F471084

General Info

Members Datasets Scaffolds Average Seq Length
633 429 527 81

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10281247|Ga0213872_102812472
Length 95
Sequence MRNVERPAGREGDAAPGARPAARRPFFRRHKTCPFSGPNAPKIDYKDVKLLQRFISERGKIVPSRITAVSAKKQRELSQAIKRARFLGLLPYLIQ

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2534681786 Brucella suis 92/29 Isolate Unclassified
4 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
7 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
8 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
9 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
10 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
11 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
12 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
13 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
14 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
15 2643221568 Rhizobium sp. Root564 Isolate Unclassified
16 2643221582 Rhizobium sp. Root651 Isolate Unclassified
17 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
18 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
19 2643221693 Rhizobium sp. Root491 Isolate Unclassified
20 2643221719 Rhizobium sp. Root274 Isolate Unclassified
21 2643221733 Bosea sp. Root381 Isolate Unclassified
22 2643221734 Bosea sp. Root670 Isolate Unclassified
23 2643221736 Bosea sp. Root483D1 Isolate Unclassified
24 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
25 2738543024 Aminobacter sp. AP02 Isolate Unclassified
26 2751185800 Brucella pituitosa AA2 Isolate Unclassified
27 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
28 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
29 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
30 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
31 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
32 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
33 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
34 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
35 2818991467 Bosea vestrisii 3192 Isolate Unclassified
36 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
37 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
38 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
39 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
40 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
41 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
42 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
43 2841760612 Bosea sp. Tri-49 Isolate Nodule
44 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
45 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
46 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
47 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
48 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
49 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
50 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
51 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
52 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
53 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
54 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
55 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
56 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
57 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
58 2844104063 Bosea sp. Tri-39 Isolate Nodule
59 2851182111 Bosea sp. Tri-44 Isolate Nodule
60 2851246043 Bosea sp. Tri-54 Isolate Nodule
61 2854911287 Brucella lupini LUP21 Isolate Unclassified
62 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
63 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
64 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
65 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
66 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
67 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
68 2902330777 Methylobacterium sp. 2A Isolate Unclassified
69 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
70 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
71 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
72 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
73 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
74 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
75 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
76 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
77 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
78 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
79 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
80 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
81 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
82 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
83 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
84 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
85 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
86 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
87 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
88 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
89 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
90 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
91 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
92 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
93 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
94 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
95 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
96 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
97 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
98 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
99 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
103 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
104 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
108 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
109 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
110 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
111 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
112 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
113 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
114 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
115 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
116 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
117 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
126 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
131 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
132 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
141 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
142 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
143 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
144 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
145 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
146 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
153 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
165 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
167 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
168 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
169 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
170 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
172 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
173 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
251 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
266 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
269 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
270 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
365 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
366 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
367 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
380 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
385 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
386 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
387 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
388 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
389 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
390 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
391 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
394 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
397 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
398 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
401 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
402 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
403 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
404 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
405 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
406 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
407 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
408 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
409 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
412 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
413 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 641522639 Methylobacterium sp. 4-46 Isolate Nodule
423 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
424 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
425 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
426 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
427 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
428 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
429 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.83
Metatranscriptomes 4.42
Isolates 16.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.79
Bulb 0
Endosphere 11.06
Nodule 4.42
Rhizoplane 2.37
Rhizosphere 68.56
Stem 0
Stem Tuber 0
Unclassified 12.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10043409 3300001979 Bacteria 1341
2 JGI25153J46596_10000054 3300003215 Bacteria 136806
3 JGI25153J46596_10001297 3300003215 Bacteria 14964
4 Ga0055536_1002526 3300003781 Bacteria 10248
5 Ga0055536_1005558 3300003781 Bacteria 6127
6 Ga0055530_10079380 3300003791 Bacteria 692
7 Ga0055531_10014275 3300003794 Bacteria 3589
8 Ga0070670_101212008 3300005331 Bacteria 690
9 Ga0070680_100004947 3300005336 Bacteria 10034
10 Ga0068868_100604584 3300005338 Bacteria 972
11 Ga0070660_101177696 3300005339 Bacteria 649
12 Ga0070668_100140175 3300005347 Bacteria 1948
13 Ga0070674_100610462 3300005356 Bacteria 923
14 Ga0070688_100280502 3300005365 Bacteria 1197
15 Ga0070667_101688612 3300005367 Bacteria 596
16 Ga0070714_100635006 3300005435 Bacteria 1027
17 Ga0070714_101556430 3300005435 Bacteria 646
18 Ga0070713_100110450 3300005436 Bacteria 2397
19 Ga0070713_101019747 3300005436 Bacteria 799
20 Ga0070678_100712532 3300005456 Bacteria 905
21 Ga0070681_10000725 3300005458 Bacteria 27287
22 Ga0068867_100243064 3300005459 Bacteria 1461
23 Ga0070698_100064203 3300005471 Bacteria 3700
24 Ga0070699_100078367 3300005518 Bacteria 2878
25 Ga0070679_100002589 3300005530 Bacteria 16435
26 Ga0070679_100368905 3300005530 Bacteria 1383
27 Ga0070684_102305693 3300005535 Bacteria 508
28 Ga0070665_100162416 3300005548 Bacteria 2236
29 Ga0070665_100708448 3300005548 Bacteria 1020
30 Ga0068855_100485229 3300005563 Bacteria 1345
31 Ga0068857_101998287 3300005577 Bacteria 569
32 Ga0068854_100124680 3300005578 Bacteria 1960
33 Ga0068856_100419637 3300005614 Bacteria 1358
34 Ga0068856_100794907 3300005614 Bacteria 966
35 Ga0068859_100811759 3300005617 Bacteria 1023
36 Ga0068866_10549651 3300005718 Bacteria 772
37 Ga0068863_100227987 3300005841 Bacteria 1796
38 Ga0068863_101224720 3300005841 Bacteria 757
39 Ga0068860_100392912 3300005843 Bacteria 1371
40 Ga0068860_100549647 3300005843 Bacteria 1157
41 Ga0068862_100025088 3300005844 Bacteria 5004
42 Ga0068862_102298708 3300005844 Bacteria 551
43 Ga0081455_10088701 3300005937 Bacteria 2512
44 Ga0081455_10095808 3300005937 Bacteria 2395
45 Ga0081540_1071562 3300005983 Bacteria 1601
46 Ga0081540_1192960 3300005983 Bacteria 749
47 Ga0070717_11678818 3300006028 Bacteria 575
48 Ga0075365_11124164 3300006038 Bacteria 553
49 Ga0075363_100699468 3300006048 Bacteria 612
50 Ga0075364_10177534 3300006051 Bacteria 1441
51 Ga0075364_10632579 3300006051 Bacteria 731
52 Ga0075362_10075390 3300006177 Bacteria 1547
53 Ga0075367_10467008 3300006178 Bacteria 800
54 Ga0075369_10279495 3300006186 Bacteria 777
55 Ga0075366_10082781 3300006195 Bacteria 1917
56 Ga0075366_10242502 3300006195 Bacteria 1099
57 Ga0097621_100557516 3300006237 Bacteria 1043
58 Ga0075370_10059673 3300006353 Bacteria 2172
59 Ga0075430_100099700 3300006846 Bacteria 2426
60 Ga0075430_101720585 3300006846 Bacteria 515
61 Ga0075431_100273750 3300006847 Bacteria 1710
62 Ga0075429_101169420 3300006880 Bacteria 672
63 Ga0075429_101587079 3300006880 Bacteria 569
64 Ga0068865_100001757 3300006881 Bacteria 12710
65 Ga0097620_100811729 3300006931 Bacteria 1023
66 Ga0105240_10018436 3300009093 Bacteria 9370
67 Ga0105240_10227124 3300009093 Bacteria 2171
68 Ga0105240_10233950 3300009093 Bacteria 2133
69 Ga0105240_10287039 3300009093 Bacteria 1888
70 Ga0105240_10539403 3300009093 Bacteria 1292
71 Ga0105240_10670775 3300009093 Bacteria 1134
72 Ga0105240_12756969 3300009093 Bacteria 506
73 Ga0105245_10185614 3300009098 Bacteria 1989
74 Ga0105245_10675613 3300009098 Bacteria 1064
75 Ga0105243_10438915 3300009148 Bacteria 1222
76 Ga0105243_10870946 3300009148 Bacteria 894
77 Ga0105241_11009513 3300009174 Bacteria 779
78 Ga0105242_10061433 3300009176 Bacteria 3090
79 Ga0105242_11239001 3300009176 Bacteria 767
80 Ga0105237_10078456 3300009545 Bacteria 3292
81 Ga0105237_10640511 3300009545 Bacteria 1070
82 Ga0105237_11377988 3300009545 Bacteria 711
83 Ga0105237_12088236 3300009545 Bacteria 576
84 Ga0105238_10005330 3300009551 Bacteria 12704
85 Ga0105238_10018574 3300009551 Bacteria 7079
86 Ga0105238_10090935 3300009551 Bacteria 3040
87 Ga0105238_10213092 3300009551 Bacteria 1908
88 Ga0105238_10692443 3300009551 Bacteria 1031
89 Ga0105239_10202620 3300010375 Bacteria 2223
90 Ga0105239_10231853 3300010375 Bacteria 2071
91 Ga0105239_10350476 3300010375 Bacteria 1667
92 Ga0105246_12066594 3300011119 Bacteria 551
93 Ga0157373_10471274 3300013100 Bacteria 905
94 Ga0157370_10473827 3300013104 Bacteria 1150
95 Ga0157374_10191203 3300013296 Bacteria 2002
96 Ga0157378_10097156 3300013297 Bacteria 2684
97 Ga0157378_11536890 3300013297 Bacteria 711
98 Ga0157372_10149792 3300013307 Bacteria 2692
99 Ga0157375_12694659 3300013308 Bacteria 594
100 Ga0163163_10157871 3300014325 Bacteria 2313
101 Ga0163163_10715641 3300014325 Bacteria 1065
102 Ga0163163_10975329 3300014325 Bacteria 911
103 Ga0182008_10551918 3300014497 Bacteria 640
104 Ga0157379_11148915 3300014968 Bacteria 745
105 Ga0206351_10059359 3300020077 Bacteria 1199
106 Ga0213872_10281247 3300021361 Bacteria 694
107 Ga0213876_10169237 3300021384 Bacteria 1162
108 Ga0213875_10000664 3300021388 Bacteria 27198
109 Ga0213875_10000936 3300021388 Bacteria 20989
110 Ga0213871_10235667 3300021441 Bacteria 578
111 Ga0247551_105454 3300023552 Bacteria 530
112 Ga0224572_1042937 3300024225 Bacteria 849
113 Ga0228598_1019470 3300024227 Bacteria 1337
114 Ga0209676_1000049 3300025292 Bacteria 403210
115 Ga0209758_1000119 3300025297 Bacteria 195545
116 Ga0209758_1027446 3300025297 Bacteria 2432
117 Ga0209050_1003817 3300025298 Bacteria 10753
118 Ga0209050_1024299 3300025298 Bacteria 2101
119 Ga0207426_1012533 3300025302 Bacteria 3180
120 Ga0209257_1000562 3300025304 Bacteria 63202
121 Ga0209257_1059605 3300025304 Bacteria 1041
122 Ga0209257_1067970 3300025304 Bacteria 948
123 Ga0207656_10181164 3300025321 Bacteria 1011
124 Ga0207707_10010185 3300025912 Bacteria 8159
125 Ga0207695_10160356 3300025913 Bacteria 2181
126 Ga0207695_10161430 3300025913 Bacteria 2172
127 Ga0207695_10436046 3300025913 Bacteria 1194
128 Ga0207671_10138862 3300025914 Bacteria 1871
129 Ga0207671_10922337 3300025914 Bacteria 690
130 Ga0207693_10626588 3300025915 Bacteria 836
131 Ga0207660_10070844 3300025917 Bacteria 2535
132 Ga0207652_10012935 3300025921 Bacteria 6751
133 Ga0207652_10079927 3300025921 Bacteria 2858
134 Ga0207694_10024964 3300025924 Bacteria 4541
135 Ga0207694_10040185 3300025924 Bacteria 3601
136 Ga0207694_10363852 3300025924 Bacteria 1199
137 Ga0207687_10100660 3300025927 Bacteria 2126
138 Ga0207700_10190664 3300025928 Bacteria 1722
139 Ga0207700_11292092 3300025928 Bacteria 650
140 Ga0207664_10472897 3300025929 Bacteria 1121
141 Ga0207664_11017984 3300025929 Bacteria 742
142 Ga0207709_10489966 3300025935 Bacteria 957
143 Ga0207669_10754446 3300025937 Bacteria 804
144 Ga0207704_10273532 3300025938 Bacteria 1280
145 Ga0207711_10001297 3300025941 Bacteria 23697
146 Ga0207679_10244632 3300025945 Bacteria 1522
147 Ga0207667_10576047 3300025949 Bacteria 1137
148 Ga0207667_10669004 3300025949 Bacteria 1042
149 Ga0207712_12041540 3300025961 Bacteria 513
150 Ga0207668_10171762 3300025972 Bacteria 1701
151 Ga0207668_10346843 3300025972 Bacteria 1240
152 Ga0207640_10069956 3300025981 Bacteria 2358
153 Ga0207677_11231926 3300026023 Bacteria 686
154 Ga0207639_10201199 3300026041 Bacteria 1708
155 Ga0207639_10285643 3300026041 Bacteria 1453
156 Ga0207702_10358055 3300026078 Bacteria 1398
157 Ga0207702_10381354 3300026078 Bacteria 1356
158 Ga0207702_11270860 3300026078 Bacteria 730
159 Ga0207674_10987839 3300026116 Bacteria 811
160 Ga0207675_101553532 3300026118 Bacteria 682
161 Ga0268266_10024595 3300028379 Bacteria 5123
162 Ga0268266_10793742 3300028379 Bacteria 914
163 Ga0268266_11071992 3300028379 Bacteria 780
164 Ga0268265_10054330 3300028380 Bacteria 3038
165 Ga0268264_10969109 3300028381 Bacteria 856
166 Ga0268264_11015581 3300028381 Bacteria 836
167 Ga0307515_10003572 3300028794 Bacteria 32658
168 Ga0265338_10210675 3300028800 Bacteria 1459
169 Ga0265338_10711983 3300028800 Bacteria 692
170 Ga0265330_10534558 3300031235 Bacteria 500
171 Ga0265328_10195190 3300031239 Bacteria 768
172 Ga0265329_10308718 3300031242 Bacteria 536
173 Ga0265340_10106034 3300031247 Bacteria 1303
174 Ga0265340_10149554 3300031247 Bacteria 1065
175 Ga0265331_10564416 3300031250 Bacteria 513
176 Ga0265327_10011785 3300031251 Bacteria 5980
177 Ga0265327_10097903 3300031251 Bacteria 1420
178 Ga0307513_10110991 3300031456 Bacteria 2736
179 Ga0307513_10714863 3300031456 Bacteria 707
180 Ga0307513_10755150 3300031456 Bacteria 678
181 Ga0307513_10842650 3300031456 Bacteria 623
182 Ga0307513_11102586 3300031456 Bacteria 506
183 Ga0307408_100049522 3300031548 Bacteria 3018
184 Ga0307508_10056257 3300031616 Bacteria 3484
185 Ga0307508_10080921 3300031616 Bacteria 2830
186 Ga0307508_10103405 3300031616 Bacteria 2445
187 Ga0307508_10600941 3300031616 Bacteria 702
188 Ga0307514_10069184 3300031649 Bacteria 2657
189 Ga0316575_10026120 3300031665 Bacteria 2268
190 Ga0316575_10327061 3300031665 Bacteria 651
191 Ga0316579_10173901 3300031691 Bacteria 1041
192 Ga0316578_10105549 3300031728 Bacteria 1690
193 Ga0307516_10063711 3300031730 Bacteria 3568
194 Ga0307516_10270669 3300031730 Bacteria 1385
195 Ga0307405_11341027 3300031731 Bacteria 624
196 Ga0316577_10467707 3300031733 Bacteria 717
197 Ga0307410_10083954 3300031852 Bacteria 2244
198 Ga0307407_10058233 3300031903 Bacteria 2245
199 Ga0307409_100344579 3300031995 Bacteria 1404
200 Ga0307409_100779109 3300031995 Bacteria 962
201 Ga0307416_101364959 3300032002 Bacteria 814
202 Ga0307416_101719840 3300032002 Bacteria 732
203 Ga0307411_10246740 3300032005 Bacteria 1401
204 Ga0316053_109592 3300032120 Bacteria 666
205 Ga0316585_10241630 3300032137 Bacteria 598
206 Ga0307510_10153476 3300033180 Bacteria 1916
207 Ga0307510_10248753 3300033180 Bacteria 1267
208 Ga0373934_0056229 3300035086 Bacteria 1565
209 Ga0373944_0180040 3300035089 Bacteria 758
210 Ga0373923_0144284 3300035111 Bacteria 1078
211 Ga0373923_0337349 3300035111 Bacteria 718
212 Ga0373936_0503760 3300035113 Bacteria 563
213 Ga0373953_0154987 3300035117 Bacteria 983
214 Ga0373954_0262302 3300035118 Bacteria 851
215 Ga0373956_0303823 3300035119 Bacteria 760
216 Ga0373956_0408529 3300035119 Bacteria 648
217 Ga0373957_0413401 3300035120 Bacteria 581
218 Ga0373943_0164611 3300035170 Bacteria 1210
219 Ga0373943_0318303 3300035170 Bacteria 886
220 Ga0373943_0530360 3300035170 Bacteria 690
221 Ga0373946_0019520 3300035171 Bacteria 2612
222 Ga0373955_0011197 3300035172 Bacteria 4265
223 Ga0373955_0432099 3300035172 Bacteria 802
224 Ga0373955_0680949 3300035172 Bacteria 631
225 Ga0316574_0068743 3300035398 Bacteria 2234
226 Ga0316574_0695530 3300035398 Bacteria 624
227 Ga0373924_0497012 3300035410 Bacteria 548
228 Ga0373935_0070835 3300035692 Bacteria 2248
229 Ga0373935_1228571 3300035692 Bacteria 559
230 Ga0373927_0004761 3300035695 Bacteria 9447
231 Ga0373927_0619470 3300035695 Bacteria 715
232 Ga0373933_0074919 3300035724 Bacteria 2065
233 Ga0373933_0434937 3300035724 Bacteria 857
234 Ga0373947_0067217 3300035725 Bacteria 2189
235 Ga0373937_0039463 3300036401 Bacteria 4303
236 Ga0373937_0193208 3300036401 Bacteria 1913
237 Ga0373937_0367625 3300036401 Bacteria 1364
238 Ga0373937_0406654 3300036401 Bacteria 1291
239 Ga0316582_0046611 3300036647 Bacteria 2734
240 Ga0316584_0016104 3300036712 Bacteria 5356
241 Ga0373925_0000039 3300037068 Bacteria 138537
242 Ga0373925_0455269 3300037068 Bacteria 1048
243 Ga0373925_0967496 3300037068 Bacteria 701
244 Ga0373925_1254948 3300037068 Bacteria 608
245 Ga0395899_0071704 3300037312 Bacteria 2535
246 Ga0395900_0583021 3300037418 Bacteria 1060
247 Ga0395905_1437777 3300037471 Bacteria 594
248 Ga0436364_0992577 3300037853 Bacteria 61189
249 Ga0395901_0385460 3300038443 Bacteria 1442
250 Ga0436365_0910090 3300039437 Bacteria 580
251 Ga0436365_1296229 3300039437 Bacteria 4110
252 Ga0436360_0522391 3300039438 Bacteria 1818
253 Ga0436360_0747340 3300039438 Bacteria 1299
254 Ga0436360_0800899 3300039438 Bacteria 716
255 Ga0436360_1058378 3300039438 Bacteria 2066
256 Ga0436361_0193398 3300039447 Bacteria 683
257 Ga0436361_0211622 3300039447 Bacteria 7071
258 Ga0436361_0337411 3300039447 Bacteria 545
259 Ga0436361_1163408 3300039447 Bacteria 611
260 Ga0436363_0439365 3300039450 Bacteria 914
261 Ga0436363_0589105 3300039450 Bacteria 555
262 Ga0436363_1503216 3300039450 Bacteria 775
263 Ga0436362_0481984 3300039453 Bacteria 889
264 Ga0436362_0538378 3300039453 Bacteria 2236
265 Ga0436362_0619277 3300039453 Bacteria 1107
266 Ga0436362_0745713 3300039453 Bacteria 899
267 Ga0436362_1027979 3300039453 Bacteria 823
268 Ga0451791_0264923 3300041451 Bacteria 1076
269 Ga0451791_1339744 3300041451 Bacteria 991
270 Ga0451802_0728035 3300041460 Bacteria 1215
271 Ga0451839_1022280 3300041496 Bacteria 779
272 Ga0451843_0458584 3300041509 Bacteria 582
273 Ga0451853_1943139 3300041512 Bacteria 542
274 Ga0439441_080128 3300042001 Bacteria 710
275 Ga0439432_172184 3300042006 Bacteria 632
276 Ga0439450_087306 3300042008 Bacteria 781
277 Ga0451577_0266672 3300042876 Bacteria 1551
278 Ga0466965_0872245 3300044683 Bacteria 524
279 Ga0466961_0778124 3300044693 Bacteria 572
280 Ga0453684_0000071 3300044712 Bacteria 448904
281 Ga0466957_0722891 3300044842 Bacteria 704
282 Ga0451576_0961771 3300045051 Bacteria 895
283 Ga0466958_0455317 3300045836 Bacteria 829
284 Ga0466958_0655044 3300045836 Bacteria 684
285 Ga0466967_1226913 3300045976 Bacteria 747
286 Ga0466967_1692082 3300045976 Bacteria 630
287 Ga0466967_1903338 3300045976 Bacteria 592
288 Ga0495603_0140479 3300046455 Bacteria 1405
289 Ga0495638_0012483 3300046460 Bacteria 5821
290 Ga0495638_0084207 3300046460 Bacteria 1925
291 Ga0495651_0026822 3300046462 Bacteria 4486
292 Ga0495651_0304508 3300046462 Bacteria 1068
293 Ga0495653_0202284 3300046463 Bacteria 1347
294 Ga0495582_0063452 3300046473 Bacteria 2041
295 Ga0495639_0352827 3300046475 Bacteria 739
296 Ga0495662_0104651 3300046476 Bacteria 1385
297 Ga0495664_0273983 3300046477 Bacteria 1020
298 Ga0495594_0198724 3300046499 Bacteria 1143
299 Ga0495608_0073902 3300046511 Bacteria 2222
300 Ga0495616_0092026 3300046513 Bacteria 1434
301 Ga0495628_0173299 3300046516 Bacteria 1635
302 Ga0495666_0242241 3300046526 Bacteria 823
303 Ga0495652_0381482 3300046529 Bacteria 1002
304 Ga0495665_0454023 3300046531 Bacteria 648
305 Ga0495665_0605014 3300046531 Bacteria 548
306 Ga0495640_0071068 3300046533 Bacteria 2336
307 Ga0495586_0161339 3300046535 Bacteria 1265
308 Ga0495587_0588499 3300046536 Bacteria 613
309 Ga0495645_0119239 3300046543 Bacteria 1859
310 Ga0495645_0352701 3300046543 Bacteria 947
311 Ga0495645_0397380 3300046543 Bacteria 879
312 Ga0495667_0135831 3300046559 Bacteria 1585
313 Ga0495667_0179555 3300046559 Bacteria 1359
314 Ga0495668_0696668 3300046616 Bacteria 562
315 Ga0495634_0060140 3300046642 Bacteria 2529
316 Ga0495625_0231376 3300046660 Bacteria 1207
317 Ga0495625_0287807 3300046660 Bacteria 1055
318 Ga0495625_0586770 3300046660 Bacteria 671
319 Ga0495635_0094634 3300046663 Bacteria 2042
320 Ga0495657_0099712 3300046675 Bacteria 1852
321 Ga0495599_0017765 3300046678 Bacteria 4426
322 Ga0495623_0035561 3300046679 Bacteria 3192
323 Ga0495646_0038219 3300046680 Bacteria 2965
324 Ga0495647_0291830 3300046681 Bacteria 734
325 Ga0495658_0147781 3300046683 Bacteria 1442
326 Ga0495613_0177775 3300046689 Bacteria 1508
327 Ga0495624_0258395 3300046690 Bacteria 1053
328 Ga0495589_0589180 3300046794 Bacteria 507
329 Ga0495600_0064718 3300046809 Bacteria 2390
330 Ga0495581_0186111 3300047315 Bacteria 1215
331 Ga0495604_0156077 3300047317 Bacteria 1616
332 Ga0495674_0108833 3300047319 Bacteria 2351
333 Ga0495674_1036651 3300047319 Bacteria 627
334 Ga0495672_0091393 3300047320 Bacteria 1671
335 Ga0495672_0403897 3300047320 Bacteria 624
336 Ga0495676_0243682 3300047321 Bacteria 1230
337 Ga0495680_0117368 3300047322 Bacteria 1967
338 Ga0495675_0243778 3300047444 Bacteria 1081
339 Ga0495675_0704836 3300047444 Bacteria 565
340 Ga0495684_0252871 3300047471 Bacteria 1281
341 Ga0495686_0142332 3300047472 Bacteria 1414
342 Ga0495686_0152838 3300047472 Bacteria 1354
343 Ga0495602_0042806 3300048088 Bacteria 4122
344 Ga0495602_0961494 3300048088 Bacteria 565
345 Ga0496100_0725865 3300048903 Bacteria 776
346 Ga0496104_1653446 3300048907 Bacteria 543
347 Ga0496106_0844831 3300048909 Bacteria 725
348 Ga0496107_0906420 3300048910 Bacteria 642
349 Ga0496108_1679143 3300048911 Bacteria 523
350 Ga0496109_2053333 3300048912 Bacteria 503
351 Ga0496112_1424084 3300048915 Bacteria 607
352 Ga0496121_0104182 3300048924 Bacteria 2181
353 Ga0496121_0366326 3300048924 Bacteria 955
354 Ga0496124_0238267 3300048927 Bacteria 1355
355 Ga0496125_0448328 3300048928 Bacteria 740
356 Ga0496126_0176002 3300048929 Bacteria 1820
357 Ga0496126_0362302 3300048929 Bacteria 1184
358 Ga0501308_007539 3300049128 Bacteria 1142
359 Ga0501308_009543 3300049128 Bacteria 1062
360 Ga0501309_011219 3300049129 Bacteria 1165
361 Ga0501310_017721 3300049130 Bacteria 864
362 Ga0501310_072748 3300049130 Bacteria 529
363 Ga0501305_006864 3300049161 Bacteria 1427
364 Ga0501305_024575 3300049161 Bacteria 909
365 Ga0501307_008318 3300049162 Bacteria 1163
366 Ga0501307_009009 3300049162 Bacteria 1134
367 Ga0495682_0104651 3300049460 Bacteria 1015
368 Ga0501311_025904 3300049527 Bacteria 824
369 Ga0501312_014612 3300049528 Bacteria 1105
370 Ga0501313_010428 3300049529 Bacteria 1059
371 Ga0501317_080817 3300049533 Bacteria 562
372 Ga0501318_030877 3300049534 Bacteria 729
373 Ga0501318_071047 3300049534 Bacteria 550
374 Ga0501031_0153854 3300049568 Bacteria 1503
375 Ga0501031_0723620 3300049568 Bacteria 639
376 Ga0501032_0132893 3300049569 Bacteria 1641
377 Ga0501032_0220772 3300049569 Bacteria 1233
378 Ga0501033_0002868 3300049570 Bacteria 14446
379 Ga0501033_0911454 3300049570 Bacteria 590
380 Ga0501034_0248544 3300049571 Bacteria 1723
381 Ga0501034_0272756 3300049571 Bacteria 1632
382 Ga0501034_0476746 3300049571 Bacteria 1163
383 Ga0501034_1285823 3300049571 Bacteria 608
384 Ga0501036_0004388 3300049572 Bacteria 11382
385 Ga0501036_0248625 3300049572 Bacteria 1490
386 Ga0501036_1353824 3300049572 Bacteria 578
387 Ga0501037_0005102 3300049573 Bacteria 9553
388 Ga0501037_0127547 3300049573 Bacteria 1826
389 Ga0501037_0132069 3300049573 Bacteria 1790
390 Ga0501037_0793901 3300049573 Bacteria 625
391 Ga0501038_0041189 3300049574 Bacteria 4028
392 Ga0501038_0147840 3300049574 Bacteria 1917
393 Ga0501038_0375081 3300049574 Bacteria 1104
394 Ga0501039_0000586 3300049575 Bacteria 26318
395 Ga0501039_0357081 3300049575 Bacteria 1148
396 Ga0501043_0075721 3300049579 Bacteria 2643
397 Ga0501043_0502702 3300049579 Bacteria 905
398 Ga0501043_0596008 3300049579 Bacteria 817
399 Ga0501046_0001687 3300049580 Bacteria 21108
400 Ga0501047_0019030 3300049581 Bacteria 6587
401 Ga0501047_0029240 3300049581 Bacteria 5314
402 Ga0501047_0604483 3300049581 Bacteria 918
403 Ga0501048_0951112 3300049582 Bacteria 618
404 Ga0501067_0000637 3300049583 Bacteria 18857
405 Ga0501067_0249699 3300049583 Bacteria 987
406 Ga0501067_0860177 3300049583 Bacteria 511
407 Ga0501068_0215628 3300049584 Bacteria 1219
408 Ga0501068_0508807 3300049584 Bacteria 781
409 Ga0501069_0001620 3300049585 Bacteria 11147
410 Ga0501069_0080708 3300049585 Bacteria 1832
411 Ga0501069_0176633 3300049585 Bacteria 1234
412 Ga0501070_0011494 3300049586 Bacteria 7477
413 Ga0501070_0074398 3300049586 Bacteria 2812
414 Ga0501070_0298577 3300049586 Bacteria 1312
415 Ga0501070_0330232 3300049586 Bacteria 1239
416 Ga0501070_0457682 3300049586 Bacteria 1028
417 Ga0501070_1150848 3300049586 Bacteria 597
418 Ga0501070_1187690 3300049586 Bacteria 586
419 Ga0501071_0221161 3300049587 Bacteria 1425
420 Ga0501072_0314758 3300049588 Bacteria 1244
421 Ga0501072_0672391 3300049588 Bacteria 814
422 Ga0501073_0003399 3300049589 Bacteria 11970
423 Ga0501073_0003816 3300049589 Bacteria 11308
424 Ga0501073_0029259 3300049589 Bacteria 3936
425 Ga0501073_0190384 3300049589 Bacteria 1420
426 Ga0501074_0033799 3300049590 Bacteria 3707
427 Ga0501075_0820561 3300049591 Bacteria 708
428 Ga0501075_1156816 3300049591 Bacteria 587
429 Ga0501076_0311928 3300049592 Bacteria 1290
430 Ga0501076_0476556 3300049592 Bacteria 1028
431 Ga0501076_0911163 3300049592 Bacteria 725
432 Ga0501077_0646780 3300049593 Bacteria 679
433 Ga0501079_0033800 3300049741 Bacteria 3935
434 Ga0501079_0302784 3300049741 Bacteria 1251
435 Ga0501080_0082919 3300049742 Bacteria 2978
436 Ga0501080_0114718 3300049742 Bacteria 2498
437 Ga0501080_0278707 3300049742 Bacteria 1520
438 Ga0501080_0283854 3300049742 Bacteria 1504
439 Ga0501080_0430412 3300049742 Bacteria 1184
440 Ga0501080_0483272 3300049742 Bacteria 1108
441 Ga0501083_0009245 3300049744 Bacteria 6958
442 Ga0501083_0014363 3300049744 Bacteria 5538
443 Ga0501083_0599744 3300049744 Bacteria 716
444 Ga0501035_0003442 3300049822 Bacteria 15145
445 Ga0501035_0152607 3300049822 Bacteria 2004
446 Ga0501035_1187316 3300049822 Bacteria 592
447 Ga0501044_0045787 3300049823 Bacteria 4531
448 Ga0501044_0048014 3300049823 Bacteria 4412
449 Ga0501044_0129026 3300049823 Bacteria 2524
450 Ga0501044_0142961 3300049823 Bacteria 2380
451 Ga0501044_0212080 3300049823 Bacteria 1890
452 Ga0501044_0231204 3300049823 Bacteria 1796
453 Ga0501044_0993776 3300049823 Bacteria 711
454 nmdc:mga03683_283207_c1 3300050489 Bacteria 775
455 nmdc:mga03683_71553_c1 3300050489 Bacteria 1483
456 nmdc:mga00v17_13050_c2 3300050491 Bacteria 1654
457 nmdc:mga0k408_109616_c1 3300050493 Bacteria 1631
458 nmdc:mga0k408_54580_c1 3300050493 Bacteria 2316
459 nmdc:mga06z11_816980_c1 3300050494 Bacteria 568
460 nmdc:mga05p37_114305_c1 3300050507 Bacteria 3318
461 nmdc:mga09592_1537256_c1 3300050508 Bacteria 540
462 nmdc:mga09592_365392_c1 3300050508 Bacteria 1248
463 nmdc:mga06r32_1060925_c1 3300050510 Bacteria 761
464 nmdc:mga08x19_1257716_c1 3300050514 Bacteria 524
465 nmdc:mga08x19_771932_c1 3300050514 Bacteria 682
466 nmdc:mga0sz30_31346_c1 3300050516 Bacteria 2199
467 Ga0495601_0070742 3300053077 Bacteria 2227
468 Ga0495619_0139198 3300053085 Bacteria 1670
469 Ga0495619_0374838 3300053085 Bacteria 983
470 Ga0495619_0680762 3300053085 Bacteria 700
471 Ga0500644_0008950 3300053088 Bacteria 2660
472 Ga0500646_0090176 3300053090 Bacteria 948
473 Ga0500647_0037188 3300053091 Bacteria 2329
474 Ga0500651_0051744 3300053093 Bacteria 2576
475 Ga0500651_0408585 3300053093 Bacteria 761
476 Ga0500651_0762378 3300053093 Bacteria 513
477 Ga0500566_0008660 3300053094 Bacteria 6017
478 Ga0500566_0285636 3300053094 Bacteria 784
479 Ga0500641_0096596 3300053096 Bacteria 1264
480 Ga0500555_001311 3300053103 Bacteria 7856
481 Ga0500593_002181 3300053117 Bacteria 7128
482 Ga0500595_002391 3300053119 Bacteria 9372
483 Ga0500595_080042 3300053119 Bacteria 957
484 Ga0500608_023066 3300053122 Bacteria 2892
485 Ga0500614_082332 3300053123 Bacteria 903
486 Ga0500642_0001084 3300053130 Bacteria 7809
487 Ga0500642_0213759 3300053130 Bacteria 894
488 Ga0500642_0236937 3300053130 Bacteria 842
489 Ga0500642_0317425 3300053130 Bacteria 699
490 Ga0500652_167741 3300053131 Bacteria 905
491 Ga0500652_405374 3300053131 Bacteria 503
492 Ga0500658_0057978 3300053134 Bacteria 1602
493 Ga0500658_0316388 3300053134 Bacteria 717
494 Ga0500559_0125598 3300053136 Bacteria 1195
495 Ga0500568_0000001 3300053139 Bacteria 988705
496 Ga0500568_0066611 3300053139 Bacteria 1384
497 Ga0500577_0124830 3300053142 Bacteria 1074
498 Ga0500577_0390602 3300053142 Bacteria 609
499 Ga0500588_0257162 3300053146 Bacteria 656
500 Ga0500604_0078306 3300053151 Bacteria 1064
501 Ga0500616_0000806 3300053153 Bacteria 35829
502 Ga0500616_0358423 3300053153 Bacteria 591
503 Ga0500622_0000695 3300053156 Bacteria 29628
504 Ga0500627_0213537 3300053158 Bacteria 863
505 Ga0500611_042214 3300053727 Bacteria 1007
506 Ga0500609_006801 3300053731 Bacteria 1552
507 Ga0500656_065166 3300053732 Bacteria 553
508 Ga0500599_027757 3300053736 Bacteria 830
509 Ga0501084_0029932 3300054114 Bacteria 4554
510 Ga0501084_0071268 3300054114 Bacteria 2910
511 Ga0501084_0672841 3300054114 Bacteria 873
512 Ga0590071_089889 3300059421 Bacteria 768
513 Ga0590074_012761 3300059423 Bacteria 1415
514 Ga0587070_234709 3300059491 Bacteria 503
515 Ga0587082_085620 3300059504 Bacteria 664
516 Ga0587085_184392 3300059506 Bacteria 502
517 Ga0587106_035783 3300059605 Bacteria 820
518 Ga0587109_137226 3300059624 Bacteria 594
519 Ga0587115_011982 3300059626 Bacteria 1101
520 Ga0587068_123033 3300059641 Bacteria 565
521 Ga0587111_0009514 3300060346 Bacteria 1641
522 Ga0587111_0023461 3300060346 Bacteria 1207
523 Ga0587111_0211827 3300060346 Bacteria 555
524 Ga0501082_0173578 3300060353 Bacteria 1874
525 Ga0501082_0253349 3300060353 Bacteria 1531
526 Ga0501082_0349394 3300060353 Bacteria 1289
527 Ga0501082_0752659 3300060353 Bacteria 853

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100243064 Ga0068867_1002430643 64
2 3300005841 Ga0068863_100227987 Ga0068863_1002279872 64
3 3300006237 Ga0097621_100557516 Ga0097621_1005575163 64
4 3300006881 Ga0068865_100001757 Ga0068865_1000017574 64
5 3300009176 Ga0105242_10061433 Ga0105242_100614332 64
6 3300013297 Ga0157378_11536890 Ga0157378_115368902 64
7 3300014325 Ga0163163_10157871 Ga0163163_101578714 64
8 3300025321 Ga0207656_10181164 Ga0207656_101811642 64
9 3300025938 Ga0207704_10273532 Ga0207704_102735321 64
10 3300025941 Ga0207711_10001297 Ga0207711_1000129716 64
11 3300031251 Ga0265327_10097903 Ga0265327_100979032 64
12 3300031616 Ga0307508_10600941 Ga0307508_106009412 64
13 3300035170 Ga0373943_0530360 Ga0373943_0530360_272_550 64
14 3300035171 Ga0373946_0019520 Ga0373946_0019520_2045_2323 64
15 3300035695 Ga0373927_0004761 Ga0373927_0004761_3447_3725 64
16 3300035725 Ga0373947_0067217 Ga0373947_0067217_1485_1763 64
17 3300037068 Ga0373925_0000039 Ga0373925_0000039_122532_122810 64
18 3300046462 Ga0495651_0304508 Ga0495651_0304508_341_619 64
19 3300046516 Ga0495628_0173299 Ga0495628_0173299_282_560 64
20 3300046531 Ga0495665_0605014 Ga0495665_0605014_105_383 64
21 3300046543 Ga0495645_0119239 Ga0495645_0119239_457_735 64
22 3300047319 Ga0495674_1036651 Ga0495674_1036651_309_587 64
23 3300048903 Ga0496100_0725865 Ga0496100_0725865_347_625 64
24 3300049161 Ga0501305_024575 Ga0501305_024575_501_788 64
25 3300049581 Ga0501047_0604483 Ga0501047_0604483_95_382 64
26 3300031247 Ga0265340_10149554 Ga0265340_101495542 65
27 3300037068 Ga0373925_0967496 Ga0373925_0967496_411_680 65
28 3300006846 Ga0075430_101720585 Ga0075430_1017205852 66
29 3300006847 Ga0075431_100273750 Ga0075431_1002737502 66
30 3300006880 Ga0075429_101169420 Ga0075429_1011694202 66
31 3300009148 Ga0105243_10870946 Ga0105243_108709462 66
32 3300025935 Ga0207709_10489966 Ga0207709_104899662 66
33 3300031548 Ga0307408_100049522 Ga0307408_1000495225 66
34 3300031731 Ga0307405_11341027 Ga0307405_113410271 66
35 3300031852 Ga0307410_10083954 Ga0307410_100839542 66
36 3300031903 Ga0307407_10058233 Ga0307407_100582334 66
37 3300031995 Ga0307409_100779109 Ga0307409_1007791092 66
38 3300032002 Ga0307416_101364959 Ga0307416_1013649592 66
39 3300032005 Ga0307411_10246740 Ga0307411_102467402 66
40 3300042006 Ga0439432_172184 Ga0439432_172184_197_469 66
41 3300042008 Ga0439450_087306 Ga0439450_087306_484_756 66
42 3300042876 Ga0451577_0266672 Ga0451577_0266672_104_403 66
43 3300046660 Ga0495625_0586770 Ga0495625_0586770_172_444 66
44 3300049128 Ga0501308_009543 Ga0501308_009543_373_645 66
45 3300049129 Ga0501309_011219 Ga0501309_011219_504_776 66
46 3300049130 Ga0501310_017721 Ga0501310_017721_378_650 66
47 3300049161 Ga0501305_006864 Ga0501305_006864_679_951 66
48 3300049162 Ga0501307_008318 Ga0501307_008318_378_650 66
49 3300049527 Ga0501311_025904 Ga0501311_025904_18_290 66
50 3300049528 Ga0501312_014612 Ga0501312_014612_542_814 66
51 3300049534 Ga0501318_030877 Ga0501318_030877_194_466 66
52 3300049592 Ga0501076_0911163 Ga0501076_0911163_419_691 66
53 3300050489 nmdc:mga03683_283207_c1 nmdc:mga03683_283207_c1_429_701 66
54 3300050508 nmdc:mga09592_365392_c1 nmdc:mga09592_365392_c1_293_565 66
55 3300050510 nmdc:mga06r32_1060925_c1 nmdc:mga06r32_1060925_c1_79_351 66
56 3300059421 Ga0590071_089889 Ga0590071_089889_193_465 66
57 3300059423 Ga0590074_012761 Ga0590074_012761_952_1224 66
58 3300060353 Ga0501082_0752659 Ga0501082_0752659_542_814 66
59 3300005983 Ga0081540_1192960 Ga0081540_11929601 67
60 3300006846 Ga0075430_100099700 Ga0075430_1000997002 67
61 3300049591 Ga0501075_0820561 Ga0501075_0820561_174_443 67
62 3300050507 nmdc:mga05p37_114305_c1 nmdc:mga05p37_114305_c1_1019_1291 67
63 3300053130 Ga0500642_0001084 Ga0500642_0001084_889_1194 67
64 3300009093 Ga0105240_10539403 Ga0105240_105394032 68
65 3300009551 Ga0105238_10005330 Ga0105238_100053304 68
66 3300021388 Ga0213875_10000664 Ga0213875_1000066412 68
67 3300025924 Ga0207694_10040185 Ga0207694_100401854 68
68 3300025945 Ga0207679_10244632 Ga0207679_102446322 68
69 3300026041 Ga0207639_10201199 Ga0207639_102011993 68
70 3300031995 Ga0307409_100344579 Ga0307409_1003445792 68
71 3300013100 Ga0157373_10471274 Ga0157373_104712742 69
72 3300023552 Ga0247551_105454 Ga0247551_1054542 69
73 3300026078 Ga0207702_10381354 Ga0207702_103813542 69
74 3300032120 Ga0316053_109592 Ga0316053_1095921 69
75 3300037471 Ga0395905_1437777 Ga0395905_1437777_255_545 69
76 3300041509 Ga0451843_0458584 Ga0451843_0458584_15_320 69
77 3300044683 Ga0466965_0872245 Ga0466965_0872245_28_267 69
78 3300049579 Ga0501043_0596008 Ga0501043_0596008_159_446 69
79 3300003791 Ga0055530_10079380 Ga0055530_100793801 70
80 3300003794 Ga0055531_10014275 Ga0055531_100142755 70
81 3300005617 Ga0068859_100811759 Ga0068859_1008117591 70
82 3300005843 Ga0068860_100549647 Ga0068860_1005496472 70
83 3300005844 Ga0068862_100025088 Ga0068862_1000250884 70
84 3300006178 Ga0075367_10467008 Ga0075367_104670082 70
85 3300006195 Ga0075366_10082781 Ga0075366_100827813 70
86 3300006931 Ga0097620_100811729 Ga0097620_1008117291 70
87 3300025298 Ga0209050_1003817 Ga0209050_10038174 70
88 3300025302 Ga0207426_1012533 Ga0207426_10125333 70
89 3300025304 Ga0209257_1000562 Ga0209257_100056247 70
90 3300025961 Ga0207712_12041540 Ga0207712_120415401 70
91 3300026041 Ga0207639_10285643 Ga0207639_102856433 70
92 3300028379 Ga0268266_11071992 Ga0268266_110719922 70
93 3300028380 Ga0268265_10054330 Ga0268265_100543302 70
94 3300028381 Ga0268264_10969109 Ga0268264_109691092 70
95 3300031242 Ga0265329_10308718 Ga0265329_103087181 70
96 3300031251 Ga0265327_10011785 Ga0265327_100117853 70
97 3300033180 Ga0307510_10153476 Ga0307510_101534762 70
98 3300039447 Ga0436361_0193398 Ga0436361_0193398_229_534 70
99 3300041451 Ga0451791_1339744 Ga0451791_1339744_27_263 70
100 3300041460 Ga0451802_0728035 Ga0451802_0728035_87_323 70
101 3300042001 Ga0439441_080128 Ga0439441_080128_172_405 70
102 3300044712 Ga0453684_0000071 Ga0453684_0000071_360835_361110 70
103 3300046513 Ga0495616_0092026 Ga0495616_0092026_915_1220 70
104 3300046660 Ga0495625_0287807 Ga0495625_0287807_83_391 70
105 3300047472 Ga0495686_0152838 Ga0495686_0152838_88_324 70
106 3300049573 Ga0501037_0127547 Ga0501037_0127547_1461_1760 70
107 3300050494 nmdc:mga06z11_816980_c1 nmdc:mga06z11_816980_c1_213_515 70
108 3300050514 nmdc:mga08x19_1257716_c1 nmdc:mga08x19_1257716_c1_183_416 70
109 3300053103 Ga0500555_001311 Ga0500555_001311_5087_5323 70
110 3300053130 Ga0500642_0213759 Ga0500642_0213759_170_475 70
111 3300053130 Ga0500642_0317425 Ga0500642_0317425_170_472 70
112 3300053134 Ga0500658_0316388 Ga0500658_0316388_29_331 70
113 3300053139 Ga0500568_0066611 Ga0500568_0066611_93_398 70
114 3300053151 Ga0500604_0078306 Ga0500604_0078306_418_720 70
115 3300053153 Ga0500616_0000806 Ga0500616_0000806_26905_27204 70
116 3300053727 Ga0500611_042214 Ga0500611_042214_107_412 70
117 3300053731 Ga0500609_006801 Ga0500609_006801_125_430 70
118 3300053732 Ga0500656_065166 Ga0500656_065166_100_405 70
119 3300053736 Ga0500599_027757 Ga0500599_027757_205_513 70
120 3300060346 Ga0587111_0009514 Ga0587111_0009514_614_913 70
121 iso_pu_bacteria 2643221733 2644728724 70
122 iso_pu_bacteria 2643221734 2644735936 70
123 iso_pu_bacteria 2643221736 2644747199 70
124 iso_pu_bacteria 2818991439 2819560238 70
125 iso_pu_bacteria 2818991467 2819718131 70
126 iso_pu_bacteria 2821123053 2821128286 70
127 iso_pu_bacteria 2841760612 2841762065 70
128 iso_pu_bacteria 2841911363 2841916508 70
129 iso_pu_bacteria 2841917233 2841922405 70
130 iso_pu_bacteria 2844104063 2844105090 70
131 iso_pu_bacteria 2851182111 2851183430 70
132 iso_pu_bacteria 2851246043 2851248078 70
133 iso_pu_bacteria 2894817345 2894819714 70
134 iso_pu_bacteria 2917699015 2917699451 70
135 iso_pu_bacteria 8057529695 8057529772 70
136 3300003215 JGI25153J46596_10000054 JGI25153J46596_10000054134 71
137 3300003215 JGI25153J46596_10001297 JGI25153J46596_1000129715 71
138 3300005435 Ga0070714_101556430 Ga0070714_1015564302 71
139 3300005841 Ga0068863_101224720 Ga0068863_1012247202 71
140 3300005937 Ga0081455_10088701 Ga0081455_100887013 71
141 3300005983 Ga0081540_1071562 Ga0081540_10715622 71
142 3300006353 Ga0075370_10059673 Ga0075370_100596733 71
143 3300021384 Ga0213876_10169237 Ga0213876_101692371 71
144 3300025297 Ga0209758_1000119 Ga0209758_1000119179 71
145 3300025297 Ga0209758_1027446 Ga0209758_10274462 71
146 3300025304 Ga0209257_1059605 Ga0209257_10596052 71
147 3300025304 Ga0209257_1067970 Ga0209257_10679702 71
148 3300025929 Ga0207664_10472897 Ga0207664_104728971 71
149 3300026116 Ga0207674_10987839 Ga0207674_109878392 71
150 3300031616 Ga0307508_10056257 Ga0307508_100562574 71
151 3300031730 Ga0307516_10270669 Ga0307516_102706692 71
152 3300035398 Ga0316574_0695530 Ga0316574_0695530_271_510 71
153 3300039437 Ga0436365_1296229 Ga0436365_1296229_613_849 71
154 3300039438 Ga0436360_0522391 Ga0436360_0522391_137_373 71
155 3300039438 Ga0436360_0800899 Ga0436360_0800899_451_687 71
156 3300039447 Ga0436361_1163408 Ga0436361_1163408_279_515 71
157 3300039450 Ga0436363_0439365 Ga0436363_0439365_124_360 71
158 3300049568 Ga0501031_0153854 Ga0501031_0153854_720_998 71
159 3300049568 Ga0501031_0723620 Ga0501031_0723620_280_576 71
160 3300049569 Ga0501032_0132893 Ga0501032_0132893_881_1180 71
161 3300049569 Ga0501032_0220772 Ga0501032_0220772_917_1195 71
162 3300049570 Ga0501033_0002868 Ga0501033_0002868_10077_10355 71
163 3300049571 Ga0501034_0248544 Ga0501034_0248544_237_536 71
164 3300049571 Ga0501034_0272756 Ga0501034_0272756_435_731 71
165 3300049571 Ga0501034_1285823 Ga0501034_1285823_39_317 71
166 3300049572 Ga0501036_0004388 Ga0501036_0004388_9295_9573 71
167 3300049572 Ga0501036_0248625 Ga0501036_0248625_546_845 71
168 3300049573 Ga0501037_0005102 Ga0501037_0005102_1619_1897 71
169 3300049573 Ga0501037_0793901 Ga0501037_0793901_247_546 71
170 3300049574 Ga0501038_0041189 Ga0501038_0041189_38_316 71
171 3300049574 Ga0501038_0147840 Ga0501038_0147840_1436_1735 71
172 3300049574 Ga0501038_0375081 Ga0501038_0375081_431_727 71
173 3300049575 Ga0501039_0000586 Ga0501039_0000586_5639_5917 71
174 3300049575 Ga0501039_0357081 Ga0501039_0357081_603_902 71
175 3300049579 Ga0501043_0075721 Ga0501043_0075721_868_1146 71
176 3300049579 Ga0501043_0502702 Ga0501043_0502702_368_667 71
177 3300049580 Ga0501046_0001687 Ga0501046_0001687_167_445 71
178 3300049581 Ga0501047_0019030 Ga0501047_0019030_5637_5936 71
179 3300049581 Ga0501047_0029240 Ga0501047_0029240_4005_4283 71
180 3300049582 Ga0501048_0951112 Ga0501048_0951112_239_535 71
181 3300049583 Ga0501067_0000637 Ga0501067_0000637_2575_2853 71
182 3300049583 Ga0501067_0249699 Ga0501067_0249699_606_905 71
183 3300049584 Ga0501068_0215628 Ga0501068_0215628_383_679 71
184 3300049584 Ga0501068_0508807 Ga0501068_0508807_185_484 71
185 3300049585 Ga0501069_0001620 Ga0501069_0001620_1940_2218 71
186 3300049585 Ga0501069_0080708 Ga0501069_0080708_508_807 71
187 3300049586 Ga0501070_0011494 Ga0501070_0011494_4168_4446 71
188 3300049586 Ga0501070_0074398 Ga0501070_0074398_2478_2777 71
189 3300049588 Ga0501072_0314758 Ga0501072_0314758_330_608 71
190 3300049588 Ga0501072_0672391 Ga0501072_0672391_485_784 71
191 3300049589 Ga0501073_0003399 Ga0501073_0003399_4168_4446 71
192 3300049589 Ga0501073_0029259 Ga0501073_0029259_1560_1856 71
193 3300049590 Ga0501074_0033799 Ga0501074_0033799_1811_2089 71
194 3300049592 Ga0501076_0311928 Ga0501076_0311928_699_977 71
195 3300049592 Ga0501076_0476556 Ga0501076_0476556_318_617 71
196 3300049741 Ga0501079_0033800 Ga0501079_0033800_2862_3140 71
197 3300049741 Ga0501079_0302784 Ga0501079_0302784_528_827 71
198 3300049742 Ga0501080_0278707 Ga0501080_0278707_982_1281 71
199 3300049742 Ga0501080_0283854 Ga0501080_0283854_597_893 71
200 3300049742 Ga0501080_0430412 Ga0501080_0430412_868_1146 71
201 3300049744 Ga0501083_0014363 Ga0501083_0014363_4297_4596 71
202 3300049744 Ga0501083_0599744 Ga0501083_0599744_292_570 71
203 3300049822 Ga0501035_0003442 Ga0501035_0003442_10863_11141 71
204 3300049822 Ga0501035_1187316 Ga0501035_1187316_68_364 71
205 3300049823 Ga0501044_0045787 Ga0501044_0045787_3586_3885 71
206 3300049823 Ga0501044_0048014 Ga0501044_0048014_1451_1729 71
207 3300049823 Ga0501044_0231204 Ga0501044_0231204_747_1043 71
208 3300050493 nmdc:mga0k408_54580_c1 nmdc:mga0k408_54580_c1_191_487 71
209 3300054114 Ga0501084_0029932 Ga0501084_0029932_4107_4385 71
210 3300054114 Ga0501084_0071268 Ga0501084_0071268_276_575 71
211 3300059626 Ga0587115_011982 Ga0587115_011982_504_743 71
212 3300060346 Ga0587111_0023461 Ga0587111_0023461_544_783 71
213 3300060353 Ga0501082_0173578 Ga0501082_0173578_1525_1824 71
214 3300060353 Ga0501082_0253349 Ga0501082_0253349_126_404 71
215 iso_pu_bacteria 2510461069 2510839688 71
216 iso_pu_bacteria 2511231027 2511392639 71
217 iso_pu_bacteria 2534681786 2535484217 71
218 iso_pu_bacteria 2537561587 2537874082 71
219 iso_pu_bacteria 2554235003 2554247115 71
220 iso_pu_bacteria 2558860242 2559294339 71
221 iso_pu_bacteria 2599185210 2599602596 71
222 iso_pu_bacteria 2600255279 2601608676 71
223 iso_pu_bacteria 2600255308 2601745450 71
224 iso_pu_bacteria 2643221550 2643770162 71
225 iso_pu_bacteria 2643221551 2643774924 71
226 iso_pu_bacteria 2643221555 2643793368 71
227 iso_pu_bacteria 2643221568 2643855866 71
228 iso_pu_bacteria 2643221582 2643918713 71
229 iso_pu_bacteria 2643221623 2644132918 71
230 iso_pu_bacteria 2643221653 2644296830 71
231 iso_pu_bacteria 2643221693 2644518743 71
232 iso_pu_bacteria 2643221719 2644655084 71
233 iso_pu_bacteria 2671180139 2671692878 71
234 iso_pu_bacteria 2738543024 2739306459 71
235 iso_pu_bacteria 2751185800 2753358808 71
236 iso_pu_bacteria 2758568016 2758641042 71
237 iso_pu_bacteria 2765235802 2765465201 71
238 iso_pu_bacteria 2767802442 2770197348 71
239 iso_pu_bacteria 2775506902 2776271945 71
240 iso_pu_bacteria 2775506904 2776279538 71
241 iso_pu_bacteria 2808606387 2808985888 71
242 iso_pu_bacteria 2818991272 2819242542 71
243 iso_pu_bacteria 2818991439 2819556007 71
244 iso_pu_bacteria 2838675328 2838676734 71
245 iso_pu_bacteria 2838714209 2838715618 71
246 iso_pu_bacteria 2838719591 2838720582 71
247 iso_pu_bacteria 2838724970 2838726374 71
248 iso_pu_bacteria 2839993093 2839995893 71
249 iso_pu_bacteria 2841846520 2841847517 71
250 iso_pu_bacteria 2841859092 2841859946 71
251 iso_pu_bacteria 2842124991 2842126453 71
252 iso_pu_bacteria 2842130223 2842131627 71
253 iso_pu_bacteria 2842152218 2842153204 71
254 iso_pu_bacteria 2842170452 2842171861 71
255 iso_pu_bacteria 2842175837 2842176823 71
256 iso_pu_bacteria 2842187318 2842188726 71
257 iso_pu_bacteria 2842211629 2842213037 71
258 iso_pu_bacteria 2842224351 2842225344 71
259 iso_pu_bacteria 2842515876 2842516731 71
260 iso_pu_bacteria 2842871566 2842874505 71
261 iso_pu_bacteria 2854911287 2854914384 71
262 iso_pu_bacteria 2889790730 2889794247 71
263 iso_pu_bacteria 2889914905 2889916795 71
264 iso_pu_bacteria 2894652903 2894654875 71
265 iso_pu_bacteria 2899792073 2899796606 71
266 iso_pu_bacteria 2899845264 2899847132 71
267 iso_pu_bacteria 2904578770 2904581371 71
268 iso_pu_bacteria 2915650412 2915651267 71
269 iso_pu_bacteria 2919114240 2919115820 71
270 iso_pu_bacteria 2919119836 2919122608 71
271 iso_pu_bacteria 2919166419 2919167368 71
272 iso_pu_bacteria 2919171160 2919171421 71
273 iso_pu_bacteria 2926754445 2926756761 71
274 iso_pu_bacteria 2926760298 2926760999 71
275 iso_pu_bacteria 2928521798 2928524667 71
276 iso_pu_bacteria 2929138655 2929139523 71
277 iso_pu_bacteria 2933006813 2933007847 71
278 iso_pu_bacteria 2933011516 2933012627 71
279 iso_pu_bacteria 2933594066 2933595067 71
280 iso_pu_bacteria 2954011201 2954015141 71
281 iso_pu_bacteria 2978969890 2978973799 71
282 iso_pu_bacteria 2979089926 2979093724 71
283 iso_pu_bacteria 2979095461 2979098893 71
284 iso_pu_bacteria 2979100975 2979105700 71
285 iso_pu_bacteria 2984509177 2984512453 71
286 iso_pu_bacteria 2984518228 2984521186 71
287 iso_pu_bacteria 2984537506 2984540480 71
288 iso_pu_bacteria 2984587000 2984589148 71
289 iso_pu_bacteria 2984601300 2984602677 71
290 iso_pu_bacteria 2989776772 2989778182 71
291 iso_pu_bacteria 3002141150 3002143341 71
292 iso_pu_bacteria 643348564 643602280 71
293 iso_pu_bacteria 650716007 650739534 71
294 iso_pu_bacteria 8002285264 8002287801 71
295 iso_pu_bacteria 8003570095 8003570580 71
296 iso_pu_bacteria 8005246636 8005251317 71
297 iso_pu_bacteria 8054563764 8054567671 71
298 3300003781 Ga0055536_1005558 Ga0055536_10055585 72
299 3300005331 Ga0070670_101212008 Ga0070670_1012120082 72
300 3300005435 Ga0070714_100635006 Ga0070714_1006350062 72
301 3300005436 Ga0070713_100110450 Ga0070713_1001104504 72
302 3300005436 Ga0070713_101019747 Ga0070713_1010197472 72
303 3300005548 Ga0070665_100162416 Ga0070665_1001624162 72
304 3300005548 Ga0070665_100708448 Ga0070665_1007084482 72
305 3300005577 Ga0068857_101998287 Ga0068857_1019982871 72
306 3300005718 Ga0068866_10549651 Ga0068866_105496512 72
307 3300006028 Ga0070717_11678818 Ga0070717_116788182 72
308 3300006177 Ga0075362_10075390 Ga0075362_100753902 72
309 3300006186 Ga0075369_10279495 Ga0075369_102794952 72
310 3300006195 Ga0075366_10242502 Ga0075366_102425022 72
311 3300009093 Ga0105240_12756969 Ga0105240_127569692 72
312 3300009545 Ga0105237_11377988 Ga0105237_113779882 72
313 3300009545 Ga0105237_12088236 Ga0105237_120882362 72
314 3300010375 Ga0105239_10231853 Ga0105239_102318533 72
315 3300010375 Ga0105239_10350476 Ga0105239_103504763 72
316 3300013297 Ga0157378_10097156 Ga0157378_100971561 72
317 3300025292 Ga0209676_1000049 Ga0209676_1000049281 72
318 3300025298 Ga0209050_1024299 Ga0209050_10242994 72
319 3300025914 Ga0207671_10922337 Ga0207671_109223372 72
320 3300025915 Ga0207693_10626588 Ga0207693_106265882 72
321 3300025924 Ga0207694_10363852 Ga0207694_103638522 72
322 3300025928 Ga0207700_10190664 Ga0207700_101906644 72
323 3300025928 Ga0207700_11292092 Ga0207700_112920922 72
324 3300025929 Ga0207664_11017984 Ga0207664_110179842 72
325 3300025972 Ga0207668_10346843 Ga0207668_103468432 72
326 3300026023 Ga0207677_11231926 Ga0207677_112319262 72
327 3300028379 Ga0268266_10793742 Ga0268266_107937422 72
328 3300028800 Ga0265338_10711983 Ga0265338_107119832 72
329 3300031235 Ga0265330_10534558 Ga0265330_105345582 72
330 3300031239 Ga0265328_10195190 Ga0265328_101951901 72
331 3300031247 Ga0265340_10106034 Ga0265340_101060343 72
332 3300031616 Ga0307508_10080921 Ga0307508_100809213 72
333 3300031665 Ga0316575_10026120 Ga0316575_100261203 72
334 3300031728 Ga0316578_10105549 Ga0316578_101055492 72
335 3300031733 Ga0316577_10467707 Ga0316577_104677072 72
336 3300032002 Ga0307416_101719840 Ga0307416_1017198401 72
337 3300032137 Ga0316585_10241630 Ga0316585_102416301 72
338 3300033180 Ga0307510_10248753 Ga0307510_102487532 72
339 3300035086 Ga0373934_0056229 Ga0373934_0056229_763_1005 72
340 3300035113 Ga0373936_0503760 Ga0373936_0503760_121_363 72
341 3300035119 Ga0373956_0408529 Ga0373956_0408529_142_384 72
342 3300035170 Ga0373943_0164611 Ga0373943_0164611_945_1187 72
343 3300035172 Ga0373955_0680949 Ga0373955_0680949_168_410 72
344 3300035398 Ga0316574_0068743 Ga0316574_0068743_292_537 72
345 3300035410 Ga0373924_0497012 Ga0373924_0497012_168_410 72
346 3300035692 Ga0373935_0070835 Ga0373935_0070835_1435_1677 72
347 3300035692 Ga0373935_1228571 Ga0373935_1228571_169_480 72
348 3300035724 Ga0373933_0434937 Ga0373933_0434937_50_292 72
349 3300036401 Ga0373937_0039463 Ga0373937_0039463_115_357 72
350 3300036401 Ga0373937_0193208 Ga0373937_0193208_778_1089 72
351 3300036401 Ga0373937_0367625 Ga0373937_0367625_916_1158 72
352 3300036647 Ga0316582_0046611 Ga0316582_0046611_1221_1466 72
353 3300036712 Ga0316584_0016104 Ga0316584_0016104_3862_4107 72
354 3300037068 Ga0373925_0455269 Ga0373925_0455269_466_708 72
355 3300039453 Ga0436362_0745713 Ga0436362_0745713_554_811 72
356 3300041451 Ga0451791_0264923 Ga0451791_0264923_196_435 72
357 3300046477 Ga0495664_0273983 Ga0495664_0273983_742_984 72
358 3300046535 Ga0495586_0161339 Ga0495586_0161339_660_902 72
359 3300046536 Ga0495587_0588499 Ga0495587_0588499_77_319 72
360 3300046543 Ga0495645_0397380 Ga0495645_0397380_559_801 72
361 3300046559 Ga0495667_0179555 Ga0495667_0179555_1101_1343 72
362 3300047320 Ga0495672_0091393 Ga0495672_0091393_1373_1612 72
363 3300047444 Ga0495675_0704836 Ga0495675_0704836_261_503 72
364 3300048088 Ga0495602_0961494 Ga0495602_0961494_298_540 72
365 3300048911 Ga0496108_1679143 Ga0496108_1679143_181_420 72
366 3300048912 Ga0496109_2053333 Ga0496109_2053333_217_456 72
367 3300048924 Ga0496121_0104182 Ga0496121_0104182_734_973 72
368 3300048928 Ga0496125_0448328 Ga0496125_0448328_478_717 72
369 3300048929 Ga0496126_0176002 Ga0496126_0176002_565_804 72
370 3300049571 Ga0501034_0476746 Ga0501034_0476746_681_920 72
371 3300049572 Ga0501036_1353824 Ga0501036_1353824_328_567 72
372 3300049573 Ga0501037_0132069 Ga0501037_0132069_456_764 72
373 3300049583 Ga0501067_0860177 Ga0501067_0860177_131_439 72
374 3300049586 Ga0501070_0330232 Ga0501070_0330232_577_885 72
375 3300049586 Ga0501070_1150848 Ga0501070_1150848_67_306 72
376 3300049589 Ga0501073_0003816 Ga0501073_0003816_4139_4447 72
377 3300049589 Ga0501073_0190384 Ga0501073_0190384_697_936 72
378 3300049742 Ga0501080_0082919 Ga0501080_0082919_1132_1440 72
379 3300049744 Ga0501083_0009245 Ga0501083_0009245_2309_2617 72
380 3300049823 Ga0501044_0129026 Ga0501044_0129026_1114_1353 72
381 3300049823 Ga0501044_0212080 Ga0501044_0212080_638_946 72
382 3300049823 Ga0501044_0993776 Ga0501044_0993776_447_686 72
383 3300050489 nmdc:mga03683_71553_c1 nmdc:mga03683_71553_c1_1081_1320 72
384 3300050493 nmdc:mga0k408_109616_c1 nmdc:mga0k408_109616_c1_530_769 72
385 3300050516 nmdc:mga0sz30_31346_c1 nmdc:mga0sz30_31346_c1_903_1142 72
386 3300053085 Ga0495619_0680762 Ga0495619_0680762_198_440 72
387 3300053117 Ga0500593_002181 Ga0500593_002181_4597_4845 72
388 3300053136 Ga0500559_0125598 Ga0500559_0125598_624_863 72
389 3300053139 Ga0500568_0000001 Ga0500568_0000001_327450_327698 72
390 3300054114 Ga0501084_0672841 Ga0501084_0672841_99_407 72
391 3300059491 Ga0587070_234709 Ga0587070_234709_141_380 72
392 3300060353 Ga0501082_0349394 Ga0501082_0349394_659_967 72
393 iso_pu_bacteria 2545555834 2545676864 72
394 iso_pu_bacteria 2595698237 2596377010 72
395 iso_pu_bacteria 2828305725 2828307052 72
396 iso_pu_bacteria 2902330777 2902334713 72
397 iso_pu_bacteria 2902405164 2902405766 72
398 iso_pu_bacteria 2928125067 2928125114 72
399 iso_pu_bacteria 3003665799 3003666502 72
400 iso_pu_bacteria 641522639 641642805 72
401 3300006038 Ga0075365_11124164 Ga0075365_111241641 73
402 3300006048 Ga0075363_100699468 Ga0075363_1006994681 73
403 3300006051 Ga0075364_10177534 Ga0075364_101775343 73
404 3300006051 Ga0075364_10632579 Ga0075364_106325791 73
405 3300024225 Ga0224572_1042937 Ga0224572_10429372 73
406 3300024227 Ga0228598_1019470 Ga0228598_10194702 73
407 3300031456 Ga0307513_10110991 Ga0307513_101109913 73
408 3300031456 Ga0307513_10714863 Ga0307513_107148632 73
409 3300031456 Ga0307513_10755150 Ga0307513_107551502 73
410 3300031616 Ga0307508_10103405 Ga0307508_101034052 73
411 3300031665 Ga0316575_10327061 Ga0316575_103270612 73
412 3300031691 Ga0316579_10173901 Ga0316579_101739011 73
413 3300035089 Ga0373944_0180040 Ga0373944_0180040_343_600 73
414 3300035111 Ga0373923_0144284 Ga0373923_0144284_75_320 73
415 3300035111 Ga0373923_0337349 Ga0373923_0337349_170_427 73
416 3300035117 Ga0373953_0154987 Ga0373953_0154987_188_445 73
417 3300035118 Ga0373954_0262302 Ga0373954_0262302_136_393 73
418 3300035119 Ga0373956_0303823 Ga0373956_0303823_161_418 73
419 3300035120 Ga0373957_0413401 Ga0373957_0413401_206_463 73
420 3300035170 Ga0373943_0318303 Ga0373943_0318303_468_725 73
421 3300035172 Ga0373955_0011197 Ga0373955_0011197_3850_4107 73
422 3300035695 Ga0373927_0619470 Ga0373927_0619470_221_478 73
423 3300035724 Ga0373933_0074919 Ga0373933_0074919_170_427 73
424 3300036401 Ga0373937_0406654 Ga0373937_0406654_821_1078 73
425 3300037068 Ga0373925_1254948 Ga0373925_1254948_289_546 73
426 3300039450 Ga0436363_1503216 Ga0436363_1503216_412_654 73
427 3300041512 Ga0451853_1943139 Ga0451853_1943139_168_461 73
428 3300046455 Ga0495603_0140479 Ga0495603_0140479_821_1078 73
429 3300046460 Ga0495638_0084207 Ga0495638_0084207_1318_1611 73
430 3300046462 Ga0495651_0026822 Ga0495651_0026822_792_1049 73
431 3300046463 Ga0495653_0202284 Ga0495653_0202284_825_1082 73
432 3300046473 Ga0495582_0063452 Ga0495582_0063452_1063_1320 73
433 3300046475 Ga0495639_0352827 Ga0495639_0352827_415_672 73
434 3300046476 Ga0495662_0104651 Ga0495662_0104651_619_876 73
435 3300046499 Ga0495594_0198724 Ga0495594_0198724_306_563 73
436 3300046511 Ga0495608_0073902 Ga0495608_0073902_991_1248 73
437 3300046526 Ga0495666_0242241 Ga0495666_0242241_276_533 73
438 3300046529 Ga0495652_0381482 Ga0495652_0381482_665_922 73
439 3300046531 Ga0495665_0454023 Ga0495665_0454023_120_377 73
440 3300046533 Ga0495640_0071068 Ga0495640_0071068_234_491 73
441 3300046543 Ga0495645_0352701 Ga0495645_0352701_57_314 73
442 3300046559 Ga0495667_0135831 Ga0495667_0135831_795_1052 73
443 3300046616 Ga0495668_0696668 Ga0495668_0696668_129_422 73
444 3300046642 Ga0495634_0060140 Ga0495634_0060140_35_292 73
445 3300046660 Ga0495625_0231376 Ga0495625_0231376_784_1077 73
446 3300046663 Ga0495635_0094634 Ga0495635_0094634_1229_1486 73
447 3300046675 Ga0495657_0099712 Ga0495657_0099712_1431_1688 73
448 3300046678 Ga0495599_0017765 Ga0495599_0017765_169_426 73
449 3300046679 Ga0495623_0035561 Ga0495623_0035561_1317_1574 73
450 3300046680 Ga0495646_0038219 Ga0495646_0038219_1970_2227 73
451 3300046681 Ga0495647_0291830 Ga0495647_0291830_361_618 73
452 3300046683 Ga0495658_0147781 Ga0495658_0147781_814_1071 73
453 3300046689 Ga0495613_0177775 Ga0495613_0177775_494_751 73
454 3300046690 Ga0495624_0258395 Ga0495624_0258395_724_981 73
455 3300046794 Ga0495589_0589180 Ga0495589_0589180_144_437 73
456 3300046809 Ga0495600_0064718 Ga0495600_0064718_1674_1931 73
457 3300047315 Ga0495581_0186111 Ga0495581_0186111_754_1011 73
458 3300047317 Ga0495604_0156077 Ga0495604_0156077_529_786 73
459 3300047319 Ga0495674_0108833 Ga0495674_0108833_860_1117 73
460 3300047320 Ga0495672_0403897 Ga0495672_0403897_357_602 73
461 3300047321 Ga0495676_0243682 Ga0495676_0243682_477_734 73
462 3300047322 Ga0495680_0117368 Ga0495680_0117368_1339_1596 73
463 3300047444 Ga0495675_0243778 Ga0495675_0243778_683_940 73
464 3300047471 Ga0495684_0252871 Ga0495684_0252871_613_870 73
465 3300047472 Ga0495686_0142332 Ga0495686_0142332_294_605 73
466 3300048088 Ga0495602_0042806 Ga0495602_0042806_3531_3788 73
467 3300049460 Ga0495682_0104651 Ga0495682_0104651_196_489 73
468 3300049570 Ga0501033_0911454 Ga0501033_0911454_225_545 73
469 3300049586 Ga0501070_0457682 Ga0501070_0457682_678_998 73
470 3300049822 Ga0501035_0152607 Ga0501035_0152607_573_893 73
471 3300049823 Ga0501044_0142961 Ga0501044_0142961_110_430 73
472 3300050491 nmdc:mga00v17_13050_c2 nmdc:mga00v17_13050_c2_145_393 73
473 3300053077 Ga0495601_0070742 Ga0495601_0070742_112_369 73
474 3300053085 Ga0495619_0374838 Ga0495619_0374838_258_515 73
475 3300053090 Ga0500646_0090176 Ga0500646_0090176_134_427 73
476 3300053093 Ga0500651_0051744 Ga0500651_0051744_526_819 73
477 3300053093 Ga0500651_0408585 Ga0500651_0408585_361_669 73
478 3300053094 Ga0500566_0008660 Ga0500566_0008660_2265_2561 73
479 3300053094 Ga0500566_0285636 Ga0500566_0285636_238_495 73
480 3300053096 Ga0500641_0096596 Ga0500641_0096596_677_988 73
481 3300053119 Ga0500595_002391 Ga0500595_002391_2091_2384 73
482 3300053123 Ga0500614_082332 Ga0500614_082332_535_828 73
483 3300053131 Ga0500652_167741 Ga0500652_167741_54_347 73
484 3300053134 Ga0500658_0057978 Ga0500658_0057978_33_326 73
485 3300053142 Ga0500577_0390602 Ga0500577_0390602_225_518 73
486 3300053146 Ga0500588_0257162 Ga0500588_0257162_146_442 73
487 3300053158 Ga0500627_0213537 Ga0500627_0213537_527_832 73
488 3300005338 Ga0068868_100604584 Ga0068868_1006045842 74
489 3300005347 Ga0070668_100140175 Ga0070668_1001401751 74
490 3300005356 Ga0070674_100610462 Ga0070674_1006104622 74
491 3300005365 Ga0070688_100280502 Ga0070688_1002805021 74
492 3300005367 Ga0070667_101688612 Ga0070667_1016886122 74
493 3300005456 Ga0070678_100712532 Ga0070678_1007125322 74
494 3300005471 Ga0070698_100064203 Ga0070698_1000642033 74
495 3300005518 Ga0070699_100078367 Ga0070699_1000783673 74
496 3300005614 Ga0068856_100419637 Ga0068856_1004196372 74
497 3300005843 Ga0068860_100392912 Ga0068860_1003929122 74
498 3300005844 Ga0068862_102298708 Ga0068862_1022987082 74
499 3300006880 Ga0075429_101587079 Ga0075429_1015870792 74
500 3300009093 Ga0105240_10227124 Ga0105240_102271243 74
501 3300009093 Ga0105240_10233950 Ga0105240_102339502 74
502 3300009093 Ga0105240_10287039 Ga0105240_102870393 74
503 3300009098 Ga0105245_10185614 Ga0105245_101856142 74
504 3300009098 Ga0105245_10675613 Ga0105245_106756132 74
505 3300009148 Ga0105243_10438915 Ga0105243_104389152 74
506 3300009174 Ga0105241_11009513 Ga0105241_110095132 74
507 3300009176 Ga0105242_11239001 Ga0105242_112390011 74
508 3300009545 Ga0105237_10078456 Ga0105237_100784564 74
509 3300009545 Ga0105237_10640511 Ga0105237_106405112 74
510 3300009551 Ga0105238_10018574 Ga0105238_100185748 74
511 3300009551 Ga0105238_10090935 Ga0105238_100909354 74
512 3300009551 Ga0105238_10213092 Ga0105238_102130922 74
513 3300010375 Ga0105239_10202620 Ga0105239_102026204 74
514 3300011119 Ga0105246_12066594 Ga0105246_120665942 74
515 3300013308 Ga0157375_12694659 Ga0157375_126946592 74
516 3300014325 Ga0163163_10715641 Ga0163163_107156412 74
517 3300014497 Ga0182008_10551918 Ga0182008_105519182 74
518 3300020077 Ga0206351_10059359 Ga0206351_100593592 74
519 3300025913 Ga0207695_10160356 Ga0207695_101603563 74
520 3300025913 Ga0207695_10161430 Ga0207695_101614303 74
521 3300025914 Ga0207671_10138862 Ga0207671_101388622 74
522 3300025924 Ga0207694_10024964 Ga0207694_100249644 74
523 3300025927 Ga0207687_10100660 Ga0207687_101006602 74
524 3300025937 Ga0207669_10754446 Ga0207669_107544461 74
525 3300025949 Ga0207667_10576047 Ga0207667_105760472 74
526 3300025972 Ga0207668_10171762 Ga0207668_101717624 74
527 3300026078 Ga0207702_11270860 Ga0207702_112708602 74
528 3300026118 Ga0207675_101553532 Ga0207675_1015535322 74
529 3300028379 Ga0268266_10024595 Ga0268266_100245953 74
530 3300028381 Ga0268264_11015581 Ga0268264_110155812 74
531 3300028800 Ga0265338_10210675 Ga0265338_102106752 74
532 3300031250 Ga0265331_10564416 Ga0265331_105644162 74
533 3300037312 Ga0395899_0071704 Ga0395899_0071704_2247_2510 74
534 3300037418 Ga0395900_0583021 Ga0395900_0583021_206_469 74
535 3300038443 Ga0395901_0385460 Ga0395901_0385460_458_721 74
536 3300039453 Ga0436362_0481984 Ga0436362_0481984_489_743 74
537 3300039453 Ga0436362_1027979 Ga0436362_1027979_131_394 74
538 3300041496 Ga0451839_1022280 Ga0451839_1022280_142_387 74
539 3300045051 Ga0451576_0961771 Ga0451576_0961771_118_420 74
540 3300045976 Ga0466967_1692082 Ga0466967_1692082_336_608 74
541 3300048910 Ga0496107_0906420 Ga0496107_0906420_93_398 74
542 3300048915 Ga0496112_1424084 Ga0496112_1424084_218_523 74
543 3300048927 Ga0496124_0238267 Ga0496124_0238267_587_832 74
544 3300048929 Ga0496126_0362302 Ga0496126_0362302_357_617 74
545 3300049586 Ga0501070_1187690 Ga0501070_1187690_86_331 74
546 3300049587 Ga0501071_0221161 Ga0501071_0221161_1038_1352 74
547 3300049591 Ga0501075_1156816 Ga0501075_1156816_130_444 74
548 3300049593 Ga0501077_0646780 Ga0501077_0646780_200_514 74
549 3300049742 Ga0501080_0483272 Ga0501080_0483272_199_462 74
550 3300050508 nmdc:mga09592_1537256_c1 nmdc:mga09592_1537256_c1_27_332 74
551 3300050514 nmdc:mga08x19_771932_c1 nmdc:mga08x19_771932_c1_190_510 74
552 3300053085 Ga0495619_0139198 Ga0495619_0139198_1109_1366 74
553 3300053091 Ga0500647_0037188 Ga0500647_0037188_1744_2004 74
554 3300053119 Ga0500595_080042 Ga0500595_080042_465_728 74
555 3300059506 Ga0587085_184392 Ga0587085_184392_106_369 74
556 3300001979 JGI24740J21852_10043409 JGI24740J21852_100434092 75
557 3300003781 Ga0055536_1002526 Ga0055536_10025269 75
558 3300005336 Ga0070680_100004947 Ga0070680_10000494710 75
559 3300005339 Ga0070660_101177696 Ga0070660_1011776962 75
560 3300005458 Ga0070681_10000725 Ga0070681_1000072524 75
561 3300005530 Ga0070679_100002589 Ga0070679_10000258914 75
562 3300005530 Ga0070679_100368905 Ga0070679_1003689054 75
563 3300005535 Ga0070684_102305693 Ga0070684_1023056932 75
564 3300005563 Ga0068855_100485229 Ga0068855_1004852293 75
565 3300005578 Ga0068854_100124680 Ga0068854_1001246803 75
566 3300005614 Ga0068856_100794907 Ga0068856_1007949073 75
567 3300005937 Ga0081455_10095808 Ga0081455_100958082 75
568 3300009093 Ga0105240_10018436 Ga0105240_100184366 75
569 3300009093 Ga0105240_10670775 Ga0105240_106707752 75
570 3300009551 Ga0105238_10692443 Ga0105238_106924431 75
571 3300013104 Ga0157370_10473827 Ga0157370_104738272 75
572 3300013296 Ga0157374_10191203 Ga0157374_101912032 75
573 3300013307 Ga0157372_10149792 Ga0157372_101497922 75
574 3300014325 Ga0163163_10975329 Ga0163163_109753291 75
575 3300014968 Ga0157379_11148915 Ga0157379_111489152 75
576 3300021361 Ga0213872_10281247 Ga0213872_102812472 75
577 3300021388 Ga0213875_10000936 Ga0213875_100009366 75
578 3300021441 Ga0213871_10235667 Ga0213871_102356672 75
579 3300025912 Ga0207707_10010185 Ga0207707_100101854 75
580 3300025913 Ga0207695_10436046 Ga0207695_104360462 75
581 3300025917 Ga0207660_10070844 Ga0207660_100708442 75
582 3300025921 Ga0207652_10012935 Ga0207652_100129355 75
583 3300025921 Ga0207652_10079927 Ga0207652_100799271 75
584 3300025949 Ga0207667_10669004 Ga0207667_106690042 75
585 3300025981 Ga0207640_10069956 Ga0207640_100699563 75
586 3300026078 Ga0207702_10358055 Ga0207702_103580553 75
587 3300028794 Ga0307515_10003572 Ga0307515_100035729 75
588 3300031456 Ga0307513_10842650 Ga0307513_108426501 75
589 3300031456 Ga0307513_11102586 Ga0307513_111025861 75
590 3300031649 Ga0307514_10069184 Ga0307514_100691842 75
591 3300031730 Ga0307516_10063711 Ga0307516_100637112 75
592 3300035172 Ga0373955_0432099 Ga0373955_0432099_158_433 75
593 3300037853 Ga0436364_0992577 Ga0436364_0992577_15582_15848 75
594 3300039437 Ga0436365_0910090 Ga0436365_0910090_66_332 75
595 3300039438 Ga0436360_0747340 Ga0436360_0747340_382_645 75
596 3300039438 Ga0436360_1058378 Ga0436360_1058378_1258_1521 75
597 3300039447 Ga0436361_0211622 Ga0436361_0211622_2341_2628 75
598 3300039447 Ga0436361_0337411 Ga0436361_0337411_68_331 75
599 3300039450 Ga0436363_0589105 Ga0436363_0589105_20_286 75
600 3300039453 Ga0436362_0538378 Ga0436362_0538378_51_317 75
601 3300039453 Ga0436362_0619277 Ga0436362_0619277_260_526 75
602 3300044693 Ga0466961_0778124 Ga0466961_0778124_237_509 75
603 3300044842 Ga0466957_0722891 Ga0466957_0722891_196_468 75
604 3300045836 Ga0466958_0455317 Ga0466958_0455317_447_719 75
605 3300045836 Ga0466958_0655044 Ga0466958_0655044_60_335 75
606 3300045976 Ga0466967_1226913 Ga0466967_1226913_172_453 75
607 3300045976 Ga0466967_1903338 Ga0466967_1903338_19_291 75
608 3300046460 Ga0495638_0012483 Ga0495638_0012483_2028_2279 75
609 3300048907 Ga0496104_1653446 Ga0496104_1653446_247_513 75
610 3300048909 Ga0496106_0844831 Ga0496106_0844831_177_428 75
611 3300048924 Ga0496121_0366326 Ga0496121_0366326_357_605 75
612 3300049128 Ga0501308_007539 Ga0501308_007539_240_491 75
613 3300049130 Ga0501310_072748 Ga0501310_072748_206_457 75
614 3300049162 Ga0501307_009009 Ga0501307_009009_231_482 75
615 3300049529 Ga0501313_010428 Ga0501313_010428_151_402 75
616 3300049533 Ga0501317_080817 Ga0501317_080817_48_299 75
617 3300049534 Ga0501318_071047 Ga0501318_071047_144_398 75
618 3300049585 Ga0501069_0176633 Ga0501069_0176633_286_555 75
619 3300049586 Ga0501070_0298577 Ga0501070_0298577_697_966 75
620 3300049742 Ga0501080_0114718 Ga0501080_0114718_638_907 75
621 3300053088 Ga0500644_0008950 Ga0500644_0008950_274_525 75
622 3300053093 Ga0500651_0762378 Ga0500651_0762378_41_292 75
623 3300053122 Ga0500608_023066 Ga0500608_023066_1941_2192 75
624 3300053130 Ga0500642_0236937 Ga0500642_0236937_14_265 75
625 3300053131 Ga0500652_405374 Ga0500652_405374_113_364 75
626 3300053142 Ga0500577_0124830 Ga0500577_0124830_462_713 75
627 3300053153 Ga0500616_0358423 Ga0500616_0358423_201_452 75
628 3300053156 Ga0500622_0000695 Ga0500622_0000695_25130_25381 75
629 3300059504 Ga0587082_085620 Ga0587082_085620_382_630 75
630 3300059605 Ga0587106_035783 Ga0587106_035783_452_703 75
631 3300059624 Ga0587109_137226 Ga0587109_137226_120_371 75
632 3300059641 Ga0587068_123033 Ga0587068_123033_172_423 75
633 3300060346 Ga0587111_0211827 Ga0587111_0211827_158_409 75

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01084

Ribosomal_S18

Ribosomal protein S18

39

90

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x8r-assembly1.cif.gz_o structure of the 30s small subunit of chloroplast ribosome from spinach 0.4998 33 73
5x8r-assembly1.cif.gz_o structure of the 30s small subunit of chloroplast ribosome from spinach 0.3668 33 73
ID Description Score Start End Superfamily
af_A0A2R8QFH5_209_309_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.6054 29 62 3.30.710.10
4ohfD03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5649 33 74 1.20.58.1160
af_Q5AHB8_2_109_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4502 33 74 1.10.287.1490
2ylaC02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;AF1782-like 0.4264 29 63 1.20.1270.90
4azhB02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;AF1782-like 0.4033 24 63 1.20.1270.90

Feature Viewer

pLDDT pTM Quality
78.67 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map