F471084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 429 | 527 | 81 |
Family's Representative Sequence
| Representative Sequence | 3300021361|Ga0213872_10281247|Ga0213872_102812472 |
| Length | 95 |
| Sequence | MRNVERPAGREGDAAPGARPAARRPFFRRHKTCPFSGPNAPKIDYKDVKLLQRFISERGKIVPSRITAVSAKKQRELSQAIKRARFLGLLPYLIQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 2 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 3 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 4 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 5 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 6 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 7 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 8 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 9 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 10 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 11 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 12 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 13 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 14 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 15 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 16 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 17 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 18 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 19 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 20 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 21 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 22 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 23 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 24 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 25 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 26 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 27 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 28 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 29 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 30 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 31 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 32 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 33 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 34 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 35 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 36 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 37 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 38 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 39 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 40 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 41 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 42 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 43 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 44 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 45 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 46 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 47 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 48 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 49 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 50 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 51 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 52 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 53 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 54 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 55 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 56 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 57 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 58 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 59 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 60 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 61 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 62 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 63 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 64 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 65 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 66 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 67 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 68 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 69 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 70 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 71 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 72 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 73 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 74 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 75 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 76 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 77 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 78 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 79 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 80 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 81 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 82 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 83 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 84 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 85 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 86 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 87 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 88 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 89 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 90 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 91 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 92 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 93 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 94 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 95 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 96 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 97 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 98 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 99 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 100 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 101 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 102 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 103 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 116 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 122 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 126 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 127 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 128 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 129 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 130 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 131 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 132 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 134 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 135 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 138 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 139 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 140 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 142 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 143 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 144 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 145 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 146 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 167 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 168 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 169 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 170 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 172 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 173 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 218 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 219 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 220 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 230 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 251 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 266 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 269 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 270 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 273 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 332 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 376 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 386 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 390 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 392 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 397 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 401 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 402 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 403 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 405 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 407 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 408 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 409 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 412 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 413 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 423 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 424 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 425 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 426 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 427 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 428 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 429 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.83 |
| Metatranscriptomes | 4.42 |
| Isolates | 16.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.79 |
| Bulb | 0 |
| Endosphere | 11.06 |
| Nodule | 4.42 |
| Rhizoplane | 2.37 |
| Rhizosphere | 68.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10043409 | 3300001979 | Bacteria | 1341 |
| 2 | JGI25153J46596_10000054 | 3300003215 | Bacteria | 136806 |
| 3 | JGI25153J46596_10001297 | 3300003215 | Bacteria | 14964 |
| 4 | Ga0055536_1002526 | 3300003781 | Bacteria | 10248 |
| 5 | Ga0055536_1005558 | 3300003781 | Bacteria | 6127 |
| 6 | Ga0055530_10079380 | 3300003791 | Bacteria | 692 |
| 7 | Ga0055531_10014275 | 3300003794 | Bacteria | 3589 |
| 8 | Ga0070670_101212008 | 3300005331 | Bacteria | 690 |
| 9 | Ga0070680_100004947 | 3300005336 | Bacteria | 10034 |
| 10 | Ga0068868_100604584 | 3300005338 | Bacteria | 972 |
| 11 | Ga0070660_101177696 | 3300005339 | Bacteria | 649 |
| 12 | Ga0070668_100140175 | 3300005347 | Bacteria | 1948 |
| 13 | Ga0070674_100610462 | 3300005356 | Bacteria | 923 |
| 14 | Ga0070688_100280502 | 3300005365 | Bacteria | 1197 |
| 15 | Ga0070667_101688612 | 3300005367 | Bacteria | 596 |
| 16 | Ga0070714_100635006 | 3300005435 | Bacteria | 1027 |
| 17 | Ga0070714_101556430 | 3300005435 | Bacteria | 646 |
| 18 | Ga0070713_100110450 | 3300005436 | Bacteria | 2397 |
| 19 | Ga0070713_101019747 | 3300005436 | Bacteria | 799 |
| 20 | Ga0070678_100712532 | 3300005456 | Bacteria | 905 |
| 21 | Ga0070681_10000725 | 3300005458 | Bacteria | 27287 |
| 22 | Ga0068867_100243064 | 3300005459 | Bacteria | 1461 |
| 23 | Ga0070698_100064203 | 3300005471 | Bacteria | 3700 |
| 24 | Ga0070699_100078367 | 3300005518 | Bacteria | 2878 |
| 25 | Ga0070679_100002589 | 3300005530 | Bacteria | 16435 |
| 26 | Ga0070679_100368905 | 3300005530 | Bacteria | 1383 |
| 27 | Ga0070684_102305693 | 3300005535 | Bacteria | 508 |
| 28 | Ga0070665_100162416 | 3300005548 | Bacteria | 2236 |
| 29 | Ga0070665_100708448 | 3300005548 | Bacteria | 1020 |
| 30 | Ga0068855_100485229 | 3300005563 | Bacteria | 1345 |
| 31 | Ga0068857_101998287 | 3300005577 | Bacteria | 569 |
| 32 | Ga0068854_100124680 | 3300005578 | Bacteria | 1960 |
| 33 | Ga0068856_100419637 | 3300005614 | Bacteria | 1358 |
| 34 | Ga0068856_100794907 | 3300005614 | Bacteria | 966 |
| 35 | Ga0068859_100811759 | 3300005617 | Bacteria | 1023 |
| 36 | Ga0068866_10549651 | 3300005718 | Bacteria | 772 |
| 37 | Ga0068863_100227987 | 3300005841 | Bacteria | 1796 |
| 38 | Ga0068863_101224720 | 3300005841 | Bacteria | 757 |
| 39 | Ga0068860_100392912 | 3300005843 | Bacteria | 1371 |
| 40 | Ga0068860_100549647 | 3300005843 | Bacteria | 1157 |
| 41 | Ga0068862_100025088 | 3300005844 | Bacteria | 5004 |
| 42 | Ga0068862_102298708 | 3300005844 | Bacteria | 551 |
| 43 | Ga0081455_10088701 | 3300005937 | Bacteria | 2512 |
| 44 | Ga0081455_10095808 | 3300005937 | Bacteria | 2395 |
| 45 | Ga0081540_1071562 | 3300005983 | Bacteria | 1601 |
| 46 | Ga0081540_1192960 | 3300005983 | Bacteria | 749 |
| 47 | Ga0070717_11678818 | 3300006028 | Bacteria | 575 |
| 48 | Ga0075365_11124164 | 3300006038 | Bacteria | 553 |
| 49 | Ga0075363_100699468 | 3300006048 | Bacteria | 612 |
| 50 | Ga0075364_10177534 | 3300006051 | Bacteria | 1441 |
| 51 | Ga0075364_10632579 | 3300006051 | Bacteria | 731 |
| 52 | Ga0075362_10075390 | 3300006177 | Bacteria | 1547 |
| 53 | Ga0075367_10467008 | 3300006178 | Bacteria | 800 |
| 54 | Ga0075369_10279495 | 3300006186 | Bacteria | 777 |
| 55 | Ga0075366_10082781 | 3300006195 | Bacteria | 1917 |
| 56 | Ga0075366_10242502 | 3300006195 | Bacteria | 1099 |
| 57 | Ga0097621_100557516 | 3300006237 | Bacteria | 1043 |
| 58 | Ga0075370_10059673 | 3300006353 | Bacteria | 2172 |
| 59 | Ga0075430_100099700 | 3300006846 | Bacteria | 2426 |
| 60 | Ga0075430_101720585 | 3300006846 | Bacteria | 515 |
| 61 | Ga0075431_100273750 | 3300006847 | Bacteria | 1710 |
| 62 | Ga0075429_101169420 | 3300006880 | Bacteria | 672 |
| 63 | Ga0075429_101587079 | 3300006880 | Bacteria | 569 |
| 64 | Ga0068865_100001757 | 3300006881 | Bacteria | 12710 |
| 65 | Ga0097620_100811729 | 3300006931 | Bacteria | 1023 |
| 66 | Ga0105240_10018436 | 3300009093 | Bacteria | 9370 |
| 67 | Ga0105240_10227124 | 3300009093 | Bacteria | 2171 |
| 68 | Ga0105240_10233950 | 3300009093 | Bacteria | 2133 |
| 69 | Ga0105240_10287039 | 3300009093 | Bacteria | 1888 |
| 70 | Ga0105240_10539403 | 3300009093 | Bacteria | 1292 |
| 71 | Ga0105240_10670775 | 3300009093 | Bacteria | 1134 |
| 72 | Ga0105240_12756969 | 3300009093 | Bacteria | 506 |
| 73 | Ga0105245_10185614 | 3300009098 | Bacteria | 1989 |
| 74 | Ga0105245_10675613 | 3300009098 | Bacteria | 1064 |
| 75 | Ga0105243_10438915 | 3300009148 | Bacteria | 1222 |
| 76 | Ga0105243_10870946 | 3300009148 | Bacteria | 894 |
| 77 | Ga0105241_11009513 | 3300009174 | Bacteria | 779 |
| 78 | Ga0105242_10061433 | 3300009176 | Bacteria | 3090 |
| 79 | Ga0105242_11239001 | 3300009176 | Bacteria | 767 |
| 80 | Ga0105237_10078456 | 3300009545 | Bacteria | 3292 |
| 81 | Ga0105237_10640511 | 3300009545 | Bacteria | 1070 |
| 82 | Ga0105237_11377988 | 3300009545 | Bacteria | 711 |
| 83 | Ga0105237_12088236 | 3300009545 | Bacteria | 576 |
| 84 | Ga0105238_10005330 | 3300009551 | Bacteria | 12704 |
| 85 | Ga0105238_10018574 | 3300009551 | Bacteria | 7079 |
| 86 | Ga0105238_10090935 | 3300009551 | Bacteria | 3040 |
| 87 | Ga0105238_10213092 | 3300009551 | Bacteria | 1908 |
| 88 | Ga0105238_10692443 | 3300009551 | Bacteria | 1031 |
| 89 | Ga0105239_10202620 | 3300010375 | Bacteria | 2223 |
| 90 | Ga0105239_10231853 | 3300010375 | Bacteria | 2071 |
| 91 | Ga0105239_10350476 | 3300010375 | Bacteria | 1667 |
| 92 | Ga0105246_12066594 | 3300011119 | Bacteria | 551 |
| 93 | Ga0157373_10471274 | 3300013100 | Bacteria | 905 |
| 94 | Ga0157370_10473827 | 3300013104 | Bacteria | 1150 |
| 95 | Ga0157374_10191203 | 3300013296 | Bacteria | 2002 |
| 96 | Ga0157378_10097156 | 3300013297 | Bacteria | 2684 |
| 97 | Ga0157378_11536890 | 3300013297 | Bacteria | 711 |
| 98 | Ga0157372_10149792 | 3300013307 | Bacteria | 2692 |
| 99 | Ga0157375_12694659 | 3300013308 | Bacteria | 594 |
| 100 | Ga0163163_10157871 | 3300014325 | Bacteria | 2313 |
| 101 | Ga0163163_10715641 | 3300014325 | Bacteria | 1065 |
| 102 | Ga0163163_10975329 | 3300014325 | Bacteria | 911 |
| 103 | Ga0182008_10551918 | 3300014497 | Bacteria | 640 |
| 104 | Ga0157379_11148915 | 3300014968 | Bacteria | 745 |
| 105 | Ga0206351_10059359 | 3300020077 | Bacteria | 1199 |
| 106 | Ga0213872_10281247 | 3300021361 | Bacteria | 694 |
| 107 | Ga0213876_10169237 | 3300021384 | Bacteria | 1162 |
| 108 | Ga0213875_10000664 | 3300021388 | Bacteria | 27198 |
| 109 | Ga0213875_10000936 | 3300021388 | Bacteria | 20989 |
| 110 | Ga0213871_10235667 | 3300021441 | Bacteria | 578 |
| 111 | Ga0247551_105454 | 3300023552 | Bacteria | 530 |
| 112 | Ga0224572_1042937 | 3300024225 | Bacteria | 849 |
| 113 | Ga0228598_1019470 | 3300024227 | Bacteria | 1337 |
| 114 | Ga0209676_1000049 | 3300025292 | Bacteria | 403210 |
| 115 | Ga0209758_1000119 | 3300025297 | Bacteria | 195545 |
| 116 | Ga0209758_1027446 | 3300025297 | Bacteria | 2432 |
| 117 | Ga0209050_1003817 | 3300025298 | Bacteria | 10753 |
| 118 | Ga0209050_1024299 | 3300025298 | Bacteria | 2101 |
| 119 | Ga0207426_1012533 | 3300025302 | Bacteria | 3180 |
| 120 | Ga0209257_1000562 | 3300025304 | Bacteria | 63202 |
| 121 | Ga0209257_1059605 | 3300025304 | Bacteria | 1041 |
| 122 | Ga0209257_1067970 | 3300025304 | Bacteria | 948 |
| 123 | Ga0207656_10181164 | 3300025321 | Bacteria | 1011 |
| 124 | Ga0207707_10010185 | 3300025912 | Bacteria | 8159 |
| 125 | Ga0207695_10160356 | 3300025913 | Bacteria | 2181 |
| 126 | Ga0207695_10161430 | 3300025913 | Bacteria | 2172 |
| 127 | Ga0207695_10436046 | 3300025913 | Bacteria | 1194 |
| 128 | Ga0207671_10138862 | 3300025914 | Bacteria | 1871 |
| 129 | Ga0207671_10922337 | 3300025914 | Bacteria | 690 |
| 130 | Ga0207693_10626588 | 3300025915 | Bacteria | 836 |
| 131 | Ga0207660_10070844 | 3300025917 | Bacteria | 2535 |
| 132 | Ga0207652_10012935 | 3300025921 | Bacteria | 6751 |
| 133 | Ga0207652_10079927 | 3300025921 | Bacteria | 2858 |
| 134 | Ga0207694_10024964 | 3300025924 | Bacteria | 4541 |
| 135 | Ga0207694_10040185 | 3300025924 | Bacteria | 3601 |
| 136 | Ga0207694_10363852 | 3300025924 | Bacteria | 1199 |
| 137 | Ga0207687_10100660 | 3300025927 | Bacteria | 2126 |
| 138 | Ga0207700_10190664 | 3300025928 | Bacteria | 1722 |
| 139 | Ga0207700_11292092 | 3300025928 | Bacteria | 650 |
| 140 | Ga0207664_10472897 | 3300025929 | Bacteria | 1121 |
| 141 | Ga0207664_11017984 | 3300025929 | Bacteria | 742 |
| 142 | Ga0207709_10489966 | 3300025935 | Bacteria | 957 |
| 143 | Ga0207669_10754446 | 3300025937 | Bacteria | 804 |
| 144 | Ga0207704_10273532 | 3300025938 | Bacteria | 1280 |
| 145 | Ga0207711_10001297 | 3300025941 | Bacteria | 23697 |
| 146 | Ga0207679_10244632 | 3300025945 | Bacteria | 1522 |
| 147 | Ga0207667_10576047 | 3300025949 | Bacteria | 1137 |
| 148 | Ga0207667_10669004 | 3300025949 | Bacteria | 1042 |
| 149 | Ga0207712_12041540 | 3300025961 | Bacteria | 513 |
| 150 | Ga0207668_10171762 | 3300025972 | Bacteria | 1701 |
| 151 | Ga0207668_10346843 | 3300025972 | Bacteria | 1240 |
| 152 | Ga0207640_10069956 | 3300025981 | Bacteria | 2358 |
| 153 | Ga0207677_11231926 | 3300026023 | Bacteria | 686 |
| 154 | Ga0207639_10201199 | 3300026041 | Bacteria | 1708 |
| 155 | Ga0207639_10285643 | 3300026041 | Bacteria | 1453 |
| 156 | Ga0207702_10358055 | 3300026078 | Bacteria | 1398 |
| 157 | Ga0207702_10381354 | 3300026078 | Bacteria | 1356 |
| 158 | Ga0207702_11270860 | 3300026078 | Bacteria | 730 |
| 159 | Ga0207674_10987839 | 3300026116 | Bacteria | 811 |
| 160 | Ga0207675_101553532 | 3300026118 | Bacteria | 682 |
| 161 | Ga0268266_10024595 | 3300028379 | Bacteria | 5123 |
| 162 | Ga0268266_10793742 | 3300028379 | Bacteria | 914 |
| 163 | Ga0268266_11071992 | 3300028379 | Bacteria | 780 |
| 164 | Ga0268265_10054330 | 3300028380 | Bacteria | 3038 |
| 165 | Ga0268264_10969109 | 3300028381 | Bacteria | 856 |
| 166 | Ga0268264_11015581 | 3300028381 | Bacteria | 836 |
| 167 | Ga0307515_10003572 | 3300028794 | Bacteria | 32658 |
| 168 | Ga0265338_10210675 | 3300028800 | Bacteria | 1459 |
| 169 | Ga0265338_10711983 | 3300028800 | Bacteria | 692 |
| 170 | Ga0265330_10534558 | 3300031235 | Bacteria | 500 |
| 171 | Ga0265328_10195190 | 3300031239 | Bacteria | 768 |
| 172 | Ga0265329_10308718 | 3300031242 | Bacteria | 536 |
| 173 | Ga0265340_10106034 | 3300031247 | Bacteria | 1303 |
| 174 | Ga0265340_10149554 | 3300031247 | Bacteria | 1065 |
| 175 | Ga0265331_10564416 | 3300031250 | Bacteria | 513 |
| 176 | Ga0265327_10011785 | 3300031251 | Bacteria | 5980 |
| 177 | Ga0265327_10097903 | 3300031251 | Bacteria | 1420 |
| 178 | Ga0307513_10110991 | 3300031456 | Bacteria | 2736 |
| 179 | Ga0307513_10714863 | 3300031456 | Bacteria | 707 |
| 180 | Ga0307513_10755150 | 3300031456 | Bacteria | 678 |
| 181 | Ga0307513_10842650 | 3300031456 | Bacteria | 623 |
| 182 | Ga0307513_11102586 | 3300031456 | Bacteria | 506 |
| 183 | Ga0307408_100049522 | 3300031548 | Bacteria | 3018 |
| 184 | Ga0307508_10056257 | 3300031616 | Bacteria | 3484 |
| 185 | Ga0307508_10080921 | 3300031616 | Bacteria | 2830 |
| 186 | Ga0307508_10103405 | 3300031616 | Bacteria | 2445 |
| 187 | Ga0307508_10600941 | 3300031616 | Bacteria | 702 |
| 188 | Ga0307514_10069184 | 3300031649 | Bacteria | 2657 |
| 189 | Ga0316575_10026120 | 3300031665 | Bacteria | 2268 |
| 190 | Ga0316575_10327061 | 3300031665 | Bacteria | 651 |
| 191 | Ga0316579_10173901 | 3300031691 | Bacteria | 1041 |
| 192 | Ga0316578_10105549 | 3300031728 | Bacteria | 1690 |
| 193 | Ga0307516_10063711 | 3300031730 | Bacteria | 3568 |
| 194 | Ga0307516_10270669 | 3300031730 | Bacteria | 1385 |
| 195 | Ga0307405_11341027 | 3300031731 | Bacteria | 624 |
| 196 | Ga0316577_10467707 | 3300031733 | Bacteria | 717 |
| 197 | Ga0307410_10083954 | 3300031852 | Bacteria | 2244 |
| 198 | Ga0307407_10058233 | 3300031903 | Bacteria | 2245 |
| 199 | Ga0307409_100344579 | 3300031995 | Bacteria | 1404 |
| 200 | Ga0307409_100779109 | 3300031995 | Bacteria | 962 |
| 201 | Ga0307416_101364959 | 3300032002 | Bacteria | 814 |
| 202 | Ga0307416_101719840 | 3300032002 | Bacteria | 732 |
| 203 | Ga0307411_10246740 | 3300032005 | Bacteria | 1401 |
| 204 | Ga0316053_109592 | 3300032120 | Bacteria | 666 |
| 205 | Ga0316585_10241630 | 3300032137 | Bacteria | 598 |
| 206 | Ga0307510_10153476 | 3300033180 | Bacteria | 1916 |
| 207 | Ga0307510_10248753 | 3300033180 | Bacteria | 1267 |
| 208 | Ga0373934_0056229 | 3300035086 | Bacteria | 1565 |
| 209 | Ga0373944_0180040 | 3300035089 | Bacteria | 758 |
| 210 | Ga0373923_0144284 | 3300035111 | Bacteria | 1078 |
| 211 | Ga0373923_0337349 | 3300035111 | Bacteria | 718 |
| 212 | Ga0373936_0503760 | 3300035113 | Bacteria | 563 |
| 213 | Ga0373953_0154987 | 3300035117 | Bacteria | 983 |
| 214 | Ga0373954_0262302 | 3300035118 | Bacteria | 851 |
| 215 | Ga0373956_0303823 | 3300035119 | Bacteria | 760 |
| 216 | Ga0373956_0408529 | 3300035119 | Bacteria | 648 |
| 217 | Ga0373957_0413401 | 3300035120 | Bacteria | 581 |
| 218 | Ga0373943_0164611 | 3300035170 | Bacteria | 1210 |
| 219 | Ga0373943_0318303 | 3300035170 | Bacteria | 886 |
| 220 | Ga0373943_0530360 | 3300035170 | Bacteria | 690 |
| 221 | Ga0373946_0019520 | 3300035171 | Bacteria | 2612 |
| 222 | Ga0373955_0011197 | 3300035172 | Bacteria | 4265 |
| 223 | Ga0373955_0432099 | 3300035172 | Bacteria | 802 |
| 224 | Ga0373955_0680949 | 3300035172 | Bacteria | 631 |
| 225 | Ga0316574_0068743 | 3300035398 | Bacteria | 2234 |
| 226 | Ga0316574_0695530 | 3300035398 | Bacteria | 624 |
| 227 | Ga0373924_0497012 | 3300035410 | Bacteria | 548 |
| 228 | Ga0373935_0070835 | 3300035692 | Bacteria | 2248 |
| 229 | Ga0373935_1228571 | 3300035692 | Bacteria | 559 |
| 230 | Ga0373927_0004761 | 3300035695 | Bacteria | 9447 |
| 231 | Ga0373927_0619470 | 3300035695 | Bacteria | 715 |
| 232 | Ga0373933_0074919 | 3300035724 | Bacteria | 2065 |
| 233 | Ga0373933_0434937 | 3300035724 | Bacteria | 857 |
| 234 | Ga0373947_0067217 | 3300035725 | Bacteria | 2189 |
| 235 | Ga0373937_0039463 | 3300036401 | Bacteria | 4303 |
| 236 | Ga0373937_0193208 | 3300036401 | Bacteria | 1913 |
| 237 | Ga0373937_0367625 | 3300036401 | Bacteria | 1364 |
| 238 | Ga0373937_0406654 | 3300036401 | Bacteria | 1291 |
| 239 | Ga0316582_0046611 | 3300036647 | Bacteria | 2734 |
| 240 | Ga0316584_0016104 | 3300036712 | Bacteria | 5356 |
| 241 | Ga0373925_0000039 | 3300037068 | Bacteria | 138537 |
| 242 | Ga0373925_0455269 | 3300037068 | Bacteria | 1048 |
| 243 | Ga0373925_0967496 | 3300037068 | Bacteria | 701 |
| 244 | Ga0373925_1254948 | 3300037068 | Bacteria | 608 |
| 245 | Ga0395899_0071704 | 3300037312 | Bacteria | 2535 |
| 246 | Ga0395900_0583021 | 3300037418 | Bacteria | 1060 |
| 247 | Ga0395905_1437777 | 3300037471 | Bacteria | 594 |
| 248 | Ga0436364_0992577 | 3300037853 | Bacteria | 61189 |
| 249 | Ga0395901_0385460 | 3300038443 | Bacteria | 1442 |
| 250 | Ga0436365_0910090 | 3300039437 | Bacteria | 580 |
| 251 | Ga0436365_1296229 | 3300039437 | Bacteria | 4110 |
| 252 | Ga0436360_0522391 | 3300039438 | Bacteria | 1818 |
| 253 | Ga0436360_0747340 | 3300039438 | Bacteria | 1299 |
| 254 | Ga0436360_0800899 | 3300039438 | Bacteria | 716 |
| 255 | Ga0436360_1058378 | 3300039438 | Bacteria | 2066 |
| 256 | Ga0436361_0193398 | 3300039447 | Bacteria | 683 |
| 257 | Ga0436361_0211622 | 3300039447 | Bacteria | 7071 |
| 258 | Ga0436361_0337411 | 3300039447 | Bacteria | 545 |
| 259 | Ga0436361_1163408 | 3300039447 | Bacteria | 611 |
| 260 | Ga0436363_0439365 | 3300039450 | Bacteria | 914 |
| 261 | Ga0436363_0589105 | 3300039450 | Bacteria | 555 |
| 262 | Ga0436363_1503216 | 3300039450 | Bacteria | 775 |
| 263 | Ga0436362_0481984 | 3300039453 | Bacteria | 889 |
| 264 | Ga0436362_0538378 | 3300039453 | Bacteria | 2236 |
| 265 | Ga0436362_0619277 | 3300039453 | Bacteria | 1107 |
| 266 | Ga0436362_0745713 | 3300039453 | Bacteria | 899 |
| 267 | Ga0436362_1027979 | 3300039453 | Bacteria | 823 |
| 268 | Ga0451791_0264923 | 3300041451 | Bacteria | 1076 |
| 269 | Ga0451791_1339744 | 3300041451 | Bacteria | 991 |
| 270 | Ga0451802_0728035 | 3300041460 | Bacteria | 1215 |
| 271 | Ga0451839_1022280 | 3300041496 | Bacteria | 779 |
| 272 | Ga0451843_0458584 | 3300041509 | Bacteria | 582 |
| 273 | Ga0451853_1943139 | 3300041512 | Bacteria | 542 |
| 274 | Ga0439441_080128 | 3300042001 | Bacteria | 710 |
| 275 | Ga0439432_172184 | 3300042006 | Bacteria | 632 |
| 276 | Ga0439450_087306 | 3300042008 | Bacteria | 781 |
| 277 | Ga0451577_0266672 | 3300042876 | Bacteria | 1551 |
| 278 | Ga0466965_0872245 | 3300044683 | Bacteria | 524 |
| 279 | Ga0466961_0778124 | 3300044693 | Bacteria | 572 |
| 280 | Ga0453684_0000071 | 3300044712 | Bacteria | 448904 |
| 281 | Ga0466957_0722891 | 3300044842 | Bacteria | 704 |
| 282 | Ga0451576_0961771 | 3300045051 | Bacteria | 895 |
| 283 | Ga0466958_0455317 | 3300045836 | Bacteria | 829 |
| 284 | Ga0466958_0655044 | 3300045836 | Bacteria | 684 |
| 285 | Ga0466967_1226913 | 3300045976 | Bacteria | 747 |
| 286 | Ga0466967_1692082 | 3300045976 | Bacteria | 630 |
| 287 | Ga0466967_1903338 | 3300045976 | Bacteria | 592 |
| 288 | Ga0495603_0140479 | 3300046455 | Bacteria | 1405 |
| 289 | Ga0495638_0012483 | 3300046460 | Bacteria | 5821 |
| 290 | Ga0495638_0084207 | 3300046460 | Bacteria | 1925 |
| 291 | Ga0495651_0026822 | 3300046462 | Bacteria | 4486 |
| 292 | Ga0495651_0304508 | 3300046462 | Bacteria | 1068 |
| 293 | Ga0495653_0202284 | 3300046463 | Bacteria | 1347 |
| 294 | Ga0495582_0063452 | 3300046473 | Bacteria | 2041 |
| 295 | Ga0495639_0352827 | 3300046475 | Bacteria | 739 |
| 296 | Ga0495662_0104651 | 3300046476 | Bacteria | 1385 |
| 297 | Ga0495664_0273983 | 3300046477 | Bacteria | 1020 |
| 298 | Ga0495594_0198724 | 3300046499 | Bacteria | 1143 |
| 299 | Ga0495608_0073902 | 3300046511 | Bacteria | 2222 |
| 300 | Ga0495616_0092026 | 3300046513 | Bacteria | 1434 |
| 301 | Ga0495628_0173299 | 3300046516 | Bacteria | 1635 |
| 302 | Ga0495666_0242241 | 3300046526 | Bacteria | 823 |
| 303 | Ga0495652_0381482 | 3300046529 | Bacteria | 1002 |
| 304 | Ga0495665_0454023 | 3300046531 | Bacteria | 648 |
| 305 | Ga0495665_0605014 | 3300046531 | Bacteria | 548 |
| 306 | Ga0495640_0071068 | 3300046533 | Bacteria | 2336 |
| 307 | Ga0495586_0161339 | 3300046535 | Bacteria | 1265 |
| 308 | Ga0495587_0588499 | 3300046536 | Bacteria | 613 |
| 309 | Ga0495645_0119239 | 3300046543 | Bacteria | 1859 |
| 310 | Ga0495645_0352701 | 3300046543 | Bacteria | 947 |
| 311 | Ga0495645_0397380 | 3300046543 | Bacteria | 879 |
| 312 | Ga0495667_0135831 | 3300046559 | Bacteria | 1585 |
| 313 | Ga0495667_0179555 | 3300046559 | Bacteria | 1359 |
| 314 | Ga0495668_0696668 | 3300046616 | Bacteria | 562 |
| 315 | Ga0495634_0060140 | 3300046642 | Bacteria | 2529 |
| 316 | Ga0495625_0231376 | 3300046660 | Bacteria | 1207 |
| 317 | Ga0495625_0287807 | 3300046660 | Bacteria | 1055 |
| 318 | Ga0495625_0586770 | 3300046660 | Bacteria | 671 |
| 319 | Ga0495635_0094634 | 3300046663 | Bacteria | 2042 |
| 320 | Ga0495657_0099712 | 3300046675 | Bacteria | 1852 |
| 321 | Ga0495599_0017765 | 3300046678 | Bacteria | 4426 |
| 322 | Ga0495623_0035561 | 3300046679 | Bacteria | 3192 |
| 323 | Ga0495646_0038219 | 3300046680 | Bacteria | 2965 |
| 324 | Ga0495647_0291830 | 3300046681 | Bacteria | 734 |
| 325 | Ga0495658_0147781 | 3300046683 | Bacteria | 1442 |
| 326 | Ga0495613_0177775 | 3300046689 | Bacteria | 1508 |
| 327 | Ga0495624_0258395 | 3300046690 | Bacteria | 1053 |
| 328 | Ga0495589_0589180 | 3300046794 | Bacteria | 507 |
| 329 | Ga0495600_0064718 | 3300046809 | Bacteria | 2390 |
| 330 | Ga0495581_0186111 | 3300047315 | Bacteria | 1215 |
| 331 | Ga0495604_0156077 | 3300047317 | Bacteria | 1616 |
| 332 | Ga0495674_0108833 | 3300047319 | Bacteria | 2351 |
| 333 | Ga0495674_1036651 | 3300047319 | Bacteria | 627 |
| 334 | Ga0495672_0091393 | 3300047320 | Bacteria | 1671 |
| 335 | Ga0495672_0403897 | 3300047320 | Bacteria | 624 |
| 336 | Ga0495676_0243682 | 3300047321 | Bacteria | 1230 |
| 337 | Ga0495680_0117368 | 3300047322 | Bacteria | 1967 |
| 338 | Ga0495675_0243778 | 3300047444 | Bacteria | 1081 |
| 339 | Ga0495675_0704836 | 3300047444 | Bacteria | 565 |
| 340 | Ga0495684_0252871 | 3300047471 | Bacteria | 1281 |
| 341 | Ga0495686_0142332 | 3300047472 | Bacteria | 1414 |
| 342 | Ga0495686_0152838 | 3300047472 | Bacteria | 1354 |
| 343 | Ga0495602_0042806 | 3300048088 | Bacteria | 4122 |
| 344 | Ga0495602_0961494 | 3300048088 | Bacteria | 565 |
| 345 | Ga0496100_0725865 | 3300048903 | Bacteria | 776 |
| 346 | Ga0496104_1653446 | 3300048907 | Bacteria | 543 |
| 347 | Ga0496106_0844831 | 3300048909 | Bacteria | 725 |
| 348 | Ga0496107_0906420 | 3300048910 | Bacteria | 642 |
| 349 | Ga0496108_1679143 | 3300048911 | Bacteria | 523 |
| 350 | Ga0496109_2053333 | 3300048912 | Bacteria | 503 |
| 351 | Ga0496112_1424084 | 3300048915 | Bacteria | 607 |
| 352 | Ga0496121_0104182 | 3300048924 | Bacteria | 2181 |
| 353 | Ga0496121_0366326 | 3300048924 | Bacteria | 955 |
| 354 | Ga0496124_0238267 | 3300048927 | Bacteria | 1355 |
| 355 | Ga0496125_0448328 | 3300048928 | Bacteria | 740 |
| 356 | Ga0496126_0176002 | 3300048929 | Bacteria | 1820 |
| 357 | Ga0496126_0362302 | 3300048929 | Bacteria | 1184 |
| 358 | Ga0501308_007539 | 3300049128 | Bacteria | 1142 |
| 359 | Ga0501308_009543 | 3300049128 | Bacteria | 1062 |
| 360 | Ga0501309_011219 | 3300049129 | Bacteria | 1165 |
| 361 | Ga0501310_017721 | 3300049130 | Bacteria | 864 |
| 362 | Ga0501310_072748 | 3300049130 | Bacteria | 529 |
| 363 | Ga0501305_006864 | 3300049161 | Bacteria | 1427 |
| 364 | Ga0501305_024575 | 3300049161 | Bacteria | 909 |
| 365 | Ga0501307_008318 | 3300049162 | Bacteria | 1163 |
| 366 | Ga0501307_009009 | 3300049162 | Bacteria | 1134 |
| 367 | Ga0495682_0104651 | 3300049460 | Bacteria | 1015 |
| 368 | Ga0501311_025904 | 3300049527 | Bacteria | 824 |
| 369 | Ga0501312_014612 | 3300049528 | Bacteria | 1105 |
| 370 | Ga0501313_010428 | 3300049529 | Bacteria | 1059 |
| 371 | Ga0501317_080817 | 3300049533 | Bacteria | 562 |
| 372 | Ga0501318_030877 | 3300049534 | Bacteria | 729 |
| 373 | Ga0501318_071047 | 3300049534 | Bacteria | 550 |
| 374 | Ga0501031_0153854 | 3300049568 | Bacteria | 1503 |
| 375 | Ga0501031_0723620 | 3300049568 | Bacteria | 639 |
| 376 | Ga0501032_0132893 | 3300049569 | Bacteria | 1641 |
| 377 | Ga0501032_0220772 | 3300049569 | Bacteria | 1233 |
| 378 | Ga0501033_0002868 | 3300049570 | Bacteria | 14446 |
| 379 | Ga0501033_0911454 | 3300049570 | Bacteria | 590 |
| 380 | Ga0501034_0248544 | 3300049571 | Bacteria | 1723 |
| 381 | Ga0501034_0272756 | 3300049571 | Bacteria | 1632 |
| 382 | Ga0501034_0476746 | 3300049571 | Bacteria | 1163 |
| 383 | Ga0501034_1285823 | 3300049571 | Bacteria | 608 |
| 384 | Ga0501036_0004388 | 3300049572 | Bacteria | 11382 |
| 385 | Ga0501036_0248625 | 3300049572 | Bacteria | 1490 |
| 386 | Ga0501036_1353824 | 3300049572 | Bacteria | 578 |
| 387 | Ga0501037_0005102 | 3300049573 | Bacteria | 9553 |
| 388 | Ga0501037_0127547 | 3300049573 | Bacteria | 1826 |
| 389 | Ga0501037_0132069 | 3300049573 | Bacteria | 1790 |
| 390 | Ga0501037_0793901 | 3300049573 | Bacteria | 625 |
| 391 | Ga0501038_0041189 | 3300049574 | Bacteria | 4028 |
| 392 | Ga0501038_0147840 | 3300049574 | Bacteria | 1917 |
| 393 | Ga0501038_0375081 | 3300049574 | Bacteria | 1104 |
| 394 | Ga0501039_0000586 | 3300049575 | Bacteria | 26318 |
| 395 | Ga0501039_0357081 | 3300049575 | Bacteria | 1148 |
| 396 | Ga0501043_0075721 | 3300049579 | Bacteria | 2643 |
| 397 | Ga0501043_0502702 | 3300049579 | Bacteria | 905 |
| 398 | Ga0501043_0596008 | 3300049579 | Bacteria | 817 |
| 399 | Ga0501046_0001687 | 3300049580 | Bacteria | 21108 |
| 400 | Ga0501047_0019030 | 3300049581 | Bacteria | 6587 |
| 401 | Ga0501047_0029240 | 3300049581 | Bacteria | 5314 |
| 402 | Ga0501047_0604483 | 3300049581 | Bacteria | 918 |
| 403 | Ga0501048_0951112 | 3300049582 | Bacteria | 618 |
| 404 | Ga0501067_0000637 | 3300049583 | Bacteria | 18857 |
| 405 | Ga0501067_0249699 | 3300049583 | Bacteria | 987 |
| 406 | Ga0501067_0860177 | 3300049583 | Bacteria | 511 |
| 407 | Ga0501068_0215628 | 3300049584 | Bacteria | 1219 |
| 408 | Ga0501068_0508807 | 3300049584 | Bacteria | 781 |
| 409 | Ga0501069_0001620 | 3300049585 | Bacteria | 11147 |
| 410 | Ga0501069_0080708 | 3300049585 | Bacteria | 1832 |
| 411 | Ga0501069_0176633 | 3300049585 | Bacteria | 1234 |
| 412 | Ga0501070_0011494 | 3300049586 | Bacteria | 7477 |
| 413 | Ga0501070_0074398 | 3300049586 | Bacteria | 2812 |
| 414 | Ga0501070_0298577 | 3300049586 | Bacteria | 1312 |
| 415 | Ga0501070_0330232 | 3300049586 | Bacteria | 1239 |
| 416 | Ga0501070_0457682 | 3300049586 | Bacteria | 1028 |
| 417 | Ga0501070_1150848 | 3300049586 | Bacteria | 597 |
| 418 | Ga0501070_1187690 | 3300049586 | Bacteria | 586 |
| 419 | Ga0501071_0221161 | 3300049587 | Bacteria | 1425 |
| 420 | Ga0501072_0314758 | 3300049588 | Bacteria | 1244 |
| 421 | Ga0501072_0672391 | 3300049588 | Bacteria | 814 |
| 422 | Ga0501073_0003399 | 3300049589 | Bacteria | 11970 |
| 423 | Ga0501073_0003816 | 3300049589 | Bacteria | 11308 |
| 424 | Ga0501073_0029259 | 3300049589 | Bacteria | 3936 |
| 425 | Ga0501073_0190384 | 3300049589 | Bacteria | 1420 |
| 426 | Ga0501074_0033799 | 3300049590 | Bacteria | 3707 |
| 427 | Ga0501075_0820561 | 3300049591 | Bacteria | 708 |
| 428 | Ga0501075_1156816 | 3300049591 | Bacteria | 587 |
| 429 | Ga0501076_0311928 | 3300049592 | Bacteria | 1290 |
| 430 | Ga0501076_0476556 | 3300049592 | Bacteria | 1028 |
| 431 | Ga0501076_0911163 | 3300049592 | Bacteria | 725 |
| 432 | Ga0501077_0646780 | 3300049593 | Bacteria | 679 |
| 433 | Ga0501079_0033800 | 3300049741 | Bacteria | 3935 |
| 434 | Ga0501079_0302784 | 3300049741 | Bacteria | 1251 |
| 435 | Ga0501080_0082919 | 3300049742 | Bacteria | 2978 |
| 436 | Ga0501080_0114718 | 3300049742 | Bacteria | 2498 |
| 437 | Ga0501080_0278707 | 3300049742 | Bacteria | 1520 |
| 438 | Ga0501080_0283854 | 3300049742 | Bacteria | 1504 |
| 439 | Ga0501080_0430412 | 3300049742 | Bacteria | 1184 |
| 440 | Ga0501080_0483272 | 3300049742 | Bacteria | 1108 |
| 441 | Ga0501083_0009245 | 3300049744 | Bacteria | 6958 |
| 442 | Ga0501083_0014363 | 3300049744 | Bacteria | 5538 |
| 443 | Ga0501083_0599744 | 3300049744 | Bacteria | 716 |
| 444 | Ga0501035_0003442 | 3300049822 | Bacteria | 15145 |
| 445 | Ga0501035_0152607 | 3300049822 | Bacteria | 2004 |
| 446 | Ga0501035_1187316 | 3300049822 | Bacteria | 592 |
| 447 | Ga0501044_0045787 | 3300049823 | Bacteria | 4531 |
| 448 | Ga0501044_0048014 | 3300049823 | Bacteria | 4412 |
| 449 | Ga0501044_0129026 | 3300049823 | Bacteria | 2524 |
| 450 | Ga0501044_0142961 | 3300049823 | Bacteria | 2380 |
| 451 | Ga0501044_0212080 | 3300049823 | Bacteria | 1890 |
| 452 | Ga0501044_0231204 | 3300049823 | Bacteria | 1796 |
| 453 | Ga0501044_0993776 | 3300049823 | Bacteria | 711 |
| 454 | nmdc:mga03683_283207_c1 | 3300050489 | Bacteria | 775 |
| 455 | nmdc:mga03683_71553_c1 | 3300050489 | Bacteria | 1483 |
| 456 | nmdc:mga00v17_13050_c2 | 3300050491 | Bacteria | 1654 |
| 457 | nmdc:mga0k408_109616_c1 | 3300050493 | Bacteria | 1631 |
| 458 | nmdc:mga0k408_54580_c1 | 3300050493 | Bacteria | 2316 |
| 459 | nmdc:mga06z11_816980_c1 | 3300050494 | Bacteria | 568 |
| 460 | nmdc:mga05p37_114305_c1 | 3300050507 | Bacteria | 3318 |
| 461 | nmdc:mga09592_1537256_c1 | 3300050508 | Bacteria | 540 |
| 462 | nmdc:mga09592_365392_c1 | 3300050508 | Bacteria | 1248 |
| 463 | nmdc:mga06r32_1060925_c1 | 3300050510 | Bacteria | 761 |
| 464 | nmdc:mga08x19_1257716_c1 | 3300050514 | Bacteria | 524 |
| 465 | nmdc:mga08x19_771932_c1 | 3300050514 | Bacteria | 682 |
| 466 | nmdc:mga0sz30_31346_c1 | 3300050516 | Bacteria | 2199 |
| 467 | Ga0495601_0070742 | 3300053077 | Bacteria | 2227 |
| 468 | Ga0495619_0139198 | 3300053085 | Bacteria | 1670 |
| 469 | Ga0495619_0374838 | 3300053085 | Bacteria | 983 |
| 470 | Ga0495619_0680762 | 3300053085 | Bacteria | 700 |
| 471 | Ga0500644_0008950 | 3300053088 | Bacteria | 2660 |
| 472 | Ga0500646_0090176 | 3300053090 | Bacteria | 948 |
| 473 | Ga0500647_0037188 | 3300053091 | Bacteria | 2329 |
| 474 | Ga0500651_0051744 | 3300053093 | Bacteria | 2576 |
| 475 | Ga0500651_0408585 | 3300053093 | Bacteria | 761 |
| 476 | Ga0500651_0762378 | 3300053093 | Bacteria | 513 |
| 477 | Ga0500566_0008660 | 3300053094 | Bacteria | 6017 |
| 478 | Ga0500566_0285636 | 3300053094 | Bacteria | 784 |
| 479 | Ga0500641_0096596 | 3300053096 | Bacteria | 1264 |
| 480 | Ga0500555_001311 | 3300053103 | Bacteria | 7856 |
| 481 | Ga0500593_002181 | 3300053117 | Bacteria | 7128 |
| 482 | Ga0500595_002391 | 3300053119 | Bacteria | 9372 |
| 483 | Ga0500595_080042 | 3300053119 | Bacteria | 957 |
| 484 | Ga0500608_023066 | 3300053122 | Bacteria | 2892 |
| 485 | Ga0500614_082332 | 3300053123 | Bacteria | 903 |
| 486 | Ga0500642_0001084 | 3300053130 | Bacteria | 7809 |
| 487 | Ga0500642_0213759 | 3300053130 | Bacteria | 894 |
| 488 | Ga0500642_0236937 | 3300053130 | Bacteria | 842 |
| 489 | Ga0500642_0317425 | 3300053130 | Bacteria | 699 |
| 490 | Ga0500652_167741 | 3300053131 | Bacteria | 905 |
| 491 | Ga0500652_405374 | 3300053131 | Bacteria | 503 |
| 492 | Ga0500658_0057978 | 3300053134 | Bacteria | 1602 |
| 493 | Ga0500658_0316388 | 3300053134 | Bacteria | 717 |
| 494 | Ga0500559_0125598 | 3300053136 | Bacteria | 1195 |
| 495 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 496 | Ga0500568_0066611 | 3300053139 | Bacteria | 1384 |
| 497 | Ga0500577_0124830 | 3300053142 | Bacteria | 1074 |
| 498 | Ga0500577_0390602 | 3300053142 | Bacteria | 609 |
| 499 | Ga0500588_0257162 | 3300053146 | Bacteria | 656 |
| 500 | Ga0500604_0078306 | 3300053151 | Bacteria | 1064 |
| 501 | Ga0500616_0000806 | 3300053153 | Bacteria | 35829 |
| 502 | Ga0500616_0358423 | 3300053153 | Bacteria | 591 |
| 503 | Ga0500622_0000695 | 3300053156 | Bacteria | 29628 |
| 504 | Ga0500627_0213537 | 3300053158 | Bacteria | 863 |
| 505 | Ga0500611_042214 | 3300053727 | Bacteria | 1007 |
| 506 | Ga0500609_006801 | 3300053731 | Bacteria | 1552 |
| 507 | Ga0500656_065166 | 3300053732 | Bacteria | 553 |
| 508 | Ga0500599_027757 | 3300053736 | Bacteria | 830 |
| 509 | Ga0501084_0029932 | 3300054114 | Bacteria | 4554 |
| 510 | Ga0501084_0071268 | 3300054114 | Bacteria | 2910 |
| 511 | Ga0501084_0672841 | 3300054114 | Bacteria | 873 |
| 512 | Ga0590071_089889 | 3300059421 | Bacteria | 768 |
| 513 | Ga0590074_012761 | 3300059423 | Bacteria | 1415 |
| 514 | Ga0587070_234709 | 3300059491 | Bacteria | 503 |
| 515 | Ga0587082_085620 | 3300059504 | Bacteria | 664 |
| 516 | Ga0587085_184392 | 3300059506 | Bacteria | 502 |
| 517 | Ga0587106_035783 | 3300059605 | Bacteria | 820 |
| 518 | Ga0587109_137226 | 3300059624 | Bacteria | 594 |
| 519 | Ga0587115_011982 | 3300059626 | Bacteria | 1101 |
| 520 | Ga0587068_123033 | 3300059641 | Bacteria | 565 |
| 521 | Ga0587111_0009514 | 3300060346 | Bacteria | 1641 |
| 522 | Ga0587111_0023461 | 3300060346 | Bacteria | 1207 |
| 523 | Ga0587111_0211827 | 3300060346 | Bacteria | 555 |
| 524 | Ga0501082_0173578 | 3300060353 | Bacteria | 1874 |
| 525 | Ga0501082_0253349 | 3300060353 | Bacteria | 1531 |
| 526 | Ga0501082_0349394 | 3300060353 | Bacteria | 1289 |
| 527 | Ga0501082_0752659 | 3300060353 | Bacteria | 853 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100243064 | Ga0068867_1002430643 | 64 |
| 2 | 3300005841 | Ga0068863_100227987 | Ga0068863_1002279872 | 64 |
| 3 | 3300006237 | Ga0097621_100557516 | Ga0097621_1005575163 | 64 |
| 4 | 3300006881 | Ga0068865_100001757 | Ga0068865_1000017574 | 64 |
| 5 | 3300009176 | Ga0105242_10061433 | Ga0105242_100614332 | 64 |
| 6 | 3300013297 | Ga0157378_11536890 | Ga0157378_115368902 | 64 |
| 7 | 3300014325 | Ga0163163_10157871 | Ga0163163_101578714 | 64 |
| 8 | 3300025321 | Ga0207656_10181164 | Ga0207656_101811642 | 64 |
| 9 | 3300025938 | Ga0207704_10273532 | Ga0207704_102735321 | 64 |
| 10 | 3300025941 | Ga0207711_10001297 | Ga0207711_1000129716 | 64 |
| 11 | 3300031251 | Ga0265327_10097903 | Ga0265327_100979032 | 64 |
| 12 | 3300031616 | Ga0307508_10600941 | Ga0307508_106009412 | 64 |
| 13 | 3300035170 | Ga0373943_0530360 | Ga0373943_0530360_272_550 | 64 |
| 14 | 3300035171 | Ga0373946_0019520 | Ga0373946_0019520_2045_2323 | 64 |
| 15 | 3300035695 | Ga0373927_0004761 | Ga0373927_0004761_3447_3725 | 64 |
| 16 | 3300035725 | Ga0373947_0067217 | Ga0373947_0067217_1485_1763 | 64 |
| 17 | 3300037068 | Ga0373925_0000039 | Ga0373925_0000039_122532_122810 | 64 |
| 18 | 3300046462 | Ga0495651_0304508 | Ga0495651_0304508_341_619 | 64 |
| 19 | 3300046516 | Ga0495628_0173299 | Ga0495628_0173299_282_560 | 64 |
| 20 | 3300046531 | Ga0495665_0605014 | Ga0495665_0605014_105_383 | 64 |
| 21 | 3300046543 | Ga0495645_0119239 | Ga0495645_0119239_457_735 | 64 |
| 22 | 3300047319 | Ga0495674_1036651 | Ga0495674_1036651_309_587 | 64 |
| 23 | 3300048903 | Ga0496100_0725865 | Ga0496100_0725865_347_625 | 64 |
| 24 | 3300049161 | Ga0501305_024575 | Ga0501305_024575_501_788 | 64 |
| 25 | 3300049581 | Ga0501047_0604483 | Ga0501047_0604483_95_382 | 64 |
| 26 | 3300031247 | Ga0265340_10149554 | Ga0265340_101495542 | 65 |
| 27 | 3300037068 | Ga0373925_0967496 | Ga0373925_0967496_411_680 | 65 |
| 28 | 3300006846 | Ga0075430_101720585 | Ga0075430_1017205852 | 66 |
| 29 | 3300006847 | Ga0075431_100273750 | Ga0075431_1002737502 | 66 |
| 30 | 3300006880 | Ga0075429_101169420 | Ga0075429_1011694202 | 66 |
| 31 | 3300009148 | Ga0105243_10870946 | Ga0105243_108709462 | 66 |
| 32 | 3300025935 | Ga0207709_10489966 | Ga0207709_104899662 | 66 |
| 33 | 3300031548 | Ga0307408_100049522 | Ga0307408_1000495225 | 66 |
| 34 | 3300031731 | Ga0307405_11341027 | Ga0307405_113410271 | 66 |
| 35 | 3300031852 | Ga0307410_10083954 | Ga0307410_100839542 | 66 |
| 36 | 3300031903 | Ga0307407_10058233 | Ga0307407_100582334 | 66 |
| 37 | 3300031995 | Ga0307409_100779109 | Ga0307409_1007791092 | 66 |
| 38 | 3300032002 | Ga0307416_101364959 | Ga0307416_1013649592 | 66 |
| 39 | 3300032005 | Ga0307411_10246740 | Ga0307411_102467402 | 66 |
| 40 | 3300042006 | Ga0439432_172184 | Ga0439432_172184_197_469 | 66 |
| 41 | 3300042008 | Ga0439450_087306 | Ga0439450_087306_484_756 | 66 |
| 42 | 3300042876 | Ga0451577_0266672 | Ga0451577_0266672_104_403 | 66 |
| 43 | 3300046660 | Ga0495625_0586770 | Ga0495625_0586770_172_444 | 66 |
| 44 | 3300049128 | Ga0501308_009543 | Ga0501308_009543_373_645 | 66 |
| 45 | 3300049129 | Ga0501309_011219 | Ga0501309_011219_504_776 | 66 |
| 46 | 3300049130 | Ga0501310_017721 | Ga0501310_017721_378_650 | 66 |
| 47 | 3300049161 | Ga0501305_006864 | Ga0501305_006864_679_951 | 66 |
| 48 | 3300049162 | Ga0501307_008318 | Ga0501307_008318_378_650 | 66 |
| 49 | 3300049527 | Ga0501311_025904 | Ga0501311_025904_18_290 | 66 |
| 50 | 3300049528 | Ga0501312_014612 | Ga0501312_014612_542_814 | 66 |
| 51 | 3300049534 | Ga0501318_030877 | Ga0501318_030877_194_466 | 66 |
| 52 | 3300049592 | Ga0501076_0911163 | Ga0501076_0911163_419_691 | 66 |
| 53 | 3300050489 | nmdc:mga03683_283207_c1 | nmdc:mga03683_283207_c1_429_701 | 66 |
| 54 | 3300050508 | nmdc:mga09592_365392_c1 | nmdc:mga09592_365392_c1_293_565 | 66 |
| 55 | 3300050510 | nmdc:mga06r32_1060925_c1 | nmdc:mga06r32_1060925_c1_79_351 | 66 |
| 56 | 3300059421 | Ga0590071_089889 | Ga0590071_089889_193_465 | 66 |
| 57 | 3300059423 | Ga0590074_012761 | Ga0590074_012761_952_1224 | 66 |
| 58 | 3300060353 | Ga0501082_0752659 | Ga0501082_0752659_542_814 | 66 |
| 59 | 3300005983 | Ga0081540_1192960 | Ga0081540_11929601 | 67 |
| 60 | 3300006846 | Ga0075430_100099700 | Ga0075430_1000997002 | 67 |
| 61 | 3300049591 | Ga0501075_0820561 | Ga0501075_0820561_174_443 | 67 |
| 62 | 3300050507 | nmdc:mga05p37_114305_c1 | nmdc:mga05p37_114305_c1_1019_1291 | 67 |
| 63 | 3300053130 | Ga0500642_0001084 | Ga0500642_0001084_889_1194 | 67 |
| 64 | 3300009093 | Ga0105240_10539403 | Ga0105240_105394032 | 68 |
| 65 | 3300009551 | Ga0105238_10005330 | Ga0105238_100053304 | 68 |
| 66 | 3300021388 | Ga0213875_10000664 | Ga0213875_1000066412 | 68 |
| 67 | 3300025924 | Ga0207694_10040185 | Ga0207694_100401854 | 68 |
| 68 | 3300025945 | Ga0207679_10244632 | Ga0207679_102446322 | 68 |
| 69 | 3300026041 | Ga0207639_10201199 | Ga0207639_102011993 | 68 |
| 70 | 3300031995 | Ga0307409_100344579 | Ga0307409_1003445792 | 68 |
| 71 | 3300013100 | Ga0157373_10471274 | Ga0157373_104712742 | 69 |
| 72 | 3300023552 | Ga0247551_105454 | Ga0247551_1054542 | 69 |
| 73 | 3300026078 | Ga0207702_10381354 | Ga0207702_103813542 | 69 |
| 74 | 3300032120 | Ga0316053_109592 | Ga0316053_1095921 | 69 |
| 75 | 3300037471 | Ga0395905_1437777 | Ga0395905_1437777_255_545 | 69 |
| 76 | 3300041509 | Ga0451843_0458584 | Ga0451843_0458584_15_320 | 69 |
| 77 | 3300044683 | Ga0466965_0872245 | Ga0466965_0872245_28_267 | 69 |
| 78 | 3300049579 | Ga0501043_0596008 | Ga0501043_0596008_159_446 | 69 |
| 79 | 3300003791 | Ga0055530_10079380 | Ga0055530_100793801 | 70 |
| 80 | 3300003794 | Ga0055531_10014275 | Ga0055531_100142755 | 70 |
| 81 | 3300005617 | Ga0068859_100811759 | Ga0068859_1008117591 | 70 |
| 82 | 3300005843 | Ga0068860_100549647 | Ga0068860_1005496472 | 70 |
| 83 | 3300005844 | Ga0068862_100025088 | Ga0068862_1000250884 | 70 |
| 84 | 3300006178 | Ga0075367_10467008 | Ga0075367_104670082 | 70 |
| 85 | 3300006195 | Ga0075366_10082781 | Ga0075366_100827813 | 70 |
| 86 | 3300006931 | Ga0097620_100811729 | Ga0097620_1008117291 | 70 |
| 87 | 3300025298 | Ga0209050_1003817 | Ga0209050_10038174 | 70 |
| 88 | 3300025302 | Ga0207426_1012533 | Ga0207426_10125333 | 70 |
| 89 | 3300025304 | Ga0209257_1000562 | Ga0209257_100056247 | 70 |
| 90 | 3300025961 | Ga0207712_12041540 | Ga0207712_120415401 | 70 |
| 91 | 3300026041 | Ga0207639_10285643 | Ga0207639_102856433 | 70 |
| 92 | 3300028379 | Ga0268266_11071992 | Ga0268266_110719922 | 70 |
| 93 | 3300028380 | Ga0268265_10054330 | Ga0268265_100543302 | 70 |
| 94 | 3300028381 | Ga0268264_10969109 | Ga0268264_109691092 | 70 |
| 95 | 3300031242 | Ga0265329_10308718 | Ga0265329_103087181 | 70 |
| 96 | 3300031251 | Ga0265327_10011785 | Ga0265327_100117853 | 70 |
| 97 | 3300033180 | Ga0307510_10153476 | Ga0307510_101534762 | 70 |
| 98 | 3300039447 | Ga0436361_0193398 | Ga0436361_0193398_229_534 | 70 |
| 99 | 3300041451 | Ga0451791_1339744 | Ga0451791_1339744_27_263 | 70 |
| 100 | 3300041460 | Ga0451802_0728035 | Ga0451802_0728035_87_323 | 70 |
| 101 | 3300042001 | Ga0439441_080128 | Ga0439441_080128_172_405 | 70 |
| 102 | 3300044712 | Ga0453684_0000071 | Ga0453684_0000071_360835_361110 | 70 |
| 103 | 3300046513 | Ga0495616_0092026 | Ga0495616_0092026_915_1220 | 70 |
| 104 | 3300046660 | Ga0495625_0287807 | Ga0495625_0287807_83_391 | 70 |
| 105 | 3300047472 | Ga0495686_0152838 | Ga0495686_0152838_88_324 | 70 |
| 106 | 3300049573 | Ga0501037_0127547 | Ga0501037_0127547_1461_1760 | 70 |
| 107 | 3300050494 | nmdc:mga06z11_816980_c1 | nmdc:mga06z11_816980_c1_213_515 | 70 |
| 108 | 3300050514 | nmdc:mga08x19_1257716_c1 | nmdc:mga08x19_1257716_c1_183_416 | 70 |
| 109 | 3300053103 | Ga0500555_001311 | Ga0500555_001311_5087_5323 | 70 |
| 110 | 3300053130 | Ga0500642_0213759 | Ga0500642_0213759_170_475 | 70 |
| 111 | 3300053130 | Ga0500642_0317425 | Ga0500642_0317425_170_472 | 70 |
| 112 | 3300053134 | Ga0500658_0316388 | Ga0500658_0316388_29_331 | 70 |
| 113 | 3300053139 | Ga0500568_0066611 | Ga0500568_0066611_93_398 | 70 |
| 114 | 3300053151 | Ga0500604_0078306 | Ga0500604_0078306_418_720 | 70 |
| 115 | 3300053153 | Ga0500616_0000806 | Ga0500616_0000806_26905_27204 | 70 |
| 116 | 3300053727 | Ga0500611_042214 | Ga0500611_042214_107_412 | 70 |
| 117 | 3300053731 | Ga0500609_006801 | Ga0500609_006801_125_430 | 70 |
| 118 | 3300053732 | Ga0500656_065166 | Ga0500656_065166_100_405 | 70 |
| 119 | 3300053736 | Ga0500599_027757 | Ga0500599_027757_205_513 | 70 |
| 120 | 3300060346 | Ga0587111_0009514 | Ga0587111_0009514_614_913 | 70 |
| 121 | iso_pu_bacteria | 2643221733 | 2644728724 | 70 |
| 122 | iso_pu_bacteria | 2643221734 | 2644735936 | 70 |
| 123 | iso_pu_bacteria | 2643221736 | 2644747199 | 70 |
| 124 | iso_pu_bacteria | 2818991439 | 2819560238 | 70 |
| 125 | iso_pu_bacteria | 2818991467 | 2819718131 | 70 |
| 126 | iso_pu_bacteria | 2821123053 | 2821128286 | 70 |
| 127 | iso_pu_bacteria | 2841760612 | 2841762065 | 70 |
| 128 | iso_pu_bacteria | 2841911363 | 2841916508 | 70 |
| 129 | iso_pu_bacteria | 2841917233 | 2841922405 | 70 |
| 130 | iso_pu_bacteria | 2844104063 | 2844105090 | 70 |
| 131 | iso_pu_bacteria | 2851182111 | 2851183430 | 70 |
| 132 | iso_pu_bacteria | 2851246043 | 2851248078 | 70 |
| 133 | iso_pu_bacteria | 2894817345 | 2894819714 | 70 |
| 134 | iso_pu_bacteria | 2917699015 | 2917699451 | 70 |
| 135 | iso_pu_bacteria | 8057529695 | 8057529772 | 70 |
| 136 | 3300003215 | JGI25153J46596_10000054 | JGI25153J46596_10000054134 | 71 |
| 137 | 3300003215 | JGI25153J46596_10001297 | JGI25153J46596_1000129715 | 71 |
| 138 | 3300005435 | Ga0070714_101556430 | Ga0070714_1015564302 | 71 |
| 139 | 3300005841 | Ga0068863_101224720 | Ga0068863_1012247202 | 71 |
| 140 | 3300005937 | Ga0081455_10088701 | Ga0081455_100887013 | 71 |
| 141 | 3300005983 | Ga0081540_1071562 | Ga0081540_10715622 | 71 |
| 142 | 3300006353 | Ga0075370_10059673 | Ga0075370_100596733 | 71 |
| 143 | 3300021384 | Ga0213876_10169237 | Ga0213876_101692371 | 71 |
| 144 | 3300025297 | Ga0209758_1000119 | Ga0209758_1000119179 | 71 |
| 145 | 3300025297 | Ga0209758_1027446 | Ga0209758_10274462 | 71 |
| 146 | 3300025304 | Ga0209257_1059605 | Ga0209257_10596052 | 71 |
| 147 | 3300025304 | Ga0209257_1067970 | Ga0209257_10679702 | 71 |
| 148 | 3300025929 | Ga0207664_10472897 | Ga0207664_104728971 | 71 |
| 149 | 3300026116 | Ga0207674_10987839 | Ga0207674_109878392 | 71 |
| 150 | 3300031616 | Ga0307508_10056257 | Ga0307508_100562574 | 71 |
| 151 | 3300031730 | Ga0307516_10270669 | Ga0307516_102706692 | 71 |
| 152 | 3300035398 | Ga0316574_0695530 | Ga0316574_0695530_271_510 | 71 |
| 153 | 3300039437 | Ga0436365_1296229 | Ga0436365_1296229_613_849 | 71 |
| 154 | 3300039438 | Ga0436360_0522391 | Ga0436360_0522391_137_373 | 71 |
| 155 | 3300039438 | Ga0436360_0800899 | Ga0436360_0800899_451_687 | 71 |
| 156 | 3300039447 | Ga0436361_1163408 | Ga0436361_1163408_279_515 | 71 |
| 157 | 3300039450 | Ga0436363_0439365 | Ga0436363_0439365_124_360 | 71 |
| 158 | 3300049568 | Ga0501031_0153854 | Ga0501031_0153854_720_998 | 71 |
| 159 | 3300049568 | Ga0501031_0723620 | Ga0501031_0723620_280_576 | 71 |
| 160 | 3300049569 | Ga0501032_0132893 | Ga0501032_0132893_881_1180 | 71 |
| 161 | 3300049569 | Ga0501032_0220772 | Ga0501032_0220772_917_1195 | 71 |
| 162 | 3300049570 | Ga0501033_0002868 | Ga0501033_0002868_10077_10355 | 71 |
| 163 | 3300049571 | Ga0501034_0248544 | Ga0501034_0248544_237_536 | 71 |
| 164 | 3300049571 | Ga0501034_0272756 | Ga0501034_0272756_435_731 | 71 |
| 165 | 3300049571 | Ga0501034_1285823 | Ga0501034_1285823_39_317 | 71 |
| 166 | 3300049572 | Ga0501036_0004388 | Ga0501036_0004388_9295_9573 | 71 |
| 167 | 3300049572 | Ga0501036_0248625 | Ga0501036_0248625_546_845 | 71 |
| 168 | 3300049573 | Ga0501037_0005102 | Ga0501037_0005102_1619_1897 | 71 |
| 169 | 3300049573 | Ga0501037_0793901 | Ga0501037_0793901_247_546 | 71 |
| 170 | 3300049574 | Ga0501038_0041189 | Ga0501038_0041189_38_316 | 71 |
| 171 | 3300049574 | Ga0501038_0147840 | Ga0501038_0147840_1436_1735 | 71 |
| 172 | 3300049574 | Ga0501038_0375081 | Ga0501038_0375081_431_727 | 71 |
| 173 | 3300049575 | Ga0501039_0000586 | Ga0501039_0000586_5639_5917 | 71 |
| 174 | 3300049575 | Ga0501039_0357081 | Ga0501039_0357081_603_902 | 71 |
| 175 | 3300049579 | Ga0501043_0075721 | Ga0501043_0075721_868_1146 | 71 |
| 176 | 3300049579 | Ga0501043_0502702 | Ga0501043_0502702_368_667 | 71 |
| 177 | 3300049580 | Ga0501046_0001687 | Ga0501046_0001687_167_445 | 71 |
| 178 | 3300049581 | Ga0501047_0019030 | Ga0501047_0019030_5637_5936 | 71 |
| 179 | 3300049581 | Ga0501047_0029240 | Ga0501047_0029240_4005_4283 | 71 |
| 180 | 3300049582 | Ga0501048_0951112 | Ga0501048_0951112_239_535 | 71 |
| 181 | 3300049583 | Ga0501067_0000637 | Ga0501067_0000637_2575_2853 | 71 |
| 182 | 3300049583 | Ga0501067_0249699 | Ga0501067_0249699_606_905 | 71 |
| 183 | 3300049584 | Ga0501068_0215628 | Ga0501068_0215628_383_679 | 71 |
| 184 | 3300049584 | Ga0501068_0508807 | Ga0501068_0508807_185_484 | 71 |
| 185 | 3300049585 | Ga0501069_0001620 | Ga0501069_0001620_1940_2218 | 71 |
| 186 | 3300049585 | Ga0501069_0080708 | Ga0501069_0080708_508_807 | 71 |
| 187 | 3300049586 | Ga0501070_0011494 | Ga0501070_0011494_4168_4446 | 71 |
| 188 | 3300049586 | Ga0501070_0074398 | Ga0501070_0074398_2478_2777 | 71 |
| 189 | 3300049588 | Ga0501072_0314758 | Ga0501072_0314758_330_608 | 71 |
| 190 | 3300049588 | Ga0501072_0672391 | Ga0501072_0672391_485_784 | 71 |
| 191 | 3300049589 | Ga0501073_0003399 | Ga0501073_0003399_4168_4446 | 71 |
| 192 | 3300049589 | Ga0501073_0029259 | Ga0501073_0029259_1560_1856 | 71 |
| 193 | 3300049590 | Ga0501074_0033799 | Ga0501074_0033799_1811_2089 | 71 |
| 194 | 3300049592 | Ga0501076_0311928 | Ga0501076_0311928_699_977 | 71 |
| 195 | 3300049592 | Ga0501076_0476556 | Ga0501076_0476556_318_617 | 71 |
| 196 | 3300049741 | Ga0501079_0033800 | Ga0501079_0033800_2862_3140 | 71 |
| 197 | 3300049741 | Ga0501079_0302784 | Ga0501079_0302784_528_827 | 71 |
| 198 | 3300049742 | Ga0501080_0278707 | Ga0501080_0278707_982_1281 | 71 |
| 199 | 3300049742 | Ga0501080_0283854 | Ga0501080_0283854_597_893 | 71 |
| 200 | 3300049742 | Ga0501080_0430412 | Ga0501080_0430412_868_1146 | 71 |
| 201 | 3300049744 | Ga0501083_0014363 | Ga0501083_0014363_4297_4596 | 71 |
| 202 | 3300049744 | Ga0501083_0599744 | Ga0501083_0599744_292_570 | 71 |
| 203 | 3300049822 | Ga0501035_0003442 | Ga0501035_0003442_10863_11141 | 71 |
| 204 | 3300049822 | Ga0501035_1187316 | Ga0501035_1187316_68_364 | 71 |
| 205 | 3300049823 | Ga0501044_0045787 | Ga0501044_0045787_3586_3885 | 71 |
| 206 | 3300049823 | Ga0501044_0048014 | Ga0501044_0048014_1451_1729 | 71 |
| 207 | 3300049823 | Ga0501044_0231204 | Ga0501044_0231204_747_1043 | 71 |
| 208 | 3300050493 | nmdc:mga0k408_54580_c1 | nmdc:mga0k408_54580_c1_191_487 | 71 |
| 209 | 3300054114 | Ga0501084_0029932 | Ga0501084_0029932_4107_4385 | 71 |
| 210 | 3300054114 | Ga0501084_0071268 | Ga0501084_0071268_276_575 | 71 |
| 211 | 3300059626 | Ga0587115_011982 | Ga0587115_011982_504_743 | 71 |
| 212 | 3300060346 | Ga0587111_0023461 | Ga0587111_0023461_544_783 | 71 |
| 213 | 3300060353 | Ga0501082_0173578 | Ga0501082_0173578_1525_1824 | 71 |
| 214 | 3300060353 | Ga0501082_0253349 | Ga0501082_0253349_126_404 | 71 |
| 215 | iso_pu_bacteria | 2510461069 | 2510839688 | 71 |
| 216 | iso_pu_bacteria | 2511231027 | 2511392639 | 71 |
| 217 | iso_pu_bacteria | 2534681786 | 2535484217 | 71 |
| 218 | iso_pu_bacteria | 2537561587 | 2537874082 | 71 |
| 219 | iso_pu_bacteria | 2554235003 | 2554247115 | 71 |
| 220 | iso_pu_bacteria | 2558860242 | 2559294339 | 71 |
| 221 | iso_pu_bacteria | 2599185210 | 2599602596 | 71 |
| 222 | iso_pu_bacteria | 2600255279 | 2601608676 | 71 |
| 223 | iso_pu_bacteria | 2600255308 | 2601745450 | 71 |
| 224 | iso_pu_bacteria | 2643221550 | 2643770162 | 71 |
| 225 | iso_pu_bacteria | 2643221551 | 2643774924 | 71 |
| 226 | iso_pu_bacteria | 2643221555 | 2643793368 | 71 |
| 227 | iso_pu_bacteria | 2643221568 | 2643855866 | 71 |
| 228 | iso_pu_bacteria | 2643221582 | 2643918713 | 71 |
| 229 | iso_pu_bacteria | 2643221623 | 2644132918 | 71 |
| 230 | iso_pu_bacteria | 2643221653 | 2644296830 | 71 |
| 231 | iso_pu_bacteria | 2643221693 | 2644518743 | 71 |
| 232 | iso_pu_bacteria | 2643221719 | 2644655084 | 71 |
| 233 | iso_pu_bacteria | 2671180139 | 2671692878 | 71 |
| 234 | iso_pu_bacteria | 2738543024 | 2739306459 | 71 |
| 235 | iso_pu_bacteria | 2751185800 | 2753358808 | 71 |
| 236 | iso_pu_bacteria | 2758568016 | 2758641042 | 71 |
| 237 | iso_pu_bacteria | 2765235802 | 2765465201 | 71 |
| 238 | iso_pu_bacteria | 2767802442 | 2770197348 | 71 |
| 239 | iso_pu_bacteria | 2775506902 | 2776271945 | 71 |
| 240 | iso_pu_bacteria | 2775506904 | 2776279538 | 71 |
| 241 | iso_pu_bacteria | 2808606387 | 2808985888 | 71 |
| 242 | iso_pu_bacteria | 2818991272 | 2819242542 | 71 |
| 243 | iso_pu_bacteria | 2818991439 | 2819556007 | 71 |
| 244 | iso_pu_bacteria | 2838675328 | 2838676734 | 71 |
| 245 | iso_pu_bacteria | 2838714209 | 2838715618 | 71 |
| 246 | iso_pu_bacteria | 2838719591 | 2838720582 | 71 |
| 247 | iso_pu_bacteria | 2838724970 | 2838726374 | 71 |
| 248 | iso_pu_bacteria | 2839993093 | 2839995893 | 71 |
| 249 | iso_pu_bacteria | 2841846520 | 2841847517 | 71 |
| 250 | iso_pu_bacteria | 2841859092 | 2841859946 | 71 |
| 251 | iso_pu_bacteria | 2842124991 | 2842126453 | 71 |
| 252 | iso_pu_bacteria | 2842130223 | 2842131627 | 71 |
| 253 | iso_pu_bacteria | 2842152218 | 2842153204 | 71 |
| 254 | iso_pu_bacteria | 2842170452 | 2842171861 | 71 |
| 255 | iso_pu_bacteria | 2842175837 | 2842176823 | 71 |
| 256 | iso_pu_bacteria | 2842187318 | 2842188726 | 71 |
| 257 | iso_pu_bacteria | 2842211629 | 2842213037 | 71 |
| 258 | iso_pu_bacteria | 2842224351 | 2842225344 | 71 |
| 259 | iso_pu_bacteria | 2842515876 | 2842516731 | 71 |
| 260 | iso_pu_bacteria | 2842871566 | 2842874505 | 71 |
| 261 | iso_pu_bacteria | 2854911287 | 2854914384 | 71 |
| 262 | iso_pu_bacteria | 2889790730 | 2889794247 | 71 |
| 263 | iso_pu_bacteria | 2889914905 | 2889916795 | 71 |
| 264 | iso_pu_bacteria | 2894652903 | 2894654875 | 71 |
| 265 | iso_pu_bacteria | 2899792073 | 2899796606 | 71 |
| 266 | iso_pu_bacteria | 2899845264 | 2899847132 | 71 |
| 267 | iso_pu_bacteria | 2904578770 | 2904581371 | 71 |
| 268 | iso_pu_bacteria | 2915650412 | 2915651267 | 71 |
| 269 | iso_pu_bacteria | 2919114240 | 2919115820 | 71 |
| 270 | iso_pu_bacteria | 2919119836 | 2919122608 | 71 |
| 271 | iso_pu_bacteria | 2919166419 | 2919167368 | 71 |
| 272 | iso_pu_bacteria | 2919171160 | 2919171421 | 71 |
| 273 | iso_pu_bacteria | 2926754445 | 2926756761 | 71 |
| 274 | iso_pu_bacteria | 2926760298 | 2926760999 | 71 |
| 275 | iso_pu_bacteria | 2928521798 | 2928524667 | 71 |
| 276 | iso_pu_bacteria | 2929138655 | 2929139523 | 71 |
| 277 | iso_pu_bacteria | 2933006813 | 2933007847 | 71 |
| 278 | iso_pu_bacteria | 2933011516 | 2933012627 | 71 |
| 279 | iso_pu_bacteria | 2933594066 | 2933595067 | 71 |
| 280 | iso_pu_bacteria | 2954011201 | 2954015141 | 71 |
| 281 | iso_pu_bacteria | 2978969890 | 2978973799 | 71 |
| 282 | iso_pu_bacteria | 2979089926 | 2979093724 | 71 |
| 283 | iso_pu_bacteria | 2979095461 | 2979098893 | 71 |
| 284 | iso_pu_bacteria | 2979100975 | 2979105700 | 71 |
| 285 | iso_pu_bacteria | 2984509177 | 2984512453 | 71 |
| 286 | iso_pu_bacteria | 2984518228 | 2984521186 | 71 |
| 287 | iso_pu_bacteria | 2984537506 | 2984540480 | 71 |
| 288 | iso_pu_bacteria | 2984587000 | 2984589148 | 71 |
| 289 | iso_pu_bacteria | 2984601300 | 2984602677 | 71 |
| 290 | iso_pu_bacteria | 2989776772 | 2989778182 | 71 |
| 291 | iso_pu_bacteria | 3002141150 | 3002143341 | 71 |
| 292 | iso_pu_bacteria | 643348564 | 643602280 | 71 |
| 293 | iso_pu_bacteria | 650716007 | 650739534 | 71 |
| 294 | iso_pu_bacteria | 8002285264 | 8002287801 | 71 |
| 295 | iso_pu_bacteria | 8003570095 | 8003570580 | 71 |
| 296 | iso_pu_bacteria | 8005246636 | 8005251317 | 71 |
| 297 | iso_pu_bacteria | 8054563764 | 8054567671 | 71 |
| 298 | 3300003781 | Ga0055536_1005558 | Ga0055536_10055585 | 72 |
| 299 | 3300005331 | Ga0070670_101212008 | Ga0070670_1012120082 | 72 |
| 300 | 3300005435 | Ga0070714_100635006 | Ga0070714_1006350062 | 72 |
| 301 | 3300005436 | Ga0070713_100110450 | Ga0070713_1001104504 | 72 |
| 302 | 3300005436 | Ga0070713_101019747 | Ga0070713_1010197472 | 72 |
| 303 | 3300005548 | Ga0070665_100162416 | Ga0070665_1001624162 | 72 |
| 304 | 3300005548 | Ga0070665_100708448 | Ga0070665_1007084482 | 72 |
| 305 | 3300005577 | Ga0068857_101998287 | Ga0068857_1019982871 | 72 |
| 306 | 3300005718 | Ga0068866_10549651 | Ga0068866_105496512 | 72 |
| 307 | 3300006028 | Ga0070717_11678818 | Ga0070717_116788182 | 72 |
| 308 | 3300006177 | Ga0075362_10075390 | Ga0075362_100753902 | 72 |
| 309 | 3300006186 | Ga0075369_10279495 | Ga0075369_102794952 | 72 |
| 310 | 3300006195 | Ga0075366_10242502 | Ga0075366_102425022 | 72 |
| 311 | 3300009093 | Ga0105240_12756969 | Ga0105240_127569692 | 72 |
| 312 | 3300009545 | Ga0105237_11377988 | Ga0105237_113779882 | 72 |
| 313 | 3300009545 | Ga0105237_12088236 | Ga0105237_120882362 | 72 |
| 314 | 3300010375 | Ga0105239_10231853 | Ga0105239_102318533 | 72 |
| 315 | 3300010375 | Ga0105239_10350476 | Ga0105239_103504763 | 72 |
| 316 | 3300013297 | Ga0157378_10097156 | Ga0157378_100971561 | 72 |
| 317 | 3300025292 | Ga0209676_1000049 | Ga0209676_1000049281 | 72 |
| 318 | 3300025298 | Ga0209050_1024299 | Ga0209050_10242994 | 72 |
| 319 | 3300025914 | Ga0207671_10922337 | Ga0207671_109223372 | 72 |
| 320 | 3300025915 | Ga0207693_10626588 | Ga0207693_106265882 | 72 |
| 321 | 3300025924 | Ga0207694_10363852 | Ga0207694_103638522 | 72 |
| 322 | 3300025928 | Ga0207700_10190664 | Ga0207700_101906644 | 72 |
| 323 | 3300025928 | Ga0207700_11292092 | Ga0207700_112920922 | 72 |
| 324 | 3300025929 | Ga0207664_11017984 | Ga0207664_110179842 | 72 |
| 325 | 3300025972 | Ga0207668_10346843 | Ga0207668_103468432 | 72 |
| 326 | 3300026023 | Ga0207677_11231926 | Ga0207677_112319262 | 72 |
| 327 | 3300028379 | Ga0268266_10793742 | Ga0268266_107937422 | 72 |
| 328 | 3300028800 | Ga0265338_10711983 | Ga0265338_107119832 | 72 |
| 329 | 3300031235 | Ga0265330_10534558 | Ga0265330_105345582 | 72 |
| 330 | 3300031239 | Ga0265328_10195190 | Ga0265328_101951901 | 72 |
| 331 | 3300031247 | Ga0265340_10106034 | Ga0265340_101060343 | 72 |
| 332 | 3300031616 | Ga0307508_10080921 | Ga0307508_100809213 | 72 |
| 333 | 3300031665 | Ga0316575_10026120 | Ga0316575_100261203 | 72 |
| 334 | 3300031728 | Ga0316578_10105549 | Ga0316578_101055492 | 72 |
| 335 | 3300031733 | Ga0316577_10467707 | Ga0316577_104677072 | 72 |
| 336 | 3300032002 | Ga0307416_101719840 | Ga0307416_1017198401 | 72 |
| 337 | 3300032137 | Ga0316585_10241630 | Ga0316585_102416301 | 72 |
| 338 | 3300033180 | Ga0307510_10248753 | Ga0307510_102487532 | 72 |
| 339 | 3300035086 | Ga0373934_0056229 | Ga0373934_0056229_763_1005 | 72 |
| 340 | 3300035113 | Ga0373936_0503760 | Ga0373936_0503760_121_363 | 72 |
| 341 | 3300035119 | Ga0373956_0408529 | Ga0373956_0408529_142_384 | 72 |
| 342 | 3300035170 | Ga0373943_0164611 | Ga0373943_0164611_945_1187 | 72 |
| 343 | 3300035172 | Ga0373955_0680949 | Ga0373955_0680949_168_410 | 72 |
| 344 | 3300035398 | Ga0316574_0068743 | Ga0316574_0068743_292_537 | 72 |
| 345 | 3300035410 | Ga0373924_0497012 | Ga0373924_0497012_168_410 | 72 |
| 346 | 3300035692 | Ga0373935_0070835 | Ga0373935_0070835_1435_1677 | 72 |
| 347 | 3300035692 | Ga0373935_1228571 | Ga0373935_1228571_169_480 | 72 |
| 348 | 3300035724 | Ga0373933_0434937 | Ga0373933_0434937_50_292 | 72 |
| 349 | 3300036401 | Ga0373937_0039463 | Ga0373937_0039463_115_357 | 72 |
| 350 | 3300036401 | Ga0373937_0193208 | Ga0373937_0193208_778_1089 | 72 |
| 351 | 3300036401 | Ga0373937_0367625 | Ga0373937_0367625_916_1158 | 72 |
| 352 | 3300036647 | Ga0316582_0046611 | Ga0316582_0046611_1221_1466 | 72 |
| 353 | 3300036712 | Ga0316584_0016104 | Ga0316584_0016104_3862_4107 | 72 |
| 354 | 3300037068 | Ga0373925_0455269 | Ga0373925_0455269_466_708 | 72 |
| 355 | 3300039453 | Ga0436362_0745713 | Ga0436362_0745713_554_811 | 72 |
| 356 | 3300041451 | Ga0451791_0264923 | Ga0451791_0264923_196_435 | 72 |
| 357 | 3300046477 | Ga0495664_0273983 | Ga0495664_0273983_742_984 | 72 |
| 358 | 3300046535 | Ga0495586_0161339 | Ga0495586_0161339_660_902 | 72 |
| 359 | 3300046536 | Ga0495587_0588499 | Ga0495587_0588499_77_319 | 72 |
| 360 | 3300046543 | Ga0495645_0397380 | Ga0495645_0397380_559_801 | 72 |
| 361 | 3300046559 | Ga0495667_0179555 | Ga0495667_0179555_1101_1343 | 72 |
| 362 | 3300047320 | Ga0495672_0091393 | Ga0495672_0091393_1373_1612 | 72 |
| 363 | 3300047444 | Ga0495675_0704836 | Ga0495675_0704836_261_503 | 72 |
| 364 | 3300048088 | Ga0495602_0961494 | Ga0495602_0961494_298_540 | 72 |
| 365 | 3300048911 | Ga0496108_1679143 | Ga0496108_1679143_181_420 | 72 |
| 366 | 3300048912 | Ga0496109_2053333 | Ga0496109_2053333_217_456 | 72 |
| 367 | 3300048924 | Ga0496121_0104182 | Ga0496121_0104182_734_973 | 72 |
| 368 | 3300048928 | Ga0496125_0448328 | Ga0496125_0448328_478_717 | 72 |
| 369 | 3300048929 | Ga0496126_0176002 | Ga0496126_0176002_565_804 | 72 |
| 370 | 3300049571 | Ga0501034_0476746 | Ga0501034_0476746_681_920 | 72 |
| 371 | 3300049572 | Ga0501036_1353824 | Ga0501036_1353824_328_567 | 72 |
| 372 | 3300049573 | Ga0501037_0132069 | Ga0501037_0132069_456_764 | 72 |
| 373 | 3300049583 | Ga0501067_0860177 | Ga0501067_0860177_131_439 | 72 |
| 374 | 3300049586 | Ga0501070_0330232 | Ga0501070_0330232_577_885 | 72 |
| 375 | 3300049586 | Ga0501070_1150848 | Ga0501070_1150848_67_306 | 72 |
| 376 | 3300049589 | Ga0501073_0003816 | Ga0501073_0003816_4139_4447 | 72 |
| 377 | 3300049589 | Ga0501073_0190384 | Ga0501073_0190384_697_936 | 72 |
| 378 | 3300049742 | Ga0501080_0082919 | Ga0501080_0082919_1132_1440 | 72 |
| 379 | 3300049744 | Ga0501083_0009245 | Ga0501083_0009245_2309_2617 | 72 |
| 380 | 3300049823 | Ga0501044_0129026 | Ga0501044_0129026_1114_1353 | 72 |
| 381 | 3300049823 | Ga0501044_0212080 | Ga0501044_0212080_638_946 | 72 |
| 382 | 3300049823 | Ga0501044_0993776 | Ga0501044_0993776_447_686 | 72 |
| 383 | 3300050489 | nmdc:mga03683_71553_c1 | nmdc:mga03683_71553_c1_1081_1320 | 72 |
| 384 | 3300050493 | nmdc:mga0k408_109616_c1 | nmdc:mga0k408_109616_c1_530_769 | 72 |
| 385 | 3300050516 | nmdc:mga0sz30_31346_c1 | nmdc:mga0sz30_31346_c1_903_1142 | 72 |
| 386 | 3300053085 | Ga0495619_0680762 | Ga0495619_0680762_198_440 | 72 |
| 387 | 3300053117 | Ga0500593_002181 | Ga0500593_002181_4597_4845 | 72 |
| 388 | 3300053136 | Ga0500559_0125598 | Ga0500559_0125598_624_863 | 72 |
| 389 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_327450_327698 | 72 |
| 390 | 3300054114 | Ga0501084_0672841 | Ga0501084_0672841_99_407 | 72 |
| 391 | 3300059491 | Ga0587070_234709 | Ga0587070_234709_141_380 | 72 |
| 392 | 3300060353 | Ga0501082_0349394 | Ga0501082_0349394_659_967 | 72 |
| 393 | iso_pu_bacteria | 2545555834 | 2545676864 | 72 |
| 394 | iso_pu_bacteria | 2595698237 | 2596377010 | 72 |
| 395 | iso_pu_bacteria | 2828305725 | 2828307052 | 72 |
| 396 | iso_pu_bacteria | 2902330777 | 2902334713 | 72 |
| 397 | iso_pu_bacteria | 2902405164 | 2902405766 | 72 |
| 398 | iso_pu_bacteria | 2928125067 | 2928125114 | 72 |
| 399 | iso_pu_bacteria | 3003665799 | 3003666502 | 72 |
| 400 | iso_pu_bacteria | 641522639 | 641642805 | 72 |
| 401 | 3300006038 | Ga0075365_11124164 | Ga0075365_111241641 | 73 |
| 402 | 3300006048 | Ga0075363_100699468 | Ga0075363_1006994681 | 73 |
| 403 | 3300006051 | Ga0075364_10177534 | Ga0075364_101775343 | 73 |
| 404 | 3300006051 | Ga0075364_10632579 | Ga0075364_106325791 | 73 |
| 405 | 3300024225 | Ga0224572_1042937 | Ga0224572_10429372 | 73 |
| 406 | 3300024227 | Ga0228598_1019470 | Ga0228598_10194702 | 73 |
| 407 | 3300031456 | Ga0307513_10110991 | Ga0307513_101109913 | 73 |
| 408 | 3300031456 | Ga0307513_10714863 | Ga0307513_107148632 | 73 |
| 409 | 3300031456 | Ga0307513_10755150 | Ga0307513_107551502 | 73 |
| 410 | 3300031616 | Ga0307508_10103405 | Ga0307508_101034052 | 73 |
| 411 | 3300031665 | Ga0316575_10327061 | Ga0316575_103270612 | 73 |
| 412 | 3300031691 | Ga0316579_10173901 | Ga0316579_101739011 | 73 |
| 413 | 3300035089 | Ga0373944_0180040 | Ga0373944_0180040_343_600 | 73 |
| 414 | 3300035111 | Ga0373923_0144284 | Ga0373923_0144284_75_320 | 73 |
| 415 | 3300035111 | Ga0373923_0337349 | Ga0373923_0337349_170_427 | 73 |
| 416 | 3300035117 | Ga0373953_0154987 | Ga0373953_0154987_188_445 | 73 |
| 417 | 3300035118 | Ga0373954_0262302 | Ga0373954_0262302_136_393 | 73 |
| 418 | 3300035119 | Ga0373956_0303823 | Ga0373956_0303823_161_418 | 73 |
| 419 | 3300035120 | Ga0373957_0413401 | Ga0373957_0413401_206_463 | 73 |
| 420 | 3300035170 | Ga0373943_0318303 | Ga0373943_0318303_468_725 | 73 |
| 421 | 3300035172 | Ga0373955_0011197 | Ga0373955_0011197_3850_4107 | 73 |
| 422 | 3300035695 | Ga0373927_0619470 | Ga0373927_0619470_221_478 | 73 |
| 423 | 3300035724 | Ga0373933_0074919 | Ga0373933_0074919_170_427 | 73 |
| 424 | 3300036401 | Ga0373937_0406654 | Ga0373937_0406654_821_1078 | 73 |
| 425 | 3300037068 | Ga0373925_1254948 | Ga0373925_1254948_289_546 | 73 |
| 426 | 3300039450 | Ga0436363_1503216 | Ga0436363_1503216_412_654 | 73 |
| 427 | 3300041512 | Ga0451853_1943139 | Ga0451853_1943139_168_461 | 73 |
| 428 | 3300046455 | Ga0495603_0140479 | Ga0495603_0140479_821_1078 | 73 |
| 429 | 3300046460 | Ga0495638_0084207 | Ga0495638_0084207_1318_1611 | 73 |
| 430 | 3300046462 | Ga0495651_0026822 | Ga0495651_0026822_792_1049 | 73 |
| 431 | 3300046463 | Ga0495653_0202284 | Ga0495653_0202284_825_1082 | 73 |
| 432 | 3300046473 | Ga0495582_0063452 | Ga0495582_0063452_1063_1320 | 73 |
| 433 | 3300046475 | Ga0495639_0352827 | Ga0495639_0352827_415_672 | 73 |
| 434 | 3300046476 | Ga0495662_0104651 | Ga0495662_0104651_619_876 | 73 |
| 435 | 3300046499 | Ga0495594_0198724 | Ga0495594_0198724_306_563 | 73 |
| 436 | 3300046511 | Ga0495608_0073902 | Ga0495608_0073902_991_1248 | 73 |
| 437 | 3300046526 | Ga0495666_0242241 | Ga0495666_0242241_276_533 | 73 |
| 438 | 3300046529 | Ga0495652_0381482 | Ga0495652_0381482_665_922 | 73 |
| 439 | 3300046531 | Ga0495665_0454023 | Ga0495665_0454023_120_377 | 73 |
| 440 | 3300046533 | Ga0495640_0071068 | Ga0495640_0071068_234_491 | 73 |
| 441 | 3300046543 | Ga0495645_0352701 | Ga0495645_0352701_57_314 | 73 |
| 442 | 3300046559 | Ga0495667_0135831 | Ga0495667_0135831_795_1052 | 73 |
| 443 | 3300046616 | Ga0495668_0696668 | Ga0495668_0696668_129_422 | 73 |
| 444 | 3300046642 | Ga0495634_0060140 | Ga0495634_0060140_35_292 | 73 |
| 445 | 3300046660 | Ga0495625_0231376 | Ga0495625_0231376_784_1077 | 73 |
| 446 | 3300046663 | Ga0495635_0094634 | Ga0495635_0094634_1229_1486 | 73 |
| 447 | 3300046675 | Ga0495657_0099712 | Ga0495657_0099712_1431_1688 | 73 |
| 448 | 3300046678 | Ga0495599_0017765 | Ga0495599_0017765_169_426 | 73 |
| 449 | 3300046679 | Ga0495623_0035561 | Ga0495623_0035561_1317_1574 | 73 |
| 450 | 3300046680 | Ga0495646_0038219 | Ga0495646_0038219_1970_2227 | 73 |
| 451 | 3300046681 | Ga0495647_0291830 | Ga0495647_0291830_361_618 | 73 |
| 452 | 3300046683 | Ga0495658_0147781 | Ga0495658_0147781_814_1071 | 73 |
| 453 | 3300046689 | Ga0495613_0177775 | Ga0495613_0177775_494_751 | 73 |
| 454 | 3300046690 | Ga0495624_0258395 | Ga0495624_0258395_724_981 | 73 |
| 455 | 3300046794 | Ga0495589_0589180 | Ga0495589_0589180_144_437 | 73 |
| 456 | 3300046809 | Ga0495600_0064718 | Ga0495600_0064718_1674_1931 | 73 |
| 457 | 3300047315 | Ga0495581_0186111 | Ga0495581_0186111_754_1011 | 73 |
| 458 | 3300047317 | Ga0495604_0156077 | Ga0495604_0156077_529_786 | 73 |
| 459 | 3300047319 | Ga0495674_0108833 | Ga0495674_0108833_860_1117 | 73 |
| 460 | 3300047320 | Ga0495672_0403897 | Ga0495672_0403897_357_602 | 73 |
| 461 | 3300047321 | Ga0495676_0243682 | Ga0495676_0243682_477_734 | 73 |
| 462 | 3300047322 | Ga0495680_0117368 | Ga0495680_0117368_1339_1596 | 73 |
| 463 | 3300047444 | Ga0495675_0243778 | Ga0495675_0243778_683_940 | 73 |
| 464 | 3300047471 | Ga0495684_0252871 | Ga0495684_0252871_613_870 | 73 |
| 465 | 3300047472 | Ga0495686_0142332 | Ga0495686_0142332_294_605 | 73 |
| 466 | 3300048088 | Ga0495602_0042806 | Ga0495602_0042806_3531_3788 | 73 |
| 467 | 3300049460 | Ga0495682_0104651 | Ga0495682_0104651_196_489 | 73 |
| 468 | 3300049570 | Ga0501033_0911454 | Ga0501033_0911454_225_545 | 73 |
| 469 | 3300049586 | Ga0501070_0457682 | Ga0501070_0457682_678_998 | 73 |
| 470 | 3300049822 | Ga0501035_0152607 | Ga0501035_0152607_573_893 | 73 |
| 471 | 3300049823 | Ga0501044_0142961 | Ga0501044_0142961_110_430 | 73 |
| 472 | 3300050491 | nmdc:mga00v17_13050_c2 | nmdc:mga00v17_13050_c2_145_393 | 73 |
| 473 | 3300053077 | Ga0495601_0070742 | Ga0495601_0070742_112_369 | 73 |
| 474 | 3300053085 | Ga0495619_0374838 | Ga0495619_0374838_258_515 | 73 |
| 475 | 3300053090 | Ga0500646_0090176 | Ga0500646_0090176_134_427 | 73 |
| 476 | 3300053093 | Ga0500651_0051744 | Ga0500651_0051744_526_819 | 73 |
| 477 | 3300053093 | Ga0500651_0408585 | Ga0500651_0408585_361_669 | 73 |
| 478 | 3300053094 | Ga0500566_0008660 | Ga0500566_0008660_2265_2561 | 73 |
| 479 | 3300053094 | Ga0500566_0285636 | Ga0500566_0285636_238_495 | 73 |
| 480 | 3300053096 | Ga0500641_0096596 | Ga0500641_0096596_677_988 | 73 |
| 481 | 3300053119 | Ga0500595_002391 | Ga0500595_002391_2091_2384 | 73 |
| 482 | 3300053123 | Ga0500614_082332 | Ga0500614_082332_535_828 | 73 |
| 483 | 3300053131 | Ga0500652_167741 | Ga0500652_167741_54_347 | 73 |
| 484 | 3300053134 | Ga0500658_0057978 | Ga0500658_0057978_33_326 | 73 |
| 485 | 3300053142 | Ga0500577_0390602 | Ga0500577_0390602_225_518 | 73 |
| 486 | 3300053146 | Ga0500588_0257162 | Ga0500588_0257162_146_442 | 73 |
| 487 | 3300053158 | Ga0500627_0213537 | Ga0500627_0213537_527_832 | 73 |
| 488 | 3300005338 | Ga0068868_100604584 | Ga0068868_1006045842 | 74 |
| 489 | 3300005347 | Ga0070668_100140175 | Ga0070668_1001401751 | 74 |
| 490 | 3300005356 | Ga0070674_100610462 | Ga0070674_1006104622 | 74 |
| 491 | 3300005365 | Ga0070688_100280502 | Ga0070688_1002805021 | 74 |
| 492 | 3300005367 | Ga0070667_101688612 | Ga0070667_1016886122 | 74 |
| 493 | 3300005456 | Ga0070678_100712532 | Ga0070678_1007125322 | 74 |
| 494 | 3300005471 | Ga0070698_100064203 | Ga0070698_1000642033 | 74 |
| 495 | 3300005518 | Ga0070699_100078367 | Ga0070699_1000783673 | 74 |
| 496 | 3300005614 | Ga0068856_100419637 | Ga0068856_1004196372 | 74 |
| 497 | 3300005843 | Ga0068860_100392912 | Ga0068860_1003929122 | 74 |
| 498 | 3300005844 | Ga0068862_102298708 | Ga0068862_1022987082 | 74 |
| 499 | 3300006880 | Ga0075429_101587079 | Ga0075429_1015870792 | 74 |
| 500 | 3300009093 | Ga0105240_10227124 | Ga0105240_102271243 | 74 |
| 501 | 3300009093 | Ga0105240_10233950 | Ga0105240_102339502 | 74 |
| 502 | 3300009093 | Ga0105240_10287039 | Ga0105240_102870393 | 74 |
| 503 | 3300009098 | Ga0105245_10185614 | Ga0105245_101856142 | 74 |
| 504 | 3300009098 | Ga0105245_10675613 | Ga0105245_106756132 | 74 |
| 505 | 3300009148 | Ga0105243_10438915 | Ga0105243_104389152 | 74 |
| 506 | 3300009174 | Ga0105241_11009513 | Ga0105241_110095132 | 74 |
| 507 | 3300009176 | Ga0105242_11239001 | Ga0105242_112390011 | 74 |
| 508 | 3300009545 | Ga0105237_10078456 | Ga0105237_100784564 | 74 |
| 509 | 3300009545 | Ga0105237_10640511 | Ga0105237_106405112 | 74 |
| 510 | 3300009551 | Ga0105238_10018574 | Ga0105238_100185748 | 74 |
| 511 | 3300009551 | Ga0105238_10090935 | Ga0105238_100909354 | 74 |
| 512 | 3300009551 | Ga0105238_10213092 | Ga0105238_102130922 | 74 |
| 513 | 3300010375 | Ga0105239_10202620 | Ga0105239_102026204 | 74 |
| 514 | 3300011119 | Ga0105246_12066594 | Ga0105246_120665942 | 74 |
| 515 | 3300013308 | Ga0157375_12694659 | Ga0157375_126946592 | 74 |
| 516 | 3300014325 | Ga0163163_10715641 | Ga0163163_107156412 | 74 |
| 517 | 3300014497 | Ga0182008_10551918 | Ga0182008_105519182 | 74 |
| 518 | 3300020077 | Ga0206351_10059359 | Ga0206351_100593592 | 74 |
| 519 | 3300025913 | Ga0207695_10160356 | Ga0207695_101603563 | 74 |
| 520 | 3300025913 | Ga0207695_10161430 | Ga0207695_101614303 | 74 |
| 521 | 3300025914 | Ga0207671_10138862 | Ga0207671_101388622 | 74 |
| 522 | 3300025924 | Ga0207694_10024964 | Ga0207694_100249644 | 74 |
| 523 | 3300025927 | Ga0207687_10100660 | Ga0207687_101006602 | 74 |
| 524 | 3300025937 | Ga0207669_10754446 | Ga0207669_107544461 | 74 |
| 525 | 3300025949 | Ga0207667_10576047 | Ga0207667_105760472 | 74 |
| 526 | 3300025972 | Ga0207668_10171762 | Ga0207668_101717624 | 74 |
| 527 | 3300026078 | Ga0207702_11270860 | Ga0207702_112708602 | 74 |
| 528 | 3300026118 | Ga0207675_101553532 | Ga0207675_1015535322 | 74 |
| 529 | 3300028379 | Ga0268266_10024595 | Ga0268266_100245953 | 74 |
| 530 | 3300028381 | Ga0268264_11015581 | Ga0268264_110155812 | 74 |
| 531 | 3300028800 | Ga0265338_10210675 | Ga0265338_102106752 | 74 |
| 532 | 3300031250 | Ga0265331_10564416 | Ga0265331_105644162 | 74 |
| 533 | 3300037312 | Ga0395899_0071704 | Ga0395899_0071704_2247_2510 | 74 |
| 534 | 3300037418 | Ga0395900_0583021 | Ga0395900_0583021_206_469 | 74 |
| 535 | 3300038443 | Ga0395901_0385460 | Ga0395901_0385460_458_721 | 74 |
| 536 | 3300039453 | Ga0436362_0481984 | Ga0436362_0481984_489_743 | 74 |
| 537 | 3300039453 | Ga0436362_1027979 | Ga0436362_1027979_131_394 | 74 |
| 538 | 3300041496 | Ga0451839_1022280 | Ga0451839_1022280_142_387 | 74 |
| 539 | 3300045051 | Ga0451576_0961771 | Ga0451576_0961771_118_420 | 74 |
| 540 | 3300045976 | Ga0466967_1692082 | Ga0466967_1692082_336_608 | 74 |
| 541 | 3300048910 | Ga0496107_0906420 | Ga0496107_0906420_93_398 | 74 |
| 542 | 3300048915 | Ga0496112_1424084 | Ga0496112_1424084_218_523 | 74 |
| 543 | 3300048927 | Ga0496124_0238267 | Ga0496124_0238267_587_832 | 74 |
| 544 | 3300048929 | Ga0496126_0362302 | Ga0496126_0362302_357_617 | 74 |
| 545 | 3300049586 | Ga0501070_1187690 | Ga0501070_1187690_86_331 | 74 |
| 546 | 3300049587 | Ga0501071_0221161 | Ga0501071_0221161_1038_1352 | 74 |
| 547 | 3300049591 | Ga0501075_1156816 | Ga0501075_1156816_130_444 | 74 |
| 548 | 3300049593 | Ga0501077_0646780 | Ga0501077_0646780_200_514 | 74 |
| 549 | 3300049742 | Ga0501080_0483272 | Ga0501080_0483272_199_462 | 74 |
| 550 | 3300050508 | nmdc:mga09592_1537256_c1 | nmdc:mga09592_1537256_c1_27_332 | 74 |
| 551 | 3300050514 | nmdc:mga08x19_771932_c1 | nmdc:mga08x19_771932_c1_190_510 | 74 |
| 552 | 3300053085 | Ga0495619_0139198 | Ga0495619_0139198_1109_1366 | 74 |
| 553 | 3300053091 | Ga0500647_0037188 | Ga0500647_0037188_1744_2004 | 74 |
| 554 | 3300053119 | Ga0500595_080042 | Ga0500595_080042_465_728 | 74 |
| 555 | 3300059506 | Ga0587085_184392 | Ga0587085_184392_106_369 | 74 |
| 556 | 3300001979 | JGI24740J21852_10043409 | JGI24740J21852_100434092 | 75 |
| 557 | 3300003781 | Ga0055536_1002526 | Ga0055536_10025269 | 75 |
| 558 | 3300005336 | Ga0070680_100004947 | Ga0070680_10000494710 | 75 |
| 559 | 3300005339 | Ga0070660_101177696 | Ga0070660_1011776962 | 75 |
| 560 | 3300005458 | Ga0070681_10000725 | Ga0070681_1000072524 | 75 |
| 561 | 3300005530 | Ga0070679_100002589 | Ga0070679_10000258914 | 75 |
| 562 | 3300005530 | Ga0070679_100368905 | Ga0070679_1003689054 | 75 |
| 563 | 3300005535 | Ga0070684_102305693 | Ga0070684_1023056932 | 75 |
| 564 | 3300005563 | Ga0068855_100485229 | Ga0068855_1004852293 | 75 |
| 565 | 3300005578 | Ga0068854_100124680 | Ga0068854_1001246803 | 75 |
| 566 | 3300005614 | Ga0068856_100794907 | Ga0068856_1007949073 | 75 |
| 567 | 3300005937 | Ga0081455_10095808 | Ga0081455_100958082 | 75 |
| 568 | 3300009093 | Ga0105240_10018436 | Ga0105240_100184366 | 75 |
| 569 | 3300009093 | Ga0105240_10670775 | Ga0105240_106707752 | 75 |
| 570 | 3300009551 | Ga0105238_10692443 | Ga0105238_106924431 | 75 |
| 571 | 3300013104 | Ga0157370_10473827 | Ga0157370_104738272 | 75 |
| 572 | 3300013296 | Ga0157374_10191203 | Ga0157374_101912032 | 75 |
| 573 | 3300013307 | Ga0157372_10149792 | Ga0157372_101497922 | 75 |
| 574 | 3300014325 | Ga0163163_10975329 | Ga0163163_109753291 | 75 |
| 575 | 3300014968 | Ga0157379_11148915 | Ga0157379_111489152 | 75 |
| 576 | 3300021361 | Ga0213872_10281247 | Ga0213872_102812472 | 75 |
| 577 | 3300021388 | Ga0213875_10000936 | Ga0213875_100009366 | 75 |
| 578 | 3300021441 | Ga0213871_10235667 | Ga0213871_102356672 | 75 |
| 579 | 3300025912 | Ga0207707_10010185 | Ga0207707_100101854 | 75 |
| 580 | 3300025913 | Ga0207695_10436046 | Ga0207695_104360462 | 75 |
| 581 | 3300025917 | Ga0207660_10070844 | Ga0207660_100708442 | 75 |
| 582 | 3300025921 | Ga0207652_10012935 | Ga0207652_100129355 | 75 |
| 583 | 3300025921 | Ga0207652_10079927 | Ga0207652_100799271 | 75 |
| 584 | 3300025949 | Ga0207667_10669004 | Ga0207667_106690042 | 75 |
| 585 | 3300025981 | Ga0207640_10069956 | Ga0207640_100699563 | 75 |
| 586 | 3300026078 | Ga0207702_10358055 | Ga0207702_103580553 | 75 |
| 587 | 3300028794 | Ga0307515_10003572 | Ga0307515_100035729 | 75 |
| 588 | 3300031456 | Ga0307513_10842650 | Ga0307513_108426501 | 75 |
| 589 | 3300031456 | Ga0307513_11102586 | Ga0307513_111025861 | 75 |
| 590 | 3300031649 | Ga0307514_10069184 | Ga0307514_100691842 | 75 |
| 591 | 3300031730 | Ga0307516_10063711 | Ga0307516_100637112 | 75 |
| 592 | 3300035172 | Ga0373955_0432099 | Ga0373955_0432099_158_433 | 75 |
| 593 | 3300037853 | Ga0436364_0992577 | Ga0436364_0992577_15582_15848 | 75 |
| 594 | 3300039437 | Ga0436365_0910090 | Ga0436365_0910090_66_332 | 75 |
| 595 | 3300039438 | Ga0436360_0747340 | Ga0436360_0747340_382_645 | 75 |
| 596 | 3300039438 | Ga0436360_1058378 | Ga0436360_1058378_1258_1521 | 75 |
| 597 | 3300039447 | Ga0436361_0211622 | Ga0436361_0211622_2341_2628 | 75 |
| 598 | 3300039447 | Ga0436361_0337411 | Ga0436361_0337411_68_331 | 75 |
| 599 | 3300039450 | Ga0436363_0589105 | Ga0436363_0589105_20_286 | 75 |
| 600 | 3300039453 | Ga0436362_0538378 | Ga0436362_0538378_51_317 | 75 |
| 601 | 3300039453 | Ga0436362_0619277 | Ga0436362_0619277_260_526 | 75 |
| 602 | 3300044693 | Ga0466961_0778124 | Ga0466961_0778124_237_509 | 75 |
| 603 | 3300044842 | Ga0466957_0722891 | Ga0466957_0722891_196_468 | 75 |
| 604 | 3300045836 | Ga0466958_0455317 | Ga0466958_0455317_447_719 | 75 |
| 605 | 3300045836 | Ga0466958_0655044 | Ga0466958_0655044_60_335 | 75 |
| 606 | 3300045976 | Ga0466967_1226913 | Ga0466967_1226913_172_453 | 75 |
| 607 | 3300045976 | Ga0466967_1903338 | Ga0466967_1903338_19_291 | 75 |
| 608 | 3300046460 | Ga0495638_0012483 | Ga0495638_0012483_2028_2279 | 75 |
| 609 | 3300048907 | Ga0496104_1653446 | Ga0496104_1653446_247_513 | 75 |
| 610 | 3300048909 | Ga0496106_0844831 | Ga0496106_0844831_177_428 | 75 |
| 611 | 3300048924 | Ga0496121_0366326 | Ga0496121_0366326_357_605 | 75 |
| 612 | 3300049128 | Ga0501308_007539 | Ga0501308_007539_240_491 | 75 |
| 613 | 3300049130 | Ga0501310_072748 | Ga0501310_072748_206_457 | 75 |
| 614 | 3300049162 | Ga0501307_009009 | Ga0501307_009009_231_482 | 75 |
| 615 | 3300049529 | Ga0501313_010428 | Ga0501313_010428_151_402 | 75 |
| 616 | 3300049533 | Ga0501317_080817 | Ga0501317_080817_48_299 | 75 |
| 617 | 3300049534 | Ga0501318_071047 | Ga0501318_071047_144_398 | 75 |
| 618 | 3300049585 | Ga0501069_0176633 | Ga0501069_0176633_286_555 | 75 |
| 619 | 3300049586 | Ga0501070_0298577 | Ga0501070_0298577_697_966 | 75 |
| 620 | 3300049742 | Ga0501080_0114718 | Ga0501080_0114718_638_907 | 75 |
| 621 | 3300053088 | Ga0500644_0008950 | Ga0500644_0008950_274_525 | 75 |
| 622 | 3300053093 | Ga0500651_0762378 | Ga0500651_0762378_41_292 | 75 |
| 623 | 3300053122 | Ga0500608_023066 | Ga0500608_023066_1941_2192 | 75 |
| 624 | 3300053130 | Ga0500642_0236937 | Ga0500642_0236937_14_265 | 75 |
| 625 | 3300053131 | Ga0500652_405374 | Ga0500652_405374_113_364 | 75 |
| 626 | 3300053142 | Ga0500577_0124830 | Ga0500577_0124830_462_713 | 75 |
| 627 | 3300053153 | Ga0500616_0358423 | Ga0500616_0358423_201_452 | 75 |
| 628 | 3300053156 | Ga0500622_0000695 | Ga0500622_0000695_25130_25381 | 75 |
| 629 | 3300059504 | Ga0587082_085620 | Ga0587082_085620_382_630 | 75 |
| 630 | 3300059605 | Ga0587106_035783 | Ga0587106_035783_452_703 | 75 |
| 631 | 3300059624 | Ga0587109_137226 | Ga0587109_137226_120_371 | 75 |
| 632 | 3300059641 | Ga0587068_123033 | Ga0587068_123033_172_423 | 75 |
| 633 | 3300060346 | Ga0587111_0211827 | Ga0587111_0211827_158_409 | 75 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x8r-assembly1.cif.gz_o | structure of the 30s small subunit of chloroplast ribosome from spinach | 0.4998 | 33 | 73 |
| 5x8r-assembly1.cif.gz_o | structure of the 30s small subunit of chloroplast ribosome from spinach | 0.3668 | 33 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8QFH5_209_309_3.30.710.10 | Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A | 0.6054 | 29 | 62 | 3.30.710.10 |
| 4ohfD03 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.5649 | 33 | 74 | 1.20.58.1160 |
| af_Q5AHB8_2_109_1.10.287.1490 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4502 | 33 | 74 | 1.10.287.1490 |
| 2ylaC02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;AF1782-like | 0.4264 | 29 | 63 | 1.20.1270.90 |
| 4azhB02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;AF1782-like | 0.4033 | 24 | 63 | 1.20.1270.90 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar