009148 Bacteria 2296
198 Ga0105241_10002439 3300009174 Bacteria 13950
199 Ga0105241_10206830 3300009174 Bacteria 1643
200 Ga0105241_10570182 3300009174 Bacteria 1019
201 Ga0105242_10172514 3300009176 Unclassified 1902
202 Ga0105248_10219449 3300009177 Unclassified 2141
203 Ga0105248_11163791 3300009177 Unclassified 872
204 Ga0105237_10043671 3300009545 Bacteria 4514
205 Ga0105237_10908706 3300009545 Bacteria 887
206 Ga0105238_10056905 3300009551 Unclassified 3922
207 Ga0105238_10103026 3300009551 Bacteria 2836
208 Ga0105238_10424973 3300009551 Bacteria 1324
209 Ga0105238_10831037 3300009551 Bacteria 940
210 Ga0105249_11495754 3300009553 Bacteria 747
211 Ga0105239_10088619 3300010375 Bacteria 3412
212 Ga0105239_10604538 3300010375 Bacteria 1251
213 Ga0105246_10154882 3300011119 Bacteria 1739
214 Ga0105246_10300626 3300011119 Unclassified 1295
215 Ga0105246_10622876 3300011119 Unclassified 935
216 Ga0105246_10903564 3300011119 Bacteria 792
217 Ga0157373_10060511 3300013100 Bacteria 2683
218 Ga0157373_10208247 3300013100 Bacteria 1379
219 Ga0157373_10418774 3300013100 Unclassified 961
220 Ga0157371_10082313 3300013102 Bacteria 2279
221 Ga0157371_10161941 3300013102 Bacteria 1598
222 Ga0157370_10000540 3300013104 Bacteria 47409
223 Ga0157370_10003694 3300013104 Bacteria 17883
224 Ga0157370_10004399 3300013104 Bacteria 16165
225 Ga0157370_10040372 3300013104 Bacteria 4505
226 Ga0157370_10125431 3300013104 Bacteria 2396
227 Ga0157370_10209269 3300013104 Bacteria 1808
228 Ga0157370_10307768 3300013104 Bacteria 1462
229 Ga0157369_10002739 3300013105 Bacteria 21042
230 Ga0157369_10015801 3300013105 Bacteria 8503
231 Ga0157369_10083959 3300013105 Bacteria 3405
232 Ga0157369_10151149 3300013105 Bacteria 2454
233 Ga0157369_10214724 3300013105 Bacteria 2015
234 Ga0157369_10384223 3300013105 Bacteria 1457
235 Ga0157369_11183013 3300013105 Unclassified 780
236 Ga0157374_10185267 3300013296 Bacteria 2035
237 Ga0157378_10026888 3300013297 Bacteria 5074
238 Ga0157378_10356705 3300013297 Unclassified 1430
239 Ga0157378_11330383 3300013297 Unclassified 760
240 Ga0163162_10069273 3300013306 Bacteria 3579
241 Ga0163162_10468854 3300013306 Unclassified 1391
242 Ga0157372_10001743 3300013307 Bacteria 23591
243 Ga0157372_10003651 3300013307 Bacteria 16548
244 Ga0157372_10007923 3300013307 Bacteria 11293
245 Ga0157372_10009451 3300013307 Bacteria 10373
246 Ga0157372_10041502 3300013307 Bacteria 5088
247 Ga0157372_10080645 3300013307 Bacteria 3683
248 Ga0157372_10103477 3300013307 Bacteria 3254
249 Ga0157372_10104797 3300013307 Bacteria 3234
250 Ga0157372_10199573 3300013307 Bacteria 2317
251 Ga0157372_10214939 3300013307 Bacteria 2228
252 Ga0157372_10253381 3300013307 Bacteria 2043
253 Ga0157372_10369537 3300013307 Unclassified 1671
254 Ga0157372_10448099 3300013307 Unclassified 1504
255 Ga0157372_10876762 3300013307 Unclassified 1042
256 Ga0157375_10029480 3300013308 Bacteria 5162
257 Ga0157375_10084945 3300013308 Unclassified 3215
258 Ga0157375_10119586 3300013308 Bacteria 2742
259 Ga0157375_10157166 3300013308 Unclassified 2413
260 Ga0157375_10234100 3300013308 Bacteria 1996
261 Ga0157380_10393769 3300014326 Bacteria 1312
262 Ga0157380_10737438 3300014326 Bacteria 995
263 Ga0157377_10058658 3300014745 Bacteria 2192
264 Ga0157377_10140413 3300014745 Bacteria 1484
265 Ga0157379_10572962 3300014968 Bacteria 1052
266 Ga0157376_10056588 3300014969 Bacteria 3277
267 Ga0197907_10335094 3300020069 Bacteria 1282
268 Ga0206353_11787594 3300020082 Bacteria 1440
269 Ga0213876_10026623 3300021384 Bacteria 3050
270 Ga0207682_10146308 3300025893 Bacteria 1063
271 Ga0207642_10056912 3300025899 Bacteria 1796
272 Ga0207688_10163360 3300025901 Bacteria 1321
273 Ga0207680_10054574 3300025903 Unclassified 2405
274 Ga0207699_10261714 3300025906 Bacteria 1196
275 Ga0207645_10056374 3300025907 Bacteria 2508
276 Ga0207645_10349702 3300025907 Bacteria 989
277 Ga0207643_10052595 3300025908 Bacteria 2313
278 Ga0207705_10003698 3300025909 Bacteria 11640
279 Ga0207705_10014773 3300025909 Bacteria 5614
280 Ga0207705_10184728 3300025909 Bacteria 1575
281 Ga0207684_10451994 3300025910 Bacteria 1103
282 Ga0207654_10017982 3300025911 Bacteria 3705
283 Ga0207707_10002022 3300025912 Bacteria 18412
284 Ga0207707_10011617 3300025912 Bacteria 7665
285 Ga0207707_10018744 3300025912 Bacteria 6034
286 Ga0207707_10037243 3300025912 Bacteria 4250
287 Ga0207707_10093867 3300025912 Bacteria 2621
288 Ga0207707_10131280 3300025912 Bacteria 2191
289 Ga0207707_10198967 3300025912 Bacteria 1747
290 Ga0207695_10001840 3300025913 Bacteria 33282
291 Ga0207695_10002822 3300025913 Bacteria 25243
292 Ga0207695_10009902 3300025913 Bacteria 11713
293 Ga0207695_10014926 3300025913 Bacteria 9168
294 Ga0207695_10025723 3300025913 Bacteria 6584
295 Ga0207695_10044047 3300025913 Unclassified 4750
296 Ga0207695_10096842 3300025913 Bacteria 2952
297 Ga0207695_10133735 3300025913 Unclassified 2435
298 Ga0207671_10045989 3300025914 Bacteria 3228
299 Ga0207663_10029987 3300025916 Bacteria 3203
300 Ga0207663_10307051 3300025916 Bacteria 1187
301 Ga0207660_10000071 3300025917 Bacteria 52971
302 Ga0207660_10009685 3300025917 Bacteria 6235
303 Ga0207660_10011949 3300025917 Bacteria 5668
304 Ga0207660_10075828 3300025917 Bacteria 2458
305 Ga0207660_10109902 3300025917 Bacteria 2073
306 Ga0207660_10116611 3300025917 Bacteria 2017
307 Ga0207660_10503591 3300025917 Bacteria 983
308 Ga0207662_10006600 3300025918 Bacteria 6266
309 Ga0207657_10001748 3300025919 Bacteria 23427
310 Ga0207657_10002151 3300025919 Bacteria 21361
311 Ga0207657_10040525 3300025919 Bacteria 4126
312 Ga0207657_10106432 3300025919 Bacteria 2321
313 Ga0207657_10116166 3300025919 Bacteria 2205
314 Ga0207657_10366525 3300025919 Bacteria 1135
315 Ga0207649_10089241 3300025920 Bacteria 2015
316 Ga0207652_10009562 3300025921 Bacteria 7797
317 Ga0207652_10012829 3300025921 Bacteria 6775
318 Ga0207652_10023518 3300025921 Bacteria 5105
319 Ga0207652_10043502 3300025921 Bacteria 3824
320 Ga0207652_10044813 3300025921 Bacteria 3769
321 Ga0207652_10049713 3300025921 Bacteria 3590
322 Ga0207652_10086227 3300025921 Bacteria 2753
323 Ga0207652_10139699 3300025921 Bacteria 2165
324 Ga0207652_10186696 3300025921 Bacteria 1864
325 Ga0207652_10200744 3300025921 Bacteria 1794
326 Ga0207652_10263202 3300025921 Bacteria 1556
327 Ga0207646_10043630 3300025922 Bacteria 4026
328 Ga0207646_10053295 3300025922 Bacteria 3618
329 Ga0207694_10076618 3300025924 Bacteria 2619
330 Ga0207694_10344769 3300025924 Bacteria 1232
331 Ga0207694_10548625 3300025924 Unclassified 970
332 Ga0207659_10065029 3300025926 Unclassified 2642
333 Ga0207659_10071449 3300025926 Bacteria 2534
334 Ga0207687_10719203 3300025927 Unclassified 848
335 Ga0207687_10755258 3300025927 Bacteria 828
336 Ga0207700_10089487 3300025928 Bacteria 2427
337 Ga0207664_10047944 3300025929 Bacteria 3358
338 Ga0207644_10026125 3300025931 Unclassified 4022
339 Ga0207644_10062127 3300025931 Bacteria 2708
340 Ga0207644_10425154 3300025931 Bacteria 1089
341 Ga0207690_10007736 3300025932 Bacteria 6377
342 Ga0207690_10018034 3300025932 Bacteria 4323
343 Ga0207690_10128083 3300025932 Bacteria 1854
344 Ga0207690_10208460 3300025932 Bacteria 1488
345 Ga0207686_10082259 3300025934 Bacteria 2104
346 Ga0207686_10200625 3300025934 Bacteria 1428
347 Ga0207686_10413521 3300025934 Bacteria 1030
348 Ga0207709_10240990 3300025935 Bacteria 1315
349 Ga0207670_10134305 3300025936 Unclassified 1817
350 Ga0207704_10070882 3300025938 Bacteria 2209
351 Ga0207704_10076585 3300025938 Bacteria 2144
352 Ga0207665_10176622 3300025939 Archaea 1545
353 Ga0207691_10014209 3300025940 Bacteria 7595
354 Ga0207691_10016949 3300025940 Bacteria 6913
355 Ga0207691_10137936 3300025940 Bacteria 2150
356 Ga0207711_10690198 3300025941 Unclassified 952
357 Ga0207661_10000568 3300025944 Bacteria 23560
358 Ga0207661_10003126 3300025944 Bacteria 11472
359 Ga0207661_10027246 3300025944 Bacteria 4364
360 Ga0207661_10027612 3300025944 Bacteria 4337
361 Ga0207661_10069121 3300025944 Bacteria 2878
362 Ga0207661_10098774 3300025944 Bacteria 2447
363 Ga0207661_10101491 3300025944 Bacteria 2417
364 Ga0207661_10306640 3300025944 Bacteria 1424
365 Ga0207661_10399948 3300025944 Bacteria 1245
366 Ga0207679_10084762 3300025945 Bacteria 2433
367 Ga0207679_10199559 3300025945 Bacteria 1670
368 Ga0207667_10035104 3300025949 Bacteria 5381
369 Ga0207667_10046369 3300025949 Bacteria 4602
370 Ga0207667_10148329 3300025949 Bacteria 2414
371 Ga0207667_10269677 3300025949 Bacteria 1740
372 Ga0207667_10645184 3300025949 Bacteria 1065
373 Ga0207667_10947140 3300025949 Bacteria 851
374 Ga0207651_10025149 3300025960 Bacteria 3697
375 Ga0207668_10076501 3300025972 Bacteria 2410
376 Ga0207668_10164258 3300025972 Unclassified 1734
377 Ga0207640_10005661 3300025981 Bacteria 6808
378 Ga0207640_10077926 3300025981 Bacteria 2254
379 Ga0207640_10402720 3300025981 Unclassified 1115
380 Ga0207658_10035986 3300025986 Unclassified 3549
381 Ga0207658_10049289 3300025986 Unclassified 3094
382 Ga0207658_10076242 3300025986 Bacteria 2554
383 Ga0207658_10441408 3300025986 Bacteria 1151
384 Ga0207677_10091726 3300026023 Bacteria 2210
385 Ga0207703_10210003 3300026035 Bacteria 1735
386 Ga0207703_10252347 3300026035 Unclassified 1591
387 Ga0207639_10043929 3300026041 Bacteria 3358
388 Ga0207678_10001464 3300026067 Bacteria 21663
389 Ga0207678_10312601 3300026067 Bacteria 1351
390 Ga0207702_10029611 3300026078 Bacteria 4557
391 Ga0207702_10071173 3300026078 Bacteria 2994
392 Ga0207702_10383544 3300026078 Bacteria 1352
393 Ga0207702_10457222 3300026078 Bacteria 1239
394 Ga0207702_10653156 3300026078 Unclassified 1034
395 Ga0207676_10256433 3300026095 Bacteria 1577
396 Ga0207674_10011008 3300026116 Bacteria 10173
397 Ga0207674_10066327 3300026116 Bacteria 3636
398 Ga0207674_10157834 3300026116 Bacteria 2223
399 Ga0207674_10258040 3300026116 Bacteria 1690
400 Ga0207674_10554171 3300026116 Unclassified 1110
401 Ga0207698_10018181 3300026142 Bacteria 4784
402 Ga0207698_10640372 3300026142 Bacteria 1052
403 Ga0268265_10033891 3300028380 Bacteria 3717
404 Ga0268265_10199146 3300028380 Bacteria 1736
405 Ga0268264_10151295 3300028381 Bacteria 2081
406 Ga0307408_100034305 3300031548 Bacteria 3554
407 Ga0307408_100092958 3300031548 Bacteria 2281
408 Ga0307408_100539281 3300031548 Unclassified 1028
409 Ga0307405_10010758 3300031731 Bacteria 4757
410 Ga0307405_10018526 3300031731 Bacteria 3843
411 Ga0307405_10254324 3300031731 Bacteria 1309
412 Ga0307413_10001849 3300031824 Bacteria 8336
413 Ga0307413_10011843 3300031824 Bacteria 4310
414 Ga0307413_10024956 3300031824 Bacteria 3267
415 Ga0307413_10064531 3300031824 Unclassified 2276
416 Ga0307413_10172726 3300031824 Bacteria 1532
417 Ga0307413_10189768 3300031824 Bacteria 1474
418 Ga0307410_10000503 3300031852 Bacteria 15891
419 Ga0307410_10012594 3300031852 Bacteria 4898
420 Ga0307410_10047362 3300031852 Bacteria 2873
421 Ga0307410_10165596 3300031852 Bacteria 1661
422 Ga0307410_10266664 3300031852 Bacteria 1338
423 Ga0307410_10388473 3300031852 Unclassified 1125
424 Ga0307406_10004847 3300031901 Bacteria 7329
425 Ga0307406_10021374 3300031901 Bacteria 3826
426 Ga0307406_10077990 3300031901 Bacteria 2193
427 Ga0307406_10134098 3300031901 Bacteria 1743
428 Ga0307406_10427797 3300031901 Bacteria 1056
429 Ga0307407_10001318 3300031903 Bacteria 8877
430 Ga0307407_10006738 3300031903 Bacteria 5140
431 Ga0307407_10020398 3300031903 Bacteria 3395
432 Ga0307407_10073887 3300031903 Bacteria 2039
433 Ga0307407_10094472 3300031903 Unclassified 1841
434 Ga0307407_10263039 3300031903 Bacteria 1187
435 Ga0307407_10538400 3300031903 Unclassified 861
436 Ga0307412_10013368 3300031911 Bacteria 4811
437 Ga0307412_10027137 3300031911 Bacteria 3567
438 Ga0307412_10193637 3300031911 Bacteria 1539
439 Ga0307412_10430668 3300031911 Bacteria 1081
440 Ga0307412_10660468 3300031911 Bacteria 893
441 Ga0307409_100013992 3300031995 Bacteria 5194
442 Ga0307409_100071539 3300031995 Bacteria 2758
443 Ga0307409_100193344 3300031995 Bacteria 1813
444 Ga0307409_100212014 3300031995 Bacteria 1741
445 Ga0307409_100560623 3300031995 Bacteria 1123
446 Ga0307416_100002176 3300032002 Bacteria 11111
447 Ga0307416_100003596 3300032002 Bacteria 9145
448 Ga0307416_100012696 3300032002 Bacteria 5688
449 Ga0307416_100058707 3300032002 Bacteria 3121
450 Ga0307416_100170483 3300032002 Bacteria 2025
451 Ga0307416_100223354 3300032002 Unclassified 1809
452 Ga0307416_100287224 3300032002 Bacteria 1626
453 Ga0307416_100444887 3300032002 Unclassified 1347
454 Ga0307416_100686939 3300032002 Bacteria 1111
455 Ga0307416_100844306 3300032002 Unclassified 1014
456 Ga0307416_101142057 3300032002 Bacteria 884
457 Ga0307414_10017852 3300032004 Bacteria 4352
458 Ga0307414_10018267 3300032004 Bacteria 4311
459 Ga0307414_10040187 3300032004 Bacteria 3157
460 Ga0307411_10037145 3300032005 Bacteria 3059
461 Ga0307411_10048558 3300032005 Bacteria 2751
462 Ga0307415_100002530 3300032126 Bacteria 9139
463 Ga0307415_100014380 3300032126 Bacteria 4652
464 Ga0307415_100026149 3300032126 Bacteria 3677
465 Ga0307415_100404202 3300032126 Archaea 1167
466 Ga0373959_0003753 3300034820 Unclassified 2431
467 Ga0373929_0084512 3300035085 Unclassified 778
468 Ga0373934_0000064 3300035086 Bacteria 36073
469 Ga0373934_0007666 3300035086 Bacteria 4009
470 Ga0373923_0019296 3300035111 Bacteria 2638
471 Ga0373923_0048442 3300035111 Bacteria 1774
472 Ga0373941_0002720 3300035115 Unclassified 3922
473 Ga0373953_0001938 3300035117 Bacteria 6153
474 Ga0373956_0000381 3300035119 Bacteria 18142
475 Ga0373956_0022153 3300035119 Bacteria 2716
476 Ga0373956_0067800 3300035119 Bacteria 1625
477 Ga0373957_0031354 3300035120 Bacteria 1953
478 Ga0373957_0123513 3300035120 Bacteria 1049
479 Ga0373955_0000995 3300035172 Bacteria 12012
480 Ga0373955_0005959 3300035172 Bacteria 5522
481 Ga0373961_0025819 3300035241 Bacteria 1601
482 Ga0373924_0042853 3300035410 Bacteria 1857
483 Ga0373931_0022133 3300035691 Bacteria 3196
484 Ga0373933_0001064 3300035724 Bacteria 16565
485 Ga0373933_0024556 3300035724 Bacteria 3450
486 Ga0373947_0016511 3300035725 Bacteria 4243
487 Ga0373947_0097201 3300035725 Bacteria 1845
488 Ga0373937_0000558 3300036401 Bacteria 33042
489 Ga0373937_0018717 3300036401 Bacteria 6189
490 Ga0373937_0051886 3300036401 Bacteria 3759
491 Ga0373937_0115090 3300036401 Bacteria 2504
492 Ga0373925_0054882 3300037068 Bacteria 2981
493 Ga0373925_0095161 3300037068 Bacteria 2281
494 Ga0395899_0106317 3300037312 Bacteria 2021
495 Ga0395898_0126652 3300037466 Bacteria 2447
496 Ga0395905_0004795 3300037471 Bacteria 13972
497 Ga0395901_0005991 3300038443 Bacteria 12311
498 Ga0436365_0041325 3300039437 Bacteria 5371
499 Ga0436365_0931492 3300039437 Bacteria 11326
500 Ga0451853_1717090 3300041512 Unclassified 1370
501 Ga0439462_0086906 3300042015 Bacteria 856
502 Ga0466966_0040865 3300044684 Bacteria 2982
503 Ga0466966_0045515 3300044684 Bacteria 2805
504 Ga0466963_0276235 3300044694 Unclassified 1181
505 Ga0466957_0279630 3300044842 Bacteria 1117
506 Ga0466958_0084438 3300045836 Bacteria 1958
507 Ga0466958_0359280 3300045836 Bacteria 938
508 Ga0466967_0027120 3300045976 Bacteria 4760
509 Ga0495592_0000897 3300046454 Bacteria 20636
510 Ga0495592_0059623 3300046454 Bacteria 2810
511 Ga0495629_0023944 3300046459 Bacteria 4348
512 Ga0495629_0062333 3300046459 Bacteria 2605
513 Ga0495638_0290598 3300046460 Unclassified 884
514 Ga0495651_0000171 3300046462 Bacteria 47887
515 Ga0495651_0102124 3300046462 Bacteria 2133
516 Ga0495653_0000065 3300046463 Bacteria 92073
517 Ga0495580_0022995 3300046472 Bacteria 4584
518 Ga0495582_0019649 3300046473 Bacteria 3694
519 Ga0495582_0081482 3300046473 Bacteria 1797
520 Ga0495662_0192426 3300046476 Bacteria 1006
521 Ga0495664_0013060 3300046477 Bacteria 4709
522 Ga0495664_0154740 3300046477 Bacteria 1391
523 Ga0495594_0005649 3300046499 Bacteria 6432
524 Ga0495594_0244070 3300046499 Bacteria 1023
525 Ga0495596_0117237 3300046500 Unclassified 1034
526 Ga0495608_0002630 3300046511 Bacteria 12898
527 Ga0495608_0070939 3300046511 Bacteria 2273
528 Ga0495618_0085422 3300046514 Bacteria 2017
529 Ga0495628_0010298 3300046516 Bacteria 7948
530 Ga0495628_0038398 3300046516 Bacteria 3833
531 Ga0495628_0077325 3300046516 Bacteria 2589
532 Ga0495630_0003226 3300046517 Bacteria 11356
533 Ga0495630_0007885 3300046517 Bacteria 7635
534 Ga0495630_0038958 3300046517 Bacteria 3555
535 Ga0495666_0023106 3300046526 Bacteria 3076
536 Ga0495666_0130026 3300046526 Bacteria 1177
537 Ga0495652_0001144 3300046529 Bacteria 29882
538 Ga0495652_0043468 3300046529 Bacteria 3869
539 Ga0495665_0035766 3300046531 Bacteria 2652
540 Ga0495665_0047420 3300046531 Bacteria 2279
541 Ga0495586_0037632 3300046535 Bacteria 2598
542 Ga0495586_0042921 3300046535 Bacteria 2435
543 Ga0495586_0050475 3300046535 Bacteria 2251
544 Ga0495586_0138016 3300046535 Bacteria 1367
545 Ga0495587_0000721 3300046536 Bacteria 22088
546 Ga0495587_0001658 3300046536 Bacteria 14860
547 Ga0495587_0001702 3300046536 Bacteria 14688
548 Ga0495645_0000127 3300046543 Bacteria 51432
549 Ga0495645_0000616 3300046543 Bacteria 24563
550 Ga0495645_0000737 3300046543 Bacteria 22347
551 Ga0495667_0001871 3300046559 Bacteria 13968
552 Ga0495667_0003111 3300046559 Bacteria 11129
553 Ga0495667_0026907 3300046559 Bacteria 3876
554 Ga0495667_0117156 3300046559 Bacteria 1720
555 Ga0495635_0000248 3300046663 Bacteria 34264
556 Ga0495588_0009726 3300046674 Bacteria 4457
557 Ga0495657_0002731 3300046675 Bacteria 14738
558 Ga0495599_0003594 3300046678 Bacteria 9093
559 Ga0495599_0004132 3300046678 Bacteria 8573
560 Ga0495623_0000399 3300046679 Bacteria 28720
561 Ga0495646_0074190 3300046680 Bacteria 1997
562 Ga0495646_0091400 3300046680 Bacteria 1756
563 Ga0495647_0071208 3300046681 Bacteria 1392
564 Ga0495658_0361922 3300046683 Bacteria 922
565 Ga0495613_0085543 3300046689 Bacteria 2288
566 Ga0495600_0002017 3300046809 Bacteria 11422
567 Ga0495581_0010734 3300047315 Bacteria 5297
568 Ga0495581_0141367 3300047315 Bacteria 1404
569 Ga0495604_0000579 3300047317 Bacteria 32066
570 Ga0495604_0197966 3300047317 Bacteria 1396
571 Ga0495604_0369625 3300047317 Bacteria 949
572 Ga0495674_0003646 3300047319 Bacteria 14993
573 Ga0495674_0097179 3300047319 Bacteria 2509
574 Ga0495674_0250710 3300047319 Bacteria 1457
575 Ga0495672_0005150 3300047320 Bacteria 10430
576 Ga0495680_0002958 3300047322 Bacteria 17006
577 Ga0495680_0245353 3300047322 Bacteria 1271
578 Ga0495675_0000773 3300047444 Bacteria 19900
579 Ga0495675_0072066 3300047444 Bacteria 2180
580 Ga0495684_0000049 3300047471 Bacteria 87765
581 Ga0495684_0030857 3300047471 Bacteria 4114
582 Ga0495684_0234372 3300047471 Bacteria 1341
583 Ga0495593_0036210 3300047673 Bacteria 2677
584 Ga0495593_0123894 3300047673 Bacteria 1314
585 Ga0495602_0023387 3300048088 Bacteria 6022
586 Ga0495602_0033360 3300048088 Bacteria 4830
587 Ga0496100_0188683 3300048903 Bacteria 1495
588 Ga0496101_0237795 3300048904 Bacteria 1417
589 Ga0496104_0581735 3300048907 Bacteria 1030
590 Ga0496105_0104039 3300048908 Bacteria 2345
591 Ga0496106_0163619 3300048909 Bacteria 1760
592 Ga0496107_0036151 3300048910 Bacteria 3543
593 Ga0496108_0164690 3300048911 Bacteria 1917
594 Ga0496112_0014840 3300048915 Bacteria 7246
595 Ga0496112_0209941 3300048915 Bacteria 1905
596 Ga0496115_0278337 3300048918 Unclassified 1374
597 Ga0501032_0209436 3300049569 Bacteria 1271
598 Ga0501032_0337707 3300049569 Unclassified 971
599 Ga0501033_0009285 3300049570 Bacteria 7577
600 Ga0501034_0175496 3300049571 Bacteria 2109
601 Ga0501036_0008351 3300049572 Bacteria 8486
602 Ga0501037_0282084 3300049573 Bacteria 1157
603 Ga0501043_0130805 3300049579 Bacteria 1967
604 Ga0501043_0617623 3300049579 Bacteria 799
605 Ga0501047_0014525 3300049581 Bacteria 7490
606 Ga0501047_0119343 3300049581 Bacteria 2519
607 Ga0501047_0193584 3300049581 Bacteria 1896
608 Ga0501070_0659329 3300049586 Bacteria 830
609 Ga0501202_009468 3300049652 Unclassified 1792
610 Ga0501233_004323 3300049668 Bacteria 2598
611 Ga0501235_005288 3300049669 Unclassified 2808
612 Ga0501251_020900 3300049681 Unclassified 869
613 Ga0501259_003055 3300049688 Unclassified 2682
614 Ga0501225_0004285 3300049705 Bacteria 4264
615 Ga0501234_002527 3300049707 Unclassified 2879
616 Ga0501083_0372205 3300049744 Unclassified 929
617 Ga0501263_000169 3300049760 Unclassified 3892
618 Ga0501035_0073884 3300049822 Bacteria 3017
619 Ga0501035_0087228 3300049822 Bacteria 2750
620 Ga0501044_0118431 3300049823 Bacteria 2651
621 Ga0501044_0131094 3300049823 Bacteria 2501
622 nmdc:mga05p37_201104_c1 3300050507 Bacteria 2413
623 nmdc:mga0n895_13980_c1 3300050512 Bacteria 7270
624 nmdc:mga0rr50_141142_c1 3300050513 Bacteria 1938
625 nmdc:mga08x19_359444_c1 3300050514 Unclassified 1017
626 nmdc:mga08x19_5485_c1 3300050514 Bacteria 7503
627 nmdc:mga0a205_60926_c1 3300050515 Bacteria 3645
628 Ga0495601_0006363 3300053077 Bacteria 6905
629 Ga0495601_0225256 3300053077 Unclassified 1225
630 Ga0495595_0076278 3300053084 Bacteria 1591
631 Ga0495595_0132511 3300053084 Bacteria 1219
632 Ga0495619_0002387 3300053085 Bacteria 12330
633 Ga0495619_0108611 3300053085 Bacteria 1894

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10146308 Ga0207682_101463081 153
2 3300009551 Ga0105238_10831037 Ga0105238_108310372 187
3 3300031901 Ga0307406_10134098 Ga0307406_101340984 189
4 3300005353 Ga0070669_100034397 Ga0070669_1000343973 191
5 3300013296 Ga0157374_10185267 Ga0157374_101852672 195
6 3300031824 Ga0307413_10172726 Ga0307413_101727262 196
7 3300005339 Ga0070660_100438343 Ga0070660_1004383432 198
8 3300005341 Ga0070691_10037141 Ga0070691_100371414 198
9 3300005344 Ga0070661_100007670 Ga0070661_10000767010 198
10 3300005366 Ga0070659_100242241 Ga0070659_1002422412 198
11 3300005435 Ga0070714_100145189 Ga0070714_1001451891 198
12 3300005546 Ga0070696_100041503 Ga0070696_1000415033 198
13 3300005563 Ga0068855_100548618 Ga0068855_1005486182 198
14 3300009551 Ga0105238_10103026 Ga0105238_101030264 198
15 3300010375 Ga0105239_10604538 Ga0105239_106045382 198
16 3300020069 Ga0197907_10335094 Ga0197907_103350942 198
17 3300020082 Ga0206353_11787594 Ga0206353_117875942 198
18 3300025912 Ga0207707_10018744 Ga0207707_100187442 198
19 3300025913 Ga0207695_10025723 Ga0207695_100257232 198
20 3300025919 Ga0207657_10366525 Ga0207657_103665252 198
21 3300025924 Ga0207694_10344769 Ga0207694_103447692 198
22 3300025929 Ga0207664_10047944 Ga0207664_100479443 198
23 3300025932 Ga0207690_10128083 Ga0207690_101280832 198
24 3300026116 Ga0207674_10258040 Ga0207674_102580402 198
25 3300005445 Ga0070708_100053005 Ga0070708_1000530051 199
26 3300005471 Ga0070698_100366715 Ga0070698_1003667151 199
27 3300005518 Ga0070699_100072998 Ga0070699_1000729984 199
28 3300031995 Ga0307409_100193344 Ga0307409_1001933442 200
29 3300032004 Ga0307414_10040187 Ga0307414_100401873 200
30 3300031548 Ga0307408_100539281 Ga0307408_1005392812 201
31 3300031852 Ga0307410_10388473 Ga0307410_103884731 201
32 3300032002 Ga0307416_100223354 Ga0307416_1002233542 201
33 3300032126 Ga0307415_100404202 Ga0307415_1004042022 201
34 3300044684 Ga0466966_0040865 Ga0466966_0040865_835_1542 201
35 3300013297 Ga0157378_11330383 Ga0157378_113303831 203
36 3300005356 Ga0070674_100289519 Ga0070674_1002895192 204
37 3300005530 Ga0070679_100508437 Ga0070679_1005084372 204
38 3300013308 Ga0157375_10119586 Ga0157375_101195862 204
39 3300025899 Ga0207642_10056912 Ga0207642_100569122 204
40 3300025934 Ga0207686_10413521 Ga0207686_104135212 204
41 3300025935 Ga0207709_10240990 Ga0207709_102409902 204
42 3300025972 Ga0207668_10076501 Ga0207668_100765013 204
43 3300028381 Ga0268264_10151295 Ga0268264_101512954 204
44 3300009553 Ga0105249_11495754 Ga0105249_114957541 205
45 3300014326 Ga0157380_10737438 Ga0157380_107374382 205
46 3300031903 Ga0307407_10538400 Ga0307407_105384002 205
47 3300048904 Ga0496101_0237795 Ga0496101_0237795_38_742 205
48 3300005329 Ga0070683_100029411 Ga0070683_1000294115 206
49 3300005355 Ga0070671_100037473 Ga0070671_1000374734 206
50 3300005367 Ga0070667_100246733 Ga0070667_1002467332 206
51 3300005547 Ga0070693_100476915 Ga0070693_1004769152 206
52 3300006844 Ga0075428_100664478 Ga0075428_1006644782 206
53 3300009094 Ga0111539_10704607 Ga0111539_107046072 206
54 3300013308 Ga0157375_10234100 Ga0157375_102341002 206
55 3300014968 Ga0157379_10572962 Ga0157379_105729622 206
56 3300025940 Ga0207691_10137936 Ga0207691_101379362 206
57 3300025944 Ga0207661_10101491 Ga0207661_101014914 206
58 3300026035 Ga0207703_10210003 Ga0207703_102100032 206
59 3300026067 Ga0207678_10312601 Ga0207678_103126012 206
60 3300036401 Ga0373937_0115090 Ga0373937_0115090_396_1067 206
61 3300047317 Ga0495604_0197966 Ga0495604_0197966_594_1265 206
62 3300047444 Ga0495675_0072066 Ga0495675_0072066_614_1285 206
63 3300048903 Ga0496100_0188683 Ga0496100_0188683_141_812 206
64 3300048907 Ga0496104_0581735 Ga0496104_0581735_292_996 206
65 3300048908 Ga0496105_0104039 Ga0496105_0104039_1583_2254 206
66 3300048909 Ga0496106_0163619 Ga0496106_0163619_310_981 206
67 3300048910 Ga0496107_0036151 Ga0496107_0036151_2735_3406 206
68 3300048911 Ga0496108_0164690 Ga0496108_0164690_948_1652 206
69 3300005458 Ga0070681_10016025 Ga0070681_100160256 207
70 3300005530 Ga0070679_100001679 Ga0070679_10000167914 207
71 3300005614 Ga0068856_100257352 Ga0068856_1002573522 207
72 3300006914 Ga0075436_100104820 Ga0075436_1001048202 207
73 3300009093 Ga0105240_10002404 Ga0105240_1000240414 207
74 3300013104 Ga0157370_10004399 Ga0157370_1000439911 207
75 3300013104 Ga0157370_10209269 Ga0157370_102092693 207
76 3300013307 Ga0157372_10103477 Ga0157372_101034771 207
77 3300013307 Ga0157372_10448099 Ga0157372_104480992 207
78 3300025912 Ga0207707_10002022 Ga0207707_100020227 207
79 3300025913 Ga0207695_10014926 Ga0207695_100149264 207
80 3300025949 Ga0207667_10947140 Ga0207667_109471401 207
81 3300026078 Ga0207702_10071173 Ga0207702_100711733 207
82 3300050514 nmdc:mga08x19_5485_c1 nmdc:mga08x19_5485_c1_5197_5883 207
83 3300005439 Ga0070711_100139992 Ga0070711_1001399922 208
84 3300009545 Ga0105237_10908706 Ga0105237_109087062 208
85 3300021384 Ga0213876_10026623 Ga0213876_100266232 208
86 3300025916 Ga0207663_10307051 Ga0207663_103070512 208
87 3300039437 Ga0436365_0041325 Ga0436365_0041325_863_1555 208
88 3300005333 Ga0070677_10152472 Ga0070677_101524722 209
89 3300005614 Ga0068856_100704776 Ga0068856_1007047762 209
90 3300014326 Ga0157380_10393769 Ga0157380_103937692 209
91 3300026078 Ga0207702_10383544 Ga0207702_103835441 209
92 3300045836 Ga0466958_0359280 Ga0466958_0359280_148_831 209
93 3300005290 Ga0065712_10082566 Ga0065712_100825662 210
94 3300005329 Ga0070683_100252583 Ga0070683_1002525832 210
95 3300005330 Ga0070690_100014309 Ga0070690_1000143094 210
96 3300005331 Ga0070670_100088295 Ga0070670_1000882953 210
97 3300005338 Ga0068868_100559362 Ga0068868_1005593621 210
98 3300005354 Ga0070675_100024357 Ga0070675_1000243575 210
99 3300005355 Ga0070671_100052254 Ga0070671_1000522543 210
100 3300005365 Ga0070688_100005628 Ga0070688_1000056283 210
101 3300005367 Ga0070667_100792639 Ga0070667_1007926392 210
102 3300005543 Ga0070672_100075885 Ga0070672_1000758851 210
103 3300005563 Ga0068855_100258194 Ga0068855_1002581942 210
104 3300005564 Ga0070664_100297289 Ga0070664_1002972892 210
105 3300005577 Ga0068857_100459257 Ga0068857_1004592572 210
106 3300005617 Ga0068859_100132360 Ga0068859_1001323603 210
107 3300005840 Ga0068870_10073588 Ga0068870_100735882 210
108 3300005843 Ga0068860_100315861 Ga0068860_1003158612 210
109 3300005844 Ga0068862_100179745 Ga0068862_1001797452 210
110 3300006931 Ga0097620_100132352 Ga0097620_1001323523 210
111 3300009174 Ga0105241_10002439 Ga0105241_100024393 210
112 3300011119 Ga0105246_10622876 Ga0105246_106228762 210
113 3300011119 Ga0105246_10903564 Ga0105246_109035641 210
114 3300013105 Ga0157369_10384223 Ga0157369_103842232 210
115 3300013297 Ga0157378_10356705 Ga0157378_103567052 210
116 3300013308 Ga0157375_10029480 Ga0157375_100294802 210
117 3300014745 Ga0157377_10058658 Ga0157377_100586582 210
118 3300025901 Ga0207688_10163360 Ga0207688_101633602 210
119 3300025908 Ga0207643_10052595 Ga0207643_100525952 210
120 3300025911 Ga0207654_10017982 Ga0207654_100179824 210
121 3300025919 Ga0207657_10106432 Ga0207657_101064324 210
122 3300025926 Ga0207659_10071449 Ga0207659_100714492 210
123 3300025931 Ga0207644_10062127 Ga0207644_100621272 210
124 3300025940 Ga0207691_10016949 Ga0207691_100169495 210
125 3300025944 Ga0207661_10306640 Ga0207661_103066402 210
126 3300025949 Ga0207667_10269677 Ga0207667_102696772 210
127 3300025960 Ga0207651_10025149 Ga0207651_100251494 210
128 3300025986 Ga0207658_10076242 Ga0207658_100762423 210
129 3300026116 Ga0207674_10066327 Ga0207674_100663272 210
130 3300028380 Ga0268265_10199146 Ga0268265_101991462 210
131 3300035086 Ga0373934_0000064 Ga0373934_0000064_30587_31270 210
132 3300035111 Ga0373923_0019296 Ga0373923_0019296_1080_1763 210
133 3300035117 Ga0373953_0001938 Ga0373953_0001938_2203_2886 210
134 3300035119 Ga0373956_0000381 Ga0373956_0000381_9824_10507 210
135 3300035120 Ga0373957_0031354 Ga0373957_0031354_628_1311 210
136 3300035172 Ga0373955_0000995 Ga0373955_0000995_11060_11743 210
137 3300035410 Ga0373924_0042853 Ga0373924_0042853_795_1478 210
138 3300035724 Ga0373933_0001064 Ga0373933_0001064_15240_15923 210
139 3300036401 Ga0373937_0000558 Ga0373937_0000558_32179_32862 210
140 3300046454 Ga0495592_0000897 Ga0495592_0000897_2374_3057 210
141 3300046459 Ga0495629_0023944 Ga0495629_0023944_3545_4228 210
142 3300046462 Ga0495651_0000171 Ga0495651_0000171_10021_10704 210
143 3300046463 Ga0495653_0000065 Ga0495653_0000065_57978_58661 210
144 3300046500 Ga0495596_0117237 Ga0495596_0117237_97_786 210
145 3300046511 Ga0495608_0002630 Ga0495608_0002630_5844_6527 210
146 3300046516 Ga0495628_0010298 Ga0495628_0010298_4923_5606 210
147 3300046517 Ga0495630_0007885 Ga0495630_0007885_3112_3795 210
148 3300046529 Ga0495652_0001144 Ga0495652_0001144_6669_7352 210
149 3300046535 Ga0495586_0037632 Ga0495586_0037632_1452_2135 210
150 3300046536 Ga0495587_0000721 Ga0495587_0000721_6513_7196 210
151 3300046543 Ga0495645_0000616 Ga0495645_0000616_13664_14347 210
152 3300046559 Ga0495667_0001871 Ga0495667_0001871_10472_11155 210
153 3300046663 Ga0495635_0000248 Ga0495635_0000248_17751_18434 210
154 3300046675 Ga0495657_0002731 Ga0495657_0002731_7518_8201 210
155 3300046678 Ga0495599_0003594 Ga0495599_0003594_514_1197 210
156 3300046679 Ga0495623_0000399 Ga0495623_0000399_5766_6449 210
157 3300046680 Ga0495646_0091400 Ga0495646_0091400_653_1336 210
158 3300046689 Ga0495613_0085543 Ga0495613_0085543_1533_2216 210
159 3300046809 Ga0495600_0002017 Ga0495600_0002017_6669_7352 210
160 3300047317 Ga0495604_0000579 Ga0495604_0000579_18032_18715 210
161 3300047319 Ga0495674_0003646 Ga0495674_0003646_6643_7326 210
162 3300047322 Ga0495680_0002958 Ga0495680_0002958_751_1434 210
163 3300047444 Ga0495675_0000773 Ga0495675_0000773_279_962 210
164 3300047471 Ga0495684_0000049 Ga0495684_0000049_50942_51625 210
165 3300047673 Ga0495593_0123894 Ga0495593_0123894_315_998 210
166 3300048088 Ga0495602_0023387 Ga0495602_0023387_2015_2698 210
167 3300053077 Ga0495601_0006363 Ga0495601_0006363_5652_6335 210
168 3300053084 Ga0495595_0076278 Ga0495595_0076278_187_870 210
169 3300053085 Ga0495619_0002387 Ga0495619_0002387_3635_4318 210
170 3300005353 Ga0070669_100463277 Ga0070669_1004632771 211
171 3300013308 Ga0157375_10084945 Ga0157375_100849454 211
172 3300041512 Ga0451853_1717090 Ga0451853_1717090_223_903 211
173 3300005530 Ga0070679_100089657 Ga0070679_1000896572 212
174 3300005546 Ga0070696_100002712 Ga0070696_1000027129 212
175 3300005547 Ga0070693_100000716 Ga0070693_1000007163 212
176 3300025921 Ga0207652_10200744 Ga0207652_102007442 212
177 3300031852 Ga0307410_10165596 Ga0307410_101655962 212
178 3300032002 Ga0307416_100844306 Ga0307416_1008443062 212
179 3300032126 Ga0307415_100026149 Ga0307415_1000261494 212
180 3300005330 Ga0070690_100126557 Ga0070690_1001265572 213
181 3300005468 Ga0070707_100265640 Ga0070707_1002656402 213
182 3300005336 Ga0070680_100000187 Ga0070680_10000018733 214
183 3300005458 Ga0070681_10034983 Ga0070681_100349832 214
184 3300005530 Ga0070679_100003788 Ga0070679_1000037887 214
185 3300005535 Ga0070684_100046228 Ga0070684_1000462283 214
186 3300013104 Ga0157370_10000540 Ga0157370_1000054035 214
187 3300013105 Ga0157369_10015801 Ga0157369_100158012 214
188 3300025917 Ga0207660_10011949 Ga0207660_100119493 214
189 3300025921 Ga0207652_10012829 Ga0207652_100128295 214
190 3300025949 Ga0207667_10046369 Ga0207667_100463694 214
191 3300005467 Ga0070706_100525910 Ga0070706_1005259102 215
192 3300005468 Ga0070707_100021715 Ga0070707_1000217155 215
193 3300005840 Ga0068870_10338599 Ga0068870_103385992 215
194 3300025910 Ga0207684_10451994 Ga0207684_104519942 215
195 3300025940 Ga0207691_10014209 Ga0207691_100142096 215
196 3300049586 Ga0501070_0659329 Ga0501070_0659329_60_746 215
197 3300005444 Ga0070694_100063519 Ga0070694_1000635193 216
198 3300013100 Ga0157373_10208247 Ga0157373_102082472 216
199 3300013297 Ga0157378_10026888 Ga0157378_100268886 216
200 3300031852 Ga0307410_10266664 Ga0307410_102666642 216
201 3300007076 Ga0075435_100156648 Ga0075435_1001566483 217
202 3300009093 Ga0105240_10007054 Ga0105240_1000705417 217
203 3300013104 Ga0157370_10125431 Ga0157370_101254312 217
204 3300013307 Ga0157372_10041502 Ga0157372_100415024 217
205 3300025913 Ga0207695_10002822 Ga0207695_1000282229 217
206 3300025949 Ga0207667_10645184 Ga0207667_106451842 217
207 3300005330 Ga0070690_100028789 Ga0070690_1000287892 218
208 3300005355 Ga0070671_100014627 Ga0070671_1000146272 218
209 3300025931 Ga0207644_10026125 Ga0207644_100261253 218
210 3300013104 Ga0157370_10307768 Ga0157370_103077682 219
211 3300005937 Ga0081455_10041058 Ga0081455_100410584 222
212 3300026095 Ga0207676_10256433 Ga0207676_102564332 222
213 3300032002 Ga0307416_100287224 Ga0307416_1002872242 222
214 3300035241 Ga0373961_0025819 Ga0373961_0025819_344_1012 222
215 3300037312 Ga0395899_0106317 Ga0395899_0106317_109_792 222
216 3300037466 Ga0395898_0126652 Ga0395898_0126652_922_1605 222
217 3300037471 Ga0395905_0004795 Ga0395905_0004795_8866_9549 222
218 3300038443 Ga0395901_0005991 Ga0395901_0005991_8899_9582 222
219 3300045976 Ga0466967_0027120 Ga0466967_0027120_328_996 222
220 3300046559 Ga0495667_0026907 Ga0495667_0026907_2733_3401 222
221 3300047320 Ga0495672_0005150 Ga0495672_0005150_9015_9683 222
222 3300049760 Ga0501263_000169 Ga0501263_000169_790_1467 222
223 2162886012 MBSR1b_contig_4672892 MBSR1b_0064.00002850 223
224 3300005293 Ga0065715_10093395 Ga0065715_100933954 223
225 3300005327 Ga0070658_10001684 Ga0070658_100016849 223
226 3300005327 Ga0070658_10005474 Ga0070658_100054742 223
227 3300005327 Ga0070658_10118904 Ga0070658_101189042 223
228 3300005327 Ga0070658_10128251 Ga0070658_101282512 223
229 3300005329 Ga0070683_100006630 Ga0070683_1000066308 223
230 3300005329 Ga0070683_100015822 Ga0070683_1000158226 223
231 3300005329 Ga0070683_100021358 Ga0070683_1000213584 223
232 3300005329 Ga0070683_100023805 Ga0070683_1000238056 223
233 3300005329 Ga0070683_100037963 Ga0070683_1000379634 223
234 3300005329 Ga0070683_100045724 Ga0070683_1000457244 223
235 3300005329 Ga0070683_100091934 Ga0070683_1000919342 223
236 3300005329 Ga0070683_100130762 Ga0070683_1001307622 223
237 3300005329 Ga0070683_100178090 Ga0070683_1001780902 223
238 3300005329 Ga0070683_100188530 Ga0070683_1001885302 223
239 3300005330 Ga0070690_100102149 Ga0070690_1001021493 223
240 3300005334 Ga0068869_100135235 Ga0068869_1001352353 223
241 3300005336 Ga0070680_100000740 Ga0070680_10000074020 223
242 3300005336 Ga0070680_100002251 Ga0070680_1000022517 223
243 3300005336 Ga0070680_100010964 Ga0070680_1000109643 223
244 3300005336 Ga0070680_100054279 Ga0070680_1000542792 223
245 3300005336 Ga0070680_100210191 Ga0070680_1002101912 223
246 3300005336 Ga0070680_100225977 Ga0070680_1002259772 223
247 3300005337 Ga0070682_100089269 Ga0070682_1000892691 223
248 3300005337 Ga0070682_100173712 Ga0070682_1001737122 223
249 3300005338 Ga0068868_100013966 Ga0068868_1000139665 223
250 3300005338 Ga0068868_100056027 Ga0068868_1000560274 223
251 3300005339 Ga0070660_100016690 Ga0070660_1000166904 223
252 3300005339 Ga0070660_100080282 Ga0070660_1000802824 223
253 3300005340 Ga0070689_100056549 Ga0070689_1000565493 223
254 3300005341 Ga0070691_10004179 Ga0070691_100041793 223
255 3300005341 Ga0070691_10010004 Ga0070691_100100043 223
256 3300005343 Ga0070687_100022622 Ga0070687_1000226222 223
257 3300005344 Ga0070661_100049184 Ga0070661_1000491845 223
258 3300005344 Ga0070661_100057094 Ga0070661_1000570942 223
259 3300005345 Ga0070692_10148848 Ga0070692_101488482 223
260 3300005347 Ga0070668_100268726 Ga0070668_1002687262 223
261 3300005354 Ga0070675_100525993 Ga0070675_1005259931 223
262 3300005364 Ga0070673_100068503 Ga0070673_1000685033 223
263 3300005365 Ga0070688_100090788 Ga0070688_1000907882 223
264 3300005366 Ga0070659_100165992 Ga0070659_1001659922 223
265 3300005367 Ga0070667_100082900 Ga0070667_1000829003 223
266 3300005434 Ga0070709_10503685 Ga0070709_105036852 223
267 3300005436 Ga0070713_100012772 Ga0070713_1000127727 223
268 3300005438 Ga0070701_10055034 Ga0070701_100550342 223
269 3300005439 Ga0070711_100047808 Ga0070711_1000478083 223
270 3300005444 Ga0070694_100068455 Ga0070694_1000684552 223
271 3300005444 Ga0070694_100214476 Ga0070694_1002144762 223
272 3300005445 Ga0070708_100000089 Ga0070708_10000008921 223
273 3300005445 Ga0070708_100004987 Ga0070708_1000049872 223
274 3300005455 Ga0070663_100064728 Ga0070663_1000647282 223
275 3300005456 Ga0070678_100541771 Ga0070678_1005417712 223
276 3300005457 Ga0070662_100296759 Ga0070662_1002967592 223
277 3300005458 Ga0070681_10005730 Ga0070681_1000573011 223
278 3300005458 Ga0070681_10006463 Ga0070681_100064633 223
279 3300005458 Ga0070681_10067660 Ga0070681_100676601 223
280 3300005458 Ga0070681_10174531 Ga0070681_101745312 223
281 3300005458 Ga0070681_10291638 Ga0070681_102916381 223
282 3300005458 Ga0070681_10483622 Ga0070681_104836222 223
283 3300005466 Ga0070685_10070273 Ga0070685_100702732 223
284 3300005468 Ga0070707_100038876 Ga0070707_1000388765 223
285 3300005468 Ga0070707_100057738 Ga0070707_1000577383 223
286 3300005471 Ga0070698_100167902 Ga0070698_1001679022 223
287 3300005471 Ga0070698_100829293 Ga0070698_1008292931 223
288 3300005518 Ga0070699_100084762 Ga0070699_1000847624 223
289 3300005530 Ga0070679_100002452 Ga0070679_10000245217 223
290 3300005530 Ga0070679_100005794 Ga0070679_1000057943 223
291 3300005530 Ga0070679_100016947 Ga0070679_1000169478 223
292 3300005530 Ga0070679_100033701 Ga0070679_1000337013 223
293 3300005530 Ga0070679_100065523 Ga0070679_1000655231 223
294 3300005530 Ga0070679_100111942 Ga0070679_1001119423 223
295 3300005530 Ga0070679_100170635 Ga0070679_1001706352 223
296 3300005530 Ga0070679_100171017 Ga0070679_1001710174 223
297 3300005530 Ga0070679_100508197 Ga0070679_1005081972 223
298 3300005535 Ga0070684_100000778 Ga0070684_10000077825 223
299 3300005535 Ga0070684_100008531 Ga0070684_1000085312 223
300 3300005535 Ga0070684_100028726 Ga0070684_1000287265 223
301 3300005535 Ga0070684_100043276 Ga0070684_1000432762 223
302 3300005535 Ga0070684_100069207 Ga0070684_1000692073 223
303 3300005535 Ga0070684_100170208 Ga0070684_1001702082 223
304 3300005535 Ga0070684_100207883 Ga0070684_1002078833 223
305 3300005535 Ga0070684_100341923 Ga0070684_1003419232 223
306 3300005536 Ga0070697_100138475 Ga0070697_1001384752 223
307 3300005545 Ga0070695_100436880 Ga0070695_1004368802 223
308 3300005546 Ga0070696_100100787 Ga0070696_1001007873 223
309 3300005546 Ga0070696_100180670 Ga0070696_1001806702 223
310 3300005547 Ga0070693_100379996 Ga0070693_1003799962 223
311 3300005547 Ga0070693_100482831 Ga0070693_1004828311 223
312 3300005549 Ga0070704_100025997 Ga0070704_1000259973 223
313 3300005549 Ga0070704_100123009 Ga0070704_1001230092 223
314 3300005549 Ga0070704_100267075 Ga0070704_1002670752 223
315 3300005549 Ga0070704_100667037 Ga0070704_1006670372 223
316 3300005563 Ga0068855_100021185 Ga0068855_1000211854 223
317 3300005563 Ga0068855_100332298 Ga0068855_1003322983 223
318 3300005563 Ga0068855_100515950 Ga0068855_1005159502 223
319 3300005564 Ga0070664_100092703 Ga0070664_1000927034 223
320 3300005564 Ga0070664_100798296 Ga0070664_1007982962 223
321 3300005577 Ga0068857_100073137 Ga0068857_1000731373 223
322 3300005578 Ga0068854_100315787 Ga0068854_1003157872 223
323 3300005578 Ga0068854_100393084 Ga0068854_1003930842 223
324 3300005578 Ga0068854_100420183 Ga0068854_1004201832 223
325 3300005614 Ga0068856_100054366 Ga0068856_1000543664 223
326 3300005614 Ga0068856_100214180 Ga0068856_1002141803 223
327 3300005614 Ga0068856_100248575 Ga0068856_1002485752 223
328 3300005614 Ga0068856_100483823 Ga0068856_1004838232 223
329 3300005615 Ga0070702_100179772 Ga0070702_1001797722 223
330 3300005616 Ga0068852_100005679 Ga0068852_1000056797 223
331 3300005616 Ga0068852_100035272 Ga0068852_1000352727 223
332 3300005616 Ga0068852_100104535 Ga0068852_1001045353 223
333 3300005617 Ga0068859_100085745 Ga0068859_1000857453 223
334 3300005617 Ga0068859_100086502 Ga0068859_1000865022 223
335 3300005617 Ga0068859_100191537 Ga0068859_1001915372 223
336 3300005618 Ga0068864_100098422 Ga0068864_1000984222 223
337 3300006173 Ga0070716_100081146 Ga0070716_1000811462 223
338 3300006173 Ga0070716_100184270 Ga0070716_1001842702 223
339 3300006237 Ga0097621_100215972 Ga0097621_1002159722 223
340 3300006237 Ga0097621_100334787 Ga0097621_1003347872 223
341 3300006871 Ga0075434_100033783 Ga0075434_1000337832 223
342 3300006914 Ga0075436_100496457 Ga0075436_1004964572 223
343 3300006931 Ga0097620_100085740 Ga0097620_1000857401 223
344 3300006931 Ga0097620_100086508 Ga0097620_1000865082 223
345 3300006931 Ga0097620_100191511 Ga0097620_1001915112 223
346 3300007076 Ga0075435_100187457 Ga0075435_1001874573 223
347 3300009093 Ga0105240_10035417 Ga0105240_100354173 223
348 3300009093 Ga0105240_10039700 Ga0105240_100397003 223
349 3300009093 Ga0105240_10109606 Ga0105240_101096061 223
350 3300009093 Ga0105240_10114766 Ga0105240_101147664 223
351 3300009093 Ga0105240_10290028 Ga0105240_102900282 223
352 3300009098 Ga0105245_10155871 Ga0105245_101558713 223
353 3300009098 Ga0105245_10864373 Ga0105245_108643732 223
354 3300009147 Ga0114129_10067730 Ga0114129_100677302 223
355 3300009148 Ga0105243_10110796 Ga0105243_101107963 223
356 3300009174 Ga0105241_10206830 Ga0105241_102068302 223
357 3300009174 Ga0105241_10570182 Ga0105241_105701822 223
358 3300009176 Ga0105242_10172514 Ga0105242_101725141 223
359 3300009177 Ga0105248_10219449 Ga0105248_102194492 223
360 3300009177 Ga0105248_11163791 Ga0105248_111637911 223
361 3300009545 Ga0105237_10043671 Ga0105237_100436714 223
362 3300009551 Ga0105238_10056905 Ga0105238_100569055 223
363 3300009551 Ga0105238_10424973 Ga0105238_104249732 223
364 3300010375 Ga0105239_10088619 Ga0105239_100886193 223
365 3300011119 Ga0105246_10154882 Ga0105246_101548822 223
366 3300011119 Ga0105246_10300626 Ga0105246_103006262 223
367 3300013100 Ga0157373_10060511 Ga0157373_100605114 223
368 3300013100 Ga0157373_10418774 Ga0157373_104187742 223
369 3300013102 Ga0157371_10082313 Ga0157371_100823131 223
370 3300013102 Ga0157371_10161941 Ga0157371_101619412 223
371 3300013104 Ga0157370_10003694 Ga0157370_100036943 223
372 3300013104 Ga0157370_10040372 Ga0157370_100403724 223
373 3300013105 Ga0157369_10002739 Ga0157369_1000273918 223
374 3300013105 Ga0157369_10083959 Ga0157369_100839595 223
375 3300013105 Ga0157369_10151149 Ga0157369_101511492 223
376 3300013105 Ga0157369_10214724 Ga0157369_102147243 223
377 3300013105 Ga0157369_11183013 Ga0157369_111830131 223
378 3300013306 Ga0163162_10069273 Ga0163162_100692733 223
379 3300013306 Ga0163162_10468854 Ga0163162_104688542 223
380 3300013307 Ga0157372_10001743 Ga0157372_100017435 223
381 3300013307 Ga0157372_10003651 Ga0157372_100036513 223
382 3300013307 Ga0157372_10007923 Ga0157372_100079235 223
383 3300013307 Ga0157372_10009451 Ga0157372_1000945112 223
384 3300013307 Ga0157372_10080645 Ga0157372_100806453 223
385 3300013307 Ga0157372_10104797 Ga0157372_101047972 223
386 3300013307 Ga0157372_10199573 Ga0157372_101995734 223
387 3300013307 Ga0157372_10214939 Ga0157372_102149392 223
388 3300013307 Ga0157372_10253381 Ga0157372_102533814 223
389 3300013307 Ga0157372_10369537 Ga0157372_103695372 223
390 3300013307 Ga0157372_10876762 Ga0157372_108767622 223
391 3300013308 Ga0157375_10157166 Ga0157375_101571664 223
392 3300014745 Ga0157377_10140413 Ga0157377_101404132 223
393 3300014969 Ga0157376_10056588 Ga0157376_100565883 223
394 3300025903 Ga0207680_10054574 Ga0207680_100545742 223
395 3300025906 Ga0207699_10261714 Ga0207699_102617142 223
396 3300025907 Ga0207645_10056374 Ga0207645_100563743 223
397 3300025907 Ga0207645_10349702 Ga0207645_103497022 223
398 3300025909 Ga0207705_10003698 Ga0207705_100036986 223
399 3300025909 Ga0207705_10014773 Ga0207705_100147734 223
400 3300025909 Ga0207705_10184728 Ga0207705_101847282 223
401 3300025912 Ga0207707_10011617 Ga0207707_100116177 223
402 3300025912 Ga0207707_10037243 Ga0207707_100372434 223
403 3300025912 Ga0207707_10093867 Ga0207707_100938674 223
404 3300025912 Ga0207707_10131280 Ga0207707_101312803 223
405 3300025912 Ga0207707_10198967 Ga0207707_101989672 223
406 3300025913 Ga0207695_10001840 Ga0207695_1000184016 223
407 3300025913 Ga0207695_10009902 Ga0207695_1000990210 223
408 3300025913 Ga0207695_10044047 Ga0207695_100440474 223
409 3300025913 Ga0207695_10096842 Ga0207695_100968422 223
410 3300025913 Ga0207695_10133735 Ga0207695_101337353 223
411 3300025914 Ga0207671_10045989 Ga0207671_100459893 223
412 3300025916 Ga0207663_10029987 Ga0207663_100299871 223
413 3300025917 Ga0207660_10000071 Ga0207660_1000007144 223
414 3300025917 Ga0207660_10009685 Ga0207660_100096857 223
415 3300025917 Ga0207660_10075828 Ga0207660_100758283 223
416 3300025917 Ga0207660_10109902 Ga0207660_101099022 223
417 3300025917 Ga0207660_10116611 Ga0207660_101166113 223
418 3300025917 Ga0207660_10503591 Ga0207660_105035912 223
419 3300025918 Ga0207662_10006600 Ga0207662_100066004 223
420 3300025919 Ga0207657_10001748 Ga0207657_1000174814 223
421 3300025919 Ga0207657_10002151 Ga0207657_100021514 223
422 3300025919 Ga0207657_10040525 Ga0207657_100405253 223
423 3300025919 Ga0207657_10116166 Ga0207657_101161664 223
424 3300025920 Ga0207649_10089241 Ga0207649_100892413 223
425 3300025921 Ga0207652_10009562 Ga0207652_100095624 223
426 3300025921 Ga0207652_10023518 Ga0207652_100235183 223
427 3300025921 Ga0207652_10043502 Ga0207652_100435025 223
428 3300025921 Ga0207652_10044813 Ga0207652_100448133 223
429 3300025921 Ga0207652_10049713 Ga0207652_100497133 223
430 3300025921 Ga0207652_10086227 Ga0207652_100862273 223
431 3300025921 Ga0207652_10139699 Ga0207652_101396994 223
432 3300025921 Ga0207652_10186696 Ga0207652_101866963 223
433 3300025921 Ga0207652_10263202 Ga0207652_102632022 223
434 3300025922 Ga0207646_10043630 Ga0207646_100436303 223
435 3300025922 Ga0207646_10053295 Ga0207646_100532954 223
436 3300025924 Ga0207694_10076618 Ga0207694_100766183 223
437 3300025924 Ga0207694_10548625 Ga0207694_105486252 223
438 3300025926 Ga0207659_10065029 Ga0207659_100650292 223
439 3300025927 Ga0207687_10719203 Ga0207687_107192031 223
440 3300025927 Ga0207687_10755258 Ga0207687_107552582 223
441 3300025928 Ga0207700_10089487 Ga0207700_100894872 223
442 3300025931 Ga0207644_10425154 Ga0207644_104251542 223
443 3300025932 Ga0207690_10007736 Ga0207690_100077363 223
444 3300025932 Ga0207690_10018034 Ga0207690_100180344 223
445 3300025932 Ga0207690_10208460 Ga0207690_102084602 223
446 3300025934 Ga0207686_10082259 Ga0207686_100822592 223
447 3300025934 Ga0207686_10200625 Ga0207686_102006252 223
448 3300025936 Ga0207670_10134305 Ga0207670_101343052 223
449 3300025938 Ga0207704_10070882 Ga0207704_100708822 223
450 3300025938 Ga0207704_10076585 Ga0207704_100765853 223
451 3300025939 Ga0207665_10176622 Ga0207665_101766221 223
452 3300025941 Ga0207711_10690198 Ga0207711_106901982 223
453 3300025944 Ga0207661_10000568 Ga0207661_100005683 223
454 3300025944 Ga0207661_10003126 Ga0207661_100031263 223
455 3300025944 Ga0207661_10027246 Ga0207661_100272464 223
456 3300025944 Ga0207661_10027612 Ga0207661_100276123 223
457 3300025944 Ga0207661_10069121 Ga0207661_100691213 223
458 3300025944 Ga0207661_10098774 Ga0207661_100987742 223
459 3300025944 Ga0207661_10399948 Ga0207661_103999482 223
460 3300025945 Ga0207679_10084762 Ga0207679_100847623 223
461 3300025945 Ga0207679_10199559 Ga0207679_101995593 223
462 3300025949 Ga0207667_10035104 Ga0207667_100351044 223
463 3300025949 Ga0207667_10148329 Ga0207667_101483292 223
464 3300025972 Ga0207668_10164258 Ga0207668_101642582 223
465 3300025981 Ga0207640_10005661 Ga0207640_100056619 223
466 3300025981 Ga0207640_10077926 Ga0207640_100779263 223
467 3300025981 Ga0207640_10402720 Ga0207640_104027201 223
468 3300025986 Ga0207658_10035986 Ga0207658_100359863 223
469 3300025986 Ga0207658_10049289 Ga0207658_100492892 223
470 3300025986 Ga0207658_10441408 Ga0207658_104414082 223
471 3300026023 Ga0207677_10091726 Ga0207677_100917263 223
472 3300026035 Ga0207703_10252347 Ga0207703_102523472 223
473 3300026041 Ga0207639_10043929 Ga0207639_100439293 223
474 3300026067 Ga0207678_10001464 Ga0207678_100014644 223
475 3300026078 Ga0207702_10029611 Ga0207702_100296114 223
476 3300026078 Ga0207702_10457222 Ga0207702_104572222 223
477 3300026078 Ga0207702_10653156 Ga0207702_106531562 223
478 3300026116 Ga0207674_10011008 Ga0207674_100110087 223
479 3300026116 Ga0207674_10157834 Ga0207674_101578343 223
480 3300026116 Ga0207674_10554171 Ga0207674_105541712 223
481 3300026142 Ga0207698_10018181 Ga0207698_100181812 223
482 3300026142 Ga0207698_10640372 Ga0207698_106403722 223
483 3300028380 Ga0268265_10033891 Ga0268265_100338913 223
484 3300031548 Ga0307408_100034305 Ga0307408_1000343052 223
485 3300031548 Ga0307408_100092958 Ga0307408_1000929582 223
486 3300031731 Ga0307405_10010758 Ga0307405_100107583 223
487 3300031731 Ga0307405_10018526 Ga0307405_100185264 223
488 3300031731 Ga0307405_10254324 Ga0307405_102543242 223
489 3300031824 Ga0307413_10001849 Ga0307413_100018492 223
490 3300031824 Ga0307413_10011843 Ga0307413_100118433 223
491 3300031824 Ga0307413_10024956 Ga0307413_100249562 223
492 3300031824 Ga0307413_10064531 Ga0307413_100645313 223
493 3300031824 Ga0307413_10189768 Ga0307413_101897681 223
494 3300031852 Ga0307410_10000503 Ga0307410_100005036 223
495 3300031852 Ga0307410_10012594 Ga0307410_100125944 223
496 3300031852 Ga0307410_10047362 Ga0307410_100473624 223
497 3300031901 Ga0307406_10004847 Ga0307406_100048476 223
498 3300031901 Ga0307406_10021374 Ga0307406_100213741 223
499 3300031901 Ga0307406_10077990 Ga0307406_100779902 223
500 3300031901 Ga0307406_10427797 Ga0307406_104277972 223
501 3300031903 Ga0307407_10001318 Ga0307407_1000131810 223
502 3300031903 Ga0307407_10006738 Ga0307407_100067384 223
503 3300031903 Ga0307407_10020398 Ga0307407_100203982 223
504 3300031903 Ga0307407_10073887 Ga0307407_100738872 223
505 3300031903 Ga0307407_10094472 Ga0307407_100944722 223
506 3300031903 Ga0307407_10263039 Ga0307407_102630391 223
507 3300031911 Ga0307412_10013368 Ga0307412_100133685 223
508 3300031911 Ga0307412_10027137 Ga0307412_100271373 223
509 3300031911 Ga0307412_10193637 Ga0307412_101936371 223
510 3300031911 Ga0307412_10430668 Ga0307412_104306682 223
511 3300031911 Ga0307412_10660468 Ga0307412_106604681 223
512 3300031995 Ga0307409_100013992 Ga0307409_1000139925 223
513 3300031995 Ga0307409_100071539 Ga0307409_1000715391 223
514 3300031995 Ga0307409_100212014 Ga0307409_1002120142 223
515 3300031995 Ga0307409_100560623 Ga0307409_1005606232 223
516 3300032002 Ga0307416_100002176 Ga0307416_1000021761 223
517 3300032002 Ga0307416_100003596 Ga0307416_1000035966 223
518 3300032002 Ga0307416_100012696 Ga0307416_1000126967 223
519 3300032002 Ga0307416_100058707 Ga0307416_1000587071 223
520 3300032002 Ga0307416_100170483 Ga0307416_1001704832 223
521 3300032002 Ga0307416_100444887 Ga0307416_1004448872 223
522 3300032002 Ga0307416_100686939 Ga0307416_1006869391 223
523 3300032002 Ga0307416_101142057 Ga0307416_1011420571 223
524 3300032004 Ga0307414_10017852 Ga0307414_100178524 223
525 3300032004 Ga0307414_10018267 Ga0307414_100182673 223
526 3300032005 Ga0307411_10037145 Ga0307411_100371453 223
527 3300032005 Ga0307411_10048558 Ga0307411_100485583 223
528 3300032126 Ga0307415_100002530 Ga0307415_1000025308 223
529 3300032126 Ga0307415_100014380 Ga0307415_1000143802 223
530 3300034820 Ga0373959_0003753 Ga0373959_0003753_1578_2249 223
531 3300035085 Ga0373929_0084512 Ga0373929_0084512_17_688 223
532 3300035086 Ga0373934_0007666 Ga0373934_0007666_2610_3302 223
533 3300035111 Ga0373923_0048442 Ga0373923_0048442_722_1435 223
534 3300035115 Ga0373941_0002720 Ga0373941_0002720_1990_2661 223
535 3300035119 Ga0373956_0022153 Ga0373956_0022153_1649_2344 223
536 3300035119 Ga0373956_0067800 Ga0373956_0067800_696_1388 223
537 3300035120 Ga0373957_0123513 Ga0373957_0123513_298_993 223
538 3300035172 Ga0373955_0005959 Ga0373955_0005959_1636_2331 223
539 3300035691 Ga0373931_0022133 Ga0373931_0022133_1387_2058 223
540 3300035724 Ga0373933_0024556 Ga0373933_0024556_1384_2079 223
541 3300035725 Ga0373947_0016511 Ga0373947_0016511_2011_2706 223
542 3300035725 Ga0373947_0097201 Ga0373947_0097201_34_729 223
543 3300036401 Ga0373937_0018717 Ga0373937_0018717_3068_3763 223
544 3300036401 Ga0373937_0051886 Ga0373937_0051886_3049_3741 223
545 3300037068 Ga0373925_0054882 Ga0373925_0054882_1819_2514 223
546 3300037068 Ga0373925_0095161 Ga0373925_0095161_630_1322 223
547 3300039437 Ga0436365_0931492 Ga0436365_0931492_8043_8729 223
548 3300042015 Ga0439462_0086906 Ga0439462_0086906_32_718 223
549 3300044684 Ga0466966_0045515 Ga0466966_0045515_797_1507 223
550 3300044694 Ga0466963_0276235 Ga0466963_0276235_337_1020 223
551 3300044842 Ga0466957_0279630 Ga0466957_0279630_371_1087 223
552 3300045836 Ga0466958_0084438 Ga0466958_0084438_55_738 223
553 3300046454 Ga0495592_0059623 Ga0495592_0059623_367_1059 223
554 3300046459 Ga0495629_0062333 Ga0495629_0062333_601_1296 223
555 3300046460 Ga0495638_0290598 Ga0495638_0290598_118_807 223
556 3300046462 Ga0495651_0102124 Ga0495651_0102124_1117_1812 223
557 3300046472 Ga0495580_0022995 Ga0495580_0022995_1212_1904 223
558 3300046473 Ga0495582_0019649 Ga0495582_0019649_1970_2662 223
559 3300046473 Ga0495582_0081482 Ga0495582_0081482_1074_1769 223
560 3300046476 Ga0495662_0192426 Ga0495662_0192426_189_884 223
561 3300046477 Ga0495664_0013060 Ga0495664_0013060_529_1221 223
562 3300046477 Ga0495664_0154740 Ga0495664_0154740_336_1031 223
563 3300046499 Ga0495594_0005649 Ga0495594_0005649_489_1184 223
564 3300046499 Ga0495594_0244070 Ga0495594_0244070_144_836 223
565 3300046511 Ga0495608_0070939 Ga0495608_0070939_809_1522 223
566 3300046514 Ga0495618_0085422 Ga0495618_0085422_163_855 223
567 3300046516 Ga0495628_0038398 Ga0495628_0038398_1835_2527 223
568 3300046516 Ga0495628_0077325 Ga0495628_0077325_854_1549 223
569 3300046517 Ga0495630_0003226 Ga0495630_0003226_8776_9471 223
570 3300046517 Ga0495630_0038958 Ga0495630_0038958_2373_3065 223
571 3300046526 Ga0495666_0023106 Ga0495666_0023106_1045_1740 223
572 3300046526 Ga0495666_0130026 Ga0495666_0130026_447_1139 223
573 3300046529 Ga0495652_0043468 Ga0495652_0043468_2125_2817 223
574 3300046531 Ga0495665_0035766 Ga0495665_0035766_1286_1978 223
575 3300046531 Ga0495665_0047420 Ga0495665_0047420_1423_2118 223
576 3300046535 Ga0495586_0042921 Ga0495586_0042921_316_1011 223
577 3300046535 Ga0495586_0050475 Ga0495586_0050475_846_1541 223
578 3300046535 Ga0495586_0138016 Ga0495586_0138016_192_887 223
579 3300046536 Ga0495587_0001658 Ga0495587_0001658_6399_7094 223
580 3300046536 Ga0495587_0001702 Ga0495587_0001702_1616_2308 223
581 3300046543 Ga0495645_0000127 Ga0495645_0000127_41397_42092 223
582 3300046543 Ga0495645_0000737 Ga0495645_0000737_4038_4730 223
583 3300046559 Ga0495667_0003111 Ga0495667_0003111_5053_5766 223
584 3300046559 Ga0495667_0117156 Ga0495667_0117156_214_909 223
585 3300046674 Ga0495588_0009726 Ga0495588_0009726_2093_2788 223
586 3300046678 Ga0495599_0004132 Ga0495599_0004132_6518_7210 223
587 3300046680 Ga0495646_0074190 Ga0495646_0074190_1203_1895 223
588 3300046681 Ga0495647_0071208 Ga0495647_0071208_373_1068 223
589 3300046683 Ga0495658_0361922 Ga0495658_0361922_135_827 223
590 3300047315 Ga0495581_0010734 Ga0495581_0010734_1612_2307 223
591 3300047315 Ga0495581_0141367 Ga0495581_0141367_328_1023 223
592 3300047317 Ga0495604_0369625 Ga0495604_0369625_210_923 223
593 3300047319 Ga0495674_0097179 Ga0495674_0097179_819_1514 223
594 3300047319 Ga0495674_0250710 Ga0495674_0250710_687_1379 223
595 3300047322 Ga0495680_0245353 Ga0495680_0245353_525_1217 223
596 3300047471 Ga0495684_0030857 Ga0495684_0030857_3110_3802 223
597 3300047471 Ga0495684_0234372 Ga0495684_0234372_313_1005 223
598 3300047673 Ga0495593_0036210 Ga0495593_0036210_1071_1766 223
599 3300048088 Ga0495602_0033360 Ga0495602_0033360_3897_4589 223
600 3300048915 Ga0496112_0014840 Ga0496112_0014840_4002_4673 223
601 3300048915 Ga0496112_0209941 Ga0496112_0209941_1172_1867 223
602 3300048918 Ga0496115_0278337 Ga0496115_0278337_477_1166 223
603 3300049569 Ga0501032_0209436 Ga0501032_0209436_252_983 223
604 3300049569 Ga0501032_0337707 Ga0501032_0337707_255_941 223
605 3300049570 Ga0501033_0009285 Ga0501033_0009285_6328_7014 223
606 3300049571 Ga0501034_0175496 Ga0501034_0175496_141_872 223
607 3300049572 Ga0501036_0008351 Ga0501036_0008351_3558_4244 223
608 3300049573 Ga0501037_0282084 Ga0501037_0282084_50_736 223
609 3300049579 Ga0501043_0130805 Ga0501043_0130805_911_1606 223
610 3300049579 Ga0501043_0617623 Ga0501043_0617623_28_714 223
611 3300049581 Ga0501047_0014525 Ga0501047_0014525_6578_7264 223
612 3300049581 Ga0501047_0119343 Ga0501047_0119343_766_1497 223
613 3300049581 Ga0501047_0193584 Ga0501047_0193584_429_1115 223
614 3300049652 Ga0501202_009468 Ga0501202_009468_11_691 223
615 3300049668 Ga0501233_004323 Ga0501233_004323_184_864 223
616 3300049669 Ga0501235_005288 Ga0501235_005288_292_972 223
617 3300049681 Ga0501251_020900 Ga0501251_020900_145_825 223
618 3300049688 Ga0501259_003055 Ga0501259_003055_1304_1984 223
619 3300049705 Ga0501225_0004285 Ga0501225_0004285_1620_2300 223
620 3300049707 Ga0501234_002527 Ga0501234_002527_579_1259 223
621 3300049744 Ga0501083_0372205 Ga0501083_0372205_163_858 223
622 3300049822 Ga0501035_0073884 Ga0501035_0073884_588_1319 223
623 3300049822 Ga0501035_0087228 Ga0501035_0087228_771_1457 223
624 3300049823 Ga0501044_0118431 Ga0501044_0118431_1141_1827 223
625 3300049823 Ga0501044_0131094 Ga0501044_0131094_746_1477 223
626 3300050507 nmdc:mga05p37_201104_c1 nmdc:mga05p37_201104_c1_237_917 223
627 3300050512 nmdc:mga0n895_13980_c1 nmdc:mga0n895_13980_c1_6255_6926 223
628 3300050513 nmdc:mga0rr50_141142_c1 nmdc:mga0rr50_141142_c1_170_850 223
629 3300050514 nmdc:mga08x19_359444_c1 nmdc:mga08x19_359444_c1_309_989 223
630 3300050515 nmdc:mga0a205_60926_c1 nmdc:mga0a205_60926_c1_167_838 223
631 3300053077 Ga0495601_0225256 Ga0495601_0225256_474_1178 223
632 3300053084 Ga0495595_0132511 Ga0495595_0132511_187_882 223
633 3300053085 Ga0495619_0108611 Ga0495619_0108611_337_1029 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03379

CcmB

CcmB protein

26

244

0.95

PF01061

ABC2_membrane

ABC-2 type transporter

24

195

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.848 5 222
7vfj-assembly1.cif.gz_B cytochrome c-type biogenesis protein ccmabcd 0.8318 5 222
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8236 5 222
7vfj-assembly1.cif.gz_B cytochrome c-type biogenesis protein ccmabcd 0.8079 5 222
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.7938 5 221
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6799 52 215 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6545 52 218 3.40.1710.10
af_P90947_382_500_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5787 142 220 1.20.120.230
af_Q96JW4_154_338_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.5411 15 185 1.10.357.20
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5231 52 215 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2V7LIW2-F1-model_v4 Heme ABC transporter permease 0.9743 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A2V7M770-F1-model_v4 Heme exporter protein B 0.9719 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A2G4FVT3-F1-model_v4 Heme exporter protein B 0.9699 3 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A6J4LHY0-F1-model_v4 Heme exporter protein B 0.9669 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A2V7PNX8-F1-model_v4 Heme exporter protein B 0.966 2 223 GO:0005886
GO:0015232
GO:0017004
GO:1903607

Feature Viewer

pLDDT pTM Quality
86.06 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map