F471091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 309 | 634 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_10465018|Ga0268266_104650182 |
| Length | 189 |
| Sequence | MINRIKRHRSRQKGGAEAGGHMTLVPFIDMLMILTVFLLVHNSDTDILPNTKAISIPASLSDKKPRPSVVVMITKEDLLVDGKAIAKVADVISSQESVIQPLKVALQGQADIVLADAAKQEIKDREVTIMGDKNTPYSVLRKIMATCTDADYGKVSLAVVEREGANKVPPSASGRTAAFNASPSNAVGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 112 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 233 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 290 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 291 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 292 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 294 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 295 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 296 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 297 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 299 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 300 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 302 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 303 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 305 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 306 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 307 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.32 |
| Nodule | 0.16 |
| Rhizoplane | 5.21 |
| Rhizosphere | 83.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_177223 | 2162886006 | Unclassified | 948 |
| 2 | SwRhRL2b_contig_2453594 | 2162886007 | Unclassified | 1049 |
| 3 | JGI24737J22298_10202343 | 3300001990 | Unclassified | 586 |
| 4 | JGI24750J21931_1017657 | 3300002070 | Bacteria | 977 |
| 5 | JGI25406J46586_10008835 | 3300003203 | Bacteria | 4537 |
| 6 | rootH1_10011139 | 3300003316 | Unclassified | 1531 |
| 7 | rootH1_10044715 | 3300003316 | Bacteria | 6276 |
| 8 | rootH1_10044715 | 3300003323 | Bacteria | 1594 |
| 9 | rootH2_10170203 | 3300003320 | Unclassified | 4199 |
| 10 | rootL2_10147116 | 3300003322 | Bacteria | 5980 |
| 11 | rootH1_10044975 | 3300003323 | Bacteria | 5612 |
| 12 | JGI25405J52794_10038036 | 3300003911 | Bacteria | 1012 |
| 13 | Ga0065704_10183317 | 3300005289 | Unclassified | 1226 |
| 14 | Ga0065704_10412331 | 3300005289 | Unclassified | 740 |
| 15 | Ga0065707_10084023 | 3300005295 | Bacteria | 7813 |
| 16 | Ga0065707_10085501 | 3300005295 | Bacteria | 6105 |
| 17 | Ga0070658_10502858 | 3300005327 | Bacteria | 1047 |
| 18 | Ga0070683_100748313 | 3300005329 | Unclassified | 936 |
| 19 | Ga0070690_100016306 | 3300005330 | Bacteria | 4447 |
| 20 | Ga0070690_100406723 | 3300005330 | Bacteria | 1001 |
| 21 | Ga0070670_100014751 | 3300005331 | Bacteria | 6709 |
| 22 | Ga0070670_100130094 | 3300005331 | Unclassified | 2173 |
| 23 | Ga0068869_100219047 | 3300005334 | Unclassified | 1508 |
| 24 | Ga0070666_10000825 | 3300005335 | Bacteria | 18805 |
| 25 | Ga0070666_10001705 | 3300005335 | Bacteria | 13402 |
| 26 | Ga0070666_10018124 | 3300005335 | Bacteria | 4522 |
| 27 | Ga0070666_10037127 | 3300005335 | Unclassified | 3238 |
| 28 | Ga0070666_10128110 | 3300005335 | Unclassified | 1762 |
| 29 | Ga0070680_100042749 | 3300005336 | Unclassified | 3678 |
| 30 | Ga0070680_100592338 | 3300005336 | Bacteria | 951 |
| 31 | Ga0070682_100101279 | 3300005337 | Unclassified | 1902 |
| 32 | Ga0070682_100255558 | 3300005337 | Bacteria | 1265 |
| 33 | Ga0070682_100423119 | 3300005337 | Unclassified | 1013 |
| 34 | Ga0068868_100001561 | 3300005338 | Bacteria | 15635 |
| 35 | Ga0068868_100076840 | 3300005338 | Bacteria | 2670 |
| 36 | Ga0068868_100448289 | 3300005338 | Bacteria | 1122 |
| 37 | Ga0070691_10054009 | 3300005341 | Bacteria | 1923 |
| 38 | Ga0070669_101244314 | 3300005353 | Bacteria | 644 |
| 39 | Ga0070675_100902814 | 3300005354 | Unclassified | 810 |
| 40 | Ga0070671_100010657 | 3300005355 | Bacteria | 7378 |
| 41 | Ga0070671_100048018 | 3300005355 | Bacteria | 3549 |
| 42 | Ga0070671_100048894 | 3300005355 | Bacteria | 3518 |
| 43 | Ga0070671_100470997 | 3300005355 | Unclassified | 1079 |
| 44 | Ga0070673_100013882 | 3300005364 | Bacteria | 5591 |
| 45 | Ga0070673_100116901 | 3300005364 | Unclassified | 2219 |
| 46 | Ga0070667_100000116 | 3300005367 | Bacteria | 102137 |
| 47 | Ga0070667_100000809 | 3300005367 | Bacteria | 29230 |
| 48 | Ga0070667_100009226 | 3300005367 | Bacteria | 8170 |
| 49 | Ga0070667_100018866 | 3300005367 | Bacteria | 5719 |
| 50 | Ga0070667_100153774 | 3300005367 | Unclassified | 2022 |
| 51 | Ga0070709_10035320 | 3300005434 | Bacteria | 3037 |
| 52 | Ga0070709_10310753 | 3300005434 | Unclassified | 1154 |
| 53 | Ga0070709_10459081 | 3300005434 | Bacteria | 961 |
| 54 | Ga0070714_100018526 | 3300005435 | Bacteria | 5658 |
| 55 | Ga0070714_100030181 | 3300005435 | Bacteria | 4511 |
| 56 | Ga0070714_100340839 | 3300005435 | Bacteria | 1406 |
| 57 | Ga0070713_100003775 | 3300005436 | Bacteria | 10029 |
| 58 | Ga0070713_100032889 | 3300005436 | Bacteria | 4148 |
| 59 | Ga0070713_100589677 | 3300005436 | Bacteria | 1055 |
| 60 | Ga0070711_100000263 | 3300005439 | Bacteria | 26963 |
| 61 | Ga0070711_101080016 | 3300005439 | Bacteria | 691 |
| 62 | Ga0070700_100254961 | 3300005441 | Unclassified | 1260 |
| 63 | Ga0070694_100235170 | 3300005444 | Unclassified | 1380 |
| 64 | Ga0070663_100100043 | 3300005455 | Unclassified | 2162 |
| 65 | Ga0070678_100000129 | 3300005456 | Bacteria | 30238 |
| 66 | Ga0070678_101567056 | 3300005456 | Bacteria | 618 |
| 67 | Ga0070681_10005968 | 3300005458 | Bacteria | 11796 |
| 68 | Ga0070681_10014820 | 3300005458 | Bacteria | 7752 |
| 69 | Ga0070681_10020355 | 3300005458 | Bacteria | 6650 |
| 70 | Ga0070681_10026771 | 3300005458 | Bacteria | 5798 |
| 71 | Ga0070681_10173564 | 3300005458 | Bacteria | 2077 |
| 72 | Ga0068867_100502754 | 3300005459 | Bacteria | 1042 |
| 73 | Ga0070685_10465259 | 3300005466 | Unclassified | 888 |
| 74 | Ga0070685_10688872 | 3300005466 | Unclassified | 744 |
| 75 | Ga0070685_10898285 | 3300005466 | Bacteria | 659 |
| 76 | Ga0070706_100186170 | 3300005467 | Bacteria | 1940 |
| 77 | Ga0070699_100229044 | 3300005518 | Bacteria | 1657 |
| 78 | Ga0070679_100061132 | 3300005530 | Bacteria | 3755 |
| 79 | Ga0070679_100061488 | 3300005530 | Unclassified | 3743 |
| 80 | Ga0070684_100025558 | 3300005535 | Unclassified | 4966 |
| 81 | Ga0070684_100217258 | 3300005535 | Unclassified | 1744 |
| 82 | Ga0068853_100427694 | 3300005539 | Unclassified | 1243 |
| 83 | Ga0068853_100877703 | 3300005539 | Bacteria | 861 |
| 84 | Ga0068853_101302920 | 3300005539 | Bacteria | 702 |
| 85 | Ga0070672_100477862 | 3300005543 | Bacteria | 1076 |
| 86 | Ga0070686_100105361 | 3300005544 | Bacteria | 1912 |
| 87 | Ga0070686_100292858 | 3300005544 | Bacteria | 1205 |
| 88 | Ga0070695_100021238 | 3300005545 | Bacteria | 3970 |
| 89 | Ga0070696_100134617 | 3300005546 | Bacteria | 1801 |
| 90 | Ga0070696_100329379 | 3300005546 | Bacteria | 1177 |
| 91 | Ga0070665_100009357 | 3300005548 | Bacteria | 9915 |
| 92 | Ga0070665_100015218 | 3300005548 | Bacteria | 7723 |
| 93 | Ga0070665_100018269 | 3300005548 | Bacteria | 7033 |
| 94 | Ga0070665_100026693 | 3300005548 | Bacteria | 5815 |
| 95 | Ga0070665_100029947 | 3300005548 | Bacteria | 5478 |
| 96 | Ga0070665_100035039 | 3300005548 | Bacteria | 5048 |
| 97 | Ga0070665_100111566 | 3300005548 | Bacteria | 2737 |
| 98 | Ga0070665_100200303 | 3300005548 | Bacteria | 1997 |
| 99 | Ga0070665_100337746 | 3300005548 | Bacteria | 1511 |
| 100 | Ga0070704_100386752 | 3300005549 | Bacteria | 1190 |
| 101 | Ga0068855_100001037 | 3300005563 | Bacteria | 34574 |
| 102 | Ga0068855_100004460 | 3300005563 | Bacteria | 17110 |
| 103 | Ga0068855_100025633 | 3300005563 | Bacteria | 7053 |
| 104 | Ga0068855_100277140 | 3300005563 | Bacteria | 1863 |
| 105 | Ga0068855_100895068 | 3300005563 | Bacteria | 938 |
| 106 | Ga0068855_100995790 | 3300005563 | Bacteria | 881 |
| 107 | Ga0070664_100015641 | 3300005564 | Bacteria | 6208 |
| 108 | Ga0068857_100097074 | 3300005577 | Unclassified | 2642 |
| 109 | Ga0068857_100600129 | 3300005577 | Bacteria | 1041 |
| 110 | Ga0068854_100713753 | 3300005578 | Unclassified | 867 |
| 111 | Ga0068856_100018387 | 3300005614 | Bacteria | 6773 |
| 112 | Ga0068856_100053312 | 3300005614 | Unclassified | 3987 |
| 113 | Ga0068852_100559421 | 3300005616 | Unclassified | 1145 |
| 114 | Ga0068859_100000196 | 3300005617 | Bacteria | 59010 |
| 115 | Ga0068859_100019340 | 3300005617 | Bacteria | 6843 |
| 116 | Ga0068859_100192899 | 3300005617 | Bacteria | 2121 |
| 117 | Ga0068859_100749193 | 3300005617 | Bacteria | 1066 |
| 118 | Ga0068859_102294138 | 3300005617 | Unclassified | 595 |
| 119 | Ga0068864_100005637 | 3300005618 | Bacteria | 10263 |
| 120 | Ga0068864_100083624 | 3300005618 | Unclassified | 2803 |
| 121 | Ga0068866_10001569 | 3300005718 | Bacteria | 9713 |
| 122 | Ga0068866_10028941 | 3300005718 | Unclassified | 2644 |
| 123 | Ga0068861_100004230 | 3300005719 | Bacteria | 9631 |
| 124 | Ga0068861_100010429 | 3300005719 | Bacteria | 6451 |
| 125 | Ga0068861_100026201 | 3300005719 | Bacteria | 4237 |
| 126 | Ga0068861_100117764 | 3300005719 | Bacteria | 2138 |
| 127 | Ga0068861_100176092 | 3300005719 | Bacteria | 1776 |
| 128 | Ga0068861_100607621 | 3300005719 | Unclassified | 1005 |
| 129 | Ga0068851_10026731 | 3300005834 | Bacteria | 2839 |
| 130 | Ga0068870_10086096 | 3300005840 | Bacteria | 1748 |
| 131 | Ga0068870_10147013 | 3300005840 | Unclassified | 1384 |
| 132 | Ga0068863_100001617 | 3300005841 | Bacteria | 22268 |
| 133 | Ga0068863_100011745 | 3300005841 | Bacteria | 8470 |
| 134 | Ga0068863_100064177 | 3300005841 | Bacteria | 3473 |
| 135 | Ga0068863_100196358 | 3300005841 | Bacteria | 1940 |
| 136 | Ga0068863_100274406 | 3300005841 | Bacteria | 1633 |
| 137 | Ga0068858_100004518 | 3300005842 | Bacteria | 13641 |
| 138 | Ga0068858_100006646 | 3300005842 | Bacteria | 11246 |
| 139 | Ga0068858_100061164 | 3300005842 | Bacteria | 3481 |
| 140 | Ga0068858_100726675 | 3300005842 | Unclassified | 967 |
| 141 | Ga0068860_100005516 | 3300005843 | Bacteria | 12806 |
| 142 | Ga0068860_100006186 | 3300005843 | Bacteria | 12043 |
| 143 | Ga0068860_100015455 | 3300005843 | Bacteria | 7453 |
| 144 | Ga0068860_100217323 | 3300005843 | Bacteria | 1855 |
| 145 | Ga0068860_100446538 | 3300005843 | Unclassified | 1285 |
| 146 | Ga0068862_100131523 | 3300005844 | Bacteria | 2214 |
| 147 | Ga0068862_100154458 | 3300005844 | Bacteria | 2045 |
| 148 | Ga0068862_100327460 | 3300005844 | Bacteria | 1416 |
| 149 | Ga0068862_100460009 | 3300005844 | Unclassified | 1201 |
| 150 | Ga0068862_101301914 | 3300005844 | Unclassified | 728 |
| 151 | Ga0081455_10000057 | 3300005937 | Bacteria | 119751 |
| 152 | Ga0081539_10000038 | 3300005985 | Bacteria | 296079 |
| 153 | Ga0070715_10006658 | 3300006163 | Bacteria | 3942 |
| 154 | Ga0070715_10164930 | 3300006163 | Bacteria | 1098 |
| 155 | Ga0070716_100027399 | 3300006173 | Bacteria | 3061 |
| 156 | Ga0070716_100133894 | 3300006173 | Bacteria | 1571 |
| 157 | Ga0070716_100595851 | 3300006173 | Bacteria | 831 |
| 158 | Ga0070712_100006678 | 3300006175 | Bacteria | 7170 |
| 159 | Ga0070712_100070870 | 3300006175 | Bacteria | 2492 |
| 160 | Ga0097621_100006379 | 3300006237 | Bacteria | 8371 |
| 161 | Ga0097621_100012611 | 3300006237 | Bacteria | 6271 |
| 162 | Ga0097621_100144460 | 3300006237 | Unclassified | 2035 |
| 163 | Ga0097621_100192057 | 3300006237 | Bacteria | 1769 |
| 164 | Ga0097621_100586124 | 3300006237 | Unclassified | 1018 |
| 165 | Ga0097621_101233752 | 3300006237 | Unclassified | 705 |
| 166 | Ga0068871_100023046 | 3300006358 | Bacteria | 4808 |
| 167 | Ga0068871_100103575 | 3300006358 | Unclassified | 2386 |
| 168 | Ga0068871_100141161 | 3300006358 | Unclassified | 2048 |
| 169 | Ga0068871_100419146 | 3300006358 | Unclassified | 1195 |
| 170 | Ga0068865_100023316 | 3300006881 | Bacteria | 4051 |
| 171 | Ga0068865_100092153 | 3300006881 | Unclassified | 2201 |
| 172 | Ga0075436_100057368 | 3300006914 | Bacteria | 2689 |
| 173 | Ga0097620_100000196 | 3300006931 | Bacteria | 59010 |
| 174 | Ga0097620_100019340 | 3300006931 | Bacteria | 6843 |
| 175 | Ga0097620_100192898 | 3300006931 | Bacteria | 2121 |
| 176 | Ga0097620_100749120 | 3300006931 | Bacteria | 1066 |
| 177 | Ga0097620_102295545 | 3300006931 | Unclassified | 595 |
| 178 | Ga0099826_10037321 | 3300006948 | Unclassified | 3425 |
| 179 | Ga0099795_10000034 | 3300007788 | Bacteria | 36525 |
| 180 | Ga0105251_10293355 | 3300009011 | Bacteria | 736 |
| 181 | Ga0105240_10001059 | 3300009093 | Bacteria | 48690 |
| 182 | Ga0105240_10002425 | 3300009093 | Bacteria | 29968 |
| 183 | Ga0105240_10108436 | 3300009093 | Bacteria | 3364 |
| 184 | Ga0105240_10148269 | 3300009093 | Bacteria | 2797 |
| 185 | Ga0105240_10259107 | 3300009093 | Bacteria | 2007 |
| 186 | Ga0105240_10264502 | 3300009093 | Bacteria | 1983 |
| 187 | Ga0105240_10344273 | 3300009093 | Bacteria | 1693 |
| 188 | Ga0105240_10800909 | 3300009093 | Bacteria | 1021 |
| 189 | Ga0105240_11432824 | 3300009093 | Unclassified | 725 |
| 190 | Ga0105245_10009828 | 3300009098 | Bacteria | 8336 |
| 191 | Ga0105245_10011723 | 3300009098 | Bacteria | 7628 |
| 192 | Ga0105245_10761294 | 3300009098 | Unclassified | 1005 |
| 193 | Ga0105247_10000558 | 3300009101 | Bacteria | 30299 |
| 194 | Ga0105247_10007392 | 3300009101 | Bacteria | 6744 |
| 195 | Ga0105247_10020368 | 3300009101 | Bacteria | 3988 |
| 196 | Ga0105247_10029035 | 3300009101 | Bacteria | 3349 |
| 197 | Ga0105247_10076456 | 3300009101 | Bacteria | 2102 |
| 198 | Ga0105247_10122147 | 3300009101 | Unclassified | 1689 |
| 199 | Ga0105243_10457762 | 3300009148 | Unclassified | 1199 |
| 200 | Ga0105241_10044123 | 3300009174 | Bacteria | 3378 |
| 201 | Ga0105242_10001505 | 3300009176 | Bacteria | 18312 |
| 202 | Ga0105242_10006373 | 3300009176 | Bacteria | 9084 |
| 203 | Ga0105248_10002404 | 3300009177 | Bacteria | 20783 |
| 204 | Ga0105248_10010045 | 3300009177 | Bacteria | 10424 |
| 205 | Ga0105248_10010440 | 3300009177 | Bacteria | 10229 |
| 206 | Ga0105248_10041193 | 3300009177 | Bacteria | 5177 |
| 207 | Ga0105248_10109384 | 3300009177 | Bacteria | 3116 |
| 208 | Ga0105248_10925351 | 3300009177 | Bacteria | 985 |
| 209 | Ga0105237_10054088 | 3300009545 | Unclassified | 4022 |
| 210 | Ga0105237_10220496 | 3300009545 | Unclassified | 1897 |
| 211 | Ga0105237_10530997 | 3300009545 | Bacteria | 1183 |
| 212 | Ga0105238_10000966 | 3300009551 | Bacteria | 29470 |
| 213 | Ga0105238_10027386 | 3300009551 | Bacteria | 5807 |
| 214 | Ga0105238_10037863 | 3300009551 | Bacteria | 4901 |
| 215 | Ga0105238_10104264 | 3300009551 | Bacteria | 2817 |
| 216 | Ga0105238_10415859 | 3300009551 | Bacteria | 1339 |
| 217 | Ga0105238_10872594 | 3300009551 | Bacteria | 917 |
| 218 | Ga0105238_11184384 | 3300009551 | Bacteria | 788 |
| 219 | Ga0105249_10015712 | 3300009553 | Bacteria | 6704 |
| 220 | Ga0105249_10108489 | 3300009553 | Unclassified | 2621 |
| 221 | Ga0105249_10212896 | 3300009553 | Bacteria | 1897 |
| 222 | Ga0099796_10000042 | 3300010159 | Bacteria | 25551 |
| 223 | Ga0099796_10101289 | 3300010159 | Unclassified | 1084 |
| 224 | Ga0105239_10019609 | 3300010375 | Bacteria | 7464 |
| 225 | Ga0105239_10031025 | 3300010375 | Bacteria | 5880 |
| 226 | Ga0105239_10317592 | 3300010375 | Bacteria | 1756 |
| 227 | Ga0105239_11324358 | 3300010375 | Bacteria | 831 |
| 228 | Ga0105239_11393335 | 3300010375 | Bacteria | 809 |
| 229 | Ga0105246_10053653 | 3300011119 | Unclassified | 2775 |
| 230 | Ga0157373_10135919 | 3300013100 | Bacteria | 1728 |
| 231 | Ga0157373_10522839 | 3300013100 | Bacteria | 859 |
| 232 | Ga0157370_10004643 | 3300013104 | Bacteria | 15700 |
| 233 | Ga0157369_10044939 | 3300013105 | Bacteria | 4806 |
| 234 | Ga0157369_10148671 | 3300013105 | Unclassified | 2476 |
| 235 | Ga0157369_10202208 | 3300013105 | Unclassified | 2085 |
| 236 | Ga0157369_10203429 | 3300013105 | Unclassified | 2078 |
| 237 | Ga0157374_10001326 | 3300013296 | Bacteria | 21038 |
| 238 | Ga0157374_10014106 | 3300013296 | Bacteria | 6985 |
| 239 | Ga0157374_10808941 | 3300013296 | Bacteria | 953 |
| 240 | Ga0157378_10001014 | 3300013297 | Bacteria | 25676 |
| 241 | Ga0157378_10011814 | 3300013297 | Bacteria | 7644 |
| 242 | Ga0163162_10026906 | 3300013306 | Bacteria | 5688 |
| 243 | Ga0163162_10068378 | 3300013306 | Unclassified | 3603 |
| 244 | Ga0163162_10160254 | 3300013306 | Bacteria | 2371 |
| 245 | Ga0163162_10784906 | 3300013306 | Bacteria | 1071 |
| 246 | Ga0157372_10127596 | 3300013307 | Unclassified | 2925 |
| 247 | Ga0157372_10138209 | 3300013307 | Bacteria | 2807 |
| 248 | Ga0157372_10241175 | 3300013307 | Bacteria | 2098 |
| 249 | Ga0157372_10561362 | 3300013307 | Bacteria | 1331 |
| 250 | Ga0157375_10062319 | 3300013308 | Bacteria | 3705 |
| 251 | Ga0157375_11719139 | 3300013308 | Bacteria | 743 |
| 252 | Ga0163163_10383653 | 3300014325 | Unclassified | 1463 |
| 253 | Ga0163163_11233371 | 3300014325 | Unclassified | 810 |
| 254 | Ga0157380_10050148 | 3300014326 | Bacteria | 3296 |
| 255 | Ga0157380_10437129 | 3300014326 | Bacteria | 1253 |
| 256 | Ga0157379_10002640 | 3300014968 | Bacteria | 15084 |
| 257 | Ga0157379_10034571 | 3300014968 | Bacteria | 4507 |
| 258 | Ga0157379_10186075 | 3300014968 | Bacteria | 1877 |
| 259 | Ga0157379_10291537 | 3300014968 | Bacteria | 1486 |
| 260 | Ga0157379_10326670 | 3300014968 | Unclassified | 1401 |
| 261 | Ga0157379_10391145 | 3300014968 | Unclassified | 1277 |
| 262 | Ga0157376_10017747 | 3300014969 | Bacteria | 5438 |
| 263 | Ga0157376_10047983 | 3300014969 | Bacteria | 3528 |
| 264 | Ga0157376_10090699 | 3300014969 | Bacteria | 2645 |
| 265 | Ga0182007_10065640 | 3300015262 | Bacteria | 1189 |
| 266 | Ga0163161_10117965 | 3300017792 | Unclassified | 1991 |
| 267 | Ga0206354_10136901 | 3300020081 | Bacteria | 756 |
| 268 | Ga0206353_10401490 | 3300020082 | Bacteria | 2162 |
| 269 | Ga0213872_10165784 | 3300021361 | Bacteria | 960 |
| 270 | Ga0213874_10008195 | 3300021377 | Bacteria | 2539 |
| 271 | Ga0213874_10103921 | 3300021377 | Unclassified | 948 |
| 272 | Ga0213876_10025709 | 3300021384 | Bacteria | 3105 |
| 273 | Ga0213871_10023011 | 3300021441 | Bacteria | 1566 |
| 274 | Ga0228598_1018914 | 3300024227 | Bacteria | 1359 |
| 275 | Ga0207692_10148310 | 3300025898 | Unclassified | 1341 |
| 276 | Ga0207692_10782059 | 3300025898 | Bacteria | 623 |
| 277 | Ga0207642_10010284 | 3300025899 | Bacteria | 3292 |
| 278 | Ga0207710_10000134 | 3300025900 | Bacteria | 87269 |
| 279 | Ga0207710_10406539 | 3300025900 | Unclassified | 699 |
| 280 | Ga0207680_10022394 | 3300025903 | Bacteria | 3435 |
| 281 | Ga0207680_10044186 | 3300025903 | Bacteria | 2618 |
| 282 | Ga0207680_10150480 | 3300025903 | Unclassified | 1551 |
| 283 | Ga0207680_10325703 | 3300025903 | Unclassified | 1075 |
| 284 | Ga0207647_10032062 | 3300025904 | Unclassified | 3379 |
| 285 | Ga0207699_10008419 | 3300025906 | Bacteria | 5090 |
| 286 | Ga0207699_10009199 | 3300025906 | Bacteria | 4908 |
| 287 | Ga0207699_10037269 | 3300025906 | Bacteria | 2778 |
| 288 | Ga0207699_10090182 | 3300025906 | Bacteria | 1923 |
| 289 | Ga0207705_10133043 | 3300025909 | Bacteria | 1852 |
| 290 | Ga0207684_10268254 | 3300025910 | Bacteria | 1473 |
| 291 | Ga0207654_10020098 | 3300025911 | Unclassified | 3535 |
| 292 | Ga0207707_10001543 | 3300025912 | Bacteria | 21211 |
| 293 | Ga0207707_10003173 | 3300025912 | Bacteria | 14592 |
| 294 | Ga0207707_10028857 | 3300025912 | Bacteria | 4849 |
| 295 | Ga0207707_10051661 | 3300025912 | Bacteria | 3580 |
| 296 | Ga0207707_10067384 | 3300025912 | Bacteria | 3118 |
| 297 | Ga0207707_10083596 | 3300025912 | Bacteria | 2787 |
| 298 | Ga0207707_10088373 | 3300025912 | Bacteria | 2707 |
| 299 | Ga0207695_10016760 | 3300025913 | Bacteria | 8555 |
| 300 | Ga0207695_10019323 | 3300025913 | Bacteria | 7846 |
| 301 | Ga0207695_10033634 | 3300025913 | Bacteria | 5587 |
| 302 | Ga0207695_10056194 | 3300025913 | Bacteria | 4097 |
| 303 | Ga0207695_10083519 | 3300025913 | Bacteria | 3226 |
| 304 | Ga0207695_10450806 | 3300025913 | Bacteria | 1169 |
| 305 | Ga0207695_10508252 | 3300025913 | Unclassified | 1087 |
| 306 | Ga0207695_10897266 | 3300025913 | Bacteria | 766 |
| 307 | Ga0207671_10170205 | 3300025914 | Unclassified | 1691 |
| 308 | Ga0207671_10251384 | 3300025914 | Bacteria | 1390 |
| 309 | Ga0207671_11065719 | 3300025914 | Unclassified | 636 |
| 310 | Ga0207693_10000060 | 3300025915 | Bacteria | 93715 |
| 311 | Ga0207663_10095510 | 3300025916 | Bacteria | 1983 |
| 312 | Ga0207663_10214000 | 3300025916 | Bacteria | 1398 |
| 313 | Ga0207663_10914313 | 3300025916 | Bacteria | 702 |
| 314 | Ga0207660_10008463 | 3300025917 | Bacteria | 6655 |
| 315 | Ga0207660_10081294 | 3300025917 | Bacteria | 2381 |
| 316 | Ga0207660_10154717 | 3300025917 | Bacteria | 1764 |
| 317 | Ga0207660_10195431 | 3300025917 | Unclassified | 1578 |
| 318 | Ga0207657_10158674 | 3300025919 | Unclassified | 1838 |
| 319 | Ga0207649_10074366 | 3300025920 | Bacteria | 2180 |
| 320 | Ga0207652_10004353 | 3300025921 | Bacteria | 11541 |
| 321 | Ga0207652_10088628 | 3300025921 | Bacteria | 2715 |
| 322 | Ga0207694_10007297 | 3300025924 | Bacteria | 8388 |
| 323 | Ga0207694_10177420 | 3300025924 | Bacteria | 1726 |
| 324 | Ga0207694_10200503 | 3300025924 | Unclassified | 1623 |
| 325 | Ga0207694_10219810 | 3300025924 | Unclassified | 1549 |
| 326 | Ga0207650_10044645 | 3300025925 | Unclassified | 3257 |
| 327 | Ga0207650_10092483 | 3300025925 | Unclassified | 2313 |
| 328 | Ga0207687_10020018 | 3300025927 | Bacteria | 4438 |
| 329 | Ga0207700_10036854 | 3300025928 | Bacteria | 3536 |
| 330 | Ga0207700_10107088 | 3300025928 | Unclassified | 2242 |
| 331 | Ga0207700_10427089 | 3300025928 | Bacteria | 1165 |
| 332 | Ga0207700_10599524 | 3300025928 | Bacteria | 980 |
| 333 | Ga0207664_10026898 | 3300025929 | Bacteria | 4354 |
| 334 | Ga0207664_10098002 | 3300025929 | Bacteria | 2417 |
| 335 | Ga0207664_10303019 | 3300025929 | Bacteria | 1406 |
| 336 | Ga0207644_10025961 | 3300025931 | Unclassified | 4032 |
| 337 | Ga0207644_10028162 | 3300025931 | Bacteria | 3886 |
| 338 | Ga0207644_10451303 | 3300025931 | Unclassified | 1056 |
| 339 | Ga0207644_10624763 | 3300025931 | Bacteria | 895 |
| 340 | Ga0207690_10104171 | 3300025932 | Unclassified | 2032 |
| 341 | Ga0207706_10303335 | 3300025933 | Unclassified | 1391 |
| 342 | Ga0207706_10339258 | 3300025933 | Bacteria | 1307 |
| 343 | Ga0207686_10029965 | 3300025934 | Bacteria | 3216 |
| 344 | Ga0207686_10220486 | 3300025934 | Unclassified | 1369 |
| 345 | Ga0207686_10357637 | 3300025934 | Bacteria | 1101 |
| 346 | Ga0207709_10812924 | 3300025935 | Unclassified | 755 |
| 347 | Ga0207670_10122643 | 3300025936 | Unclassified | 1892 |
| 348 | Ga0207669_10577357 | 3300025937 | Bacteria | 911 |
| 349 | Ga0207704_10010187 | 3300025938 | Bacteria | 4571 |
| 350 | Ga0207665_10013127 | 3300025939 | Bacteria | 5446 |
| 351 | Ga0207665_10062406 | 3300025939 | Bacteria | 2528 |
| 352 | Ga0207665_10212608 | 3300025939 | Bacteria | 1414 |
| 353 | Ga0207691_10292272 | 3300025940 | Unclassified | 1401 |
| 354 | Ga0207691_10477695 | 3300025940 | Bacteria | 1059 |
| 355 | Ga0207711_10016352 | 3300025941 | Bacteria | 6166 |
| 356 | Ga0207711_10033562 | 3300025941 | Bacteria | 4344 |
| 357 | Ga0207711_10264937 | 3300025941 | Bacteria | 1580 |
| 358 | Ga0207711_10306933 | 3300025941 | Bacteria | 1464 |
| 359 | Ga0207711_10611543 | 3300025941 | Bacteria | 1017 |
| 360 | Ga0207711_10682763 | 3300025941 | Bacteria | 958 |
| 361 | Ga0207689_10705373 | 3300025942 | Bacteria | 851 |
| 362 | Ga0207689_10724305 | 3300025942 | Bacteria | 839 |
| 363 | Ga0207661_10090182 | 3300025944 | Unclassified | 2552 |
| 364 | Ga0207661_10609646 | 3300025944 | Unclassified | 1002 |
| 365 | Ga0207679_10396857 | 3300025945 | Bacteria | 1213 |
| 366 | Ga0207679_10580660 | 3300025945 | Unclassified | 1008 |
| 367 | Ga0207667_10016427 | 3300025949 | Bacteria | 8367 |
| 368 | Ga0207667_10100314 | 3300025949 | Unclassified | 2986 |
| 369 | Ga0207667_10799060 | 3300025949 | Bacteria | 940 |
| 370 | Ga0207651_10103967 | 3300025960 | Bacteria | 2115 |
| 371 | Ga0207712_10073839 | 3300025961 | Unclassified | 2461 |
| 372 | Ga0207712_10148861 | 3300025961 | Bacteria | 1806 |
| 373 | Ga0207640_10424969 | 3300025981 | Unclassified | 1088 |
| 374 | Ga0207658_10000746 | 3300025986 | Bacteria | 27992 |
| 375 | Ga0207658_10032600 | 3300025986 | Bacteria | 3709 |
| 376 | Ga0207658_10035725 | 3300025986 | Bacteria | 3560 |
| 377 | Ga0207658_10036219 | 3300025986 | Bacteria | 3537 |
| 378 | Ga0207677_10355308 | 3300026023 | Bacteria | 1229 |
| 379 | Ga0207703_10003474 | 3300026035 | Bacteria | 13199 |
| 380 | Ga0207703_10006491 | 3300026035 | Bacteria | 9337 |
| 381 | Ga0207703_10130641 | 3300026035 | Bacteria | 2168 |
| 382 | Ga0207703_10643681 | 3300026035 | Bacteria | 1005 |
| 383 | Ga0207639_10399180 | 3300026041 | Bacteria | 1238 |
| 384 | Ga0207639_10823011 | 3300026041 | Unclassified | 866 |
| 385 | Ga0207639_11516275 | 3300026041 | Bacteria | 629 |
| 386 | Ga0207678_10031411 | 3300026067 | Bacteria | 4632 |
| 387 | Ga0207708_10971680 | 3300026075 | Bacteria | 737 |
| 388 | Ga0207702_10109134 | 3300026078 | Bacteria | 2456 |
| 389 | Ga0207702_10212225 | 3300026078 | Unclassified | 1800 |
| 390 | Ga0207641_10001822 | 3300026088 | Bacteria | 20498 |
| 391 | Ga0207641_10032206 | 3300026088 | Bacteria | 4352 |
| 392 | Ga0207641_10332765 | 3300026088 | Bacteria | 1443 |
| 393 | Ga0207641_11245633 | 3300026088 | Unclassified | 744 |
| 394 | Ga0207641_11744600 | 3300026088 | Bacteria | 624 |
| 395 | Ga0207648_10427578 | 3300026089 | Bacteria | 1203 |
| 396 | Ga0207648_10584002 | 3300026089 | Unclassified | 1029 |
| 397 | Ga0207674_10212247 | 3300026116 | Unclassified | 1885 |
| 398 | Ga0207675_100014060 | 3300026118 | Bacteria | 7464 |
| 399 | Ga0207675_100038984 | 3300026118 | Bacteria | 4434 |
| 400 | Ga0207675_100044390 | 3300026118 | Bacteria | 4154 |
| 401 | Ga0207675_100073376 | 3300026118 | Bacteria | 3202 |
| 402 | Ga0207675_100103102 | 3300026118 | Bacteria | 2688 |
| 403 | Ga0207683_10000725 | 3300026121 | Bacteria | 29989 |
| 404 | Ga0207683_10270825 | 3300026121 | Unclassified | 1551 |
| 405 | Ga0207698_10832645 | 3300026142 | Unclassified | 927 |
| 406 | Ga0209179_1000027 | 3300027512 | Bacteria | 35217 |
| 407 | Ga0268266_10004065 | 3300028379 | Bacteria | 14142 |
| 408 | Ga0268266_10012525 | 3300028379 | Bacteria | 7329 |
| 409 | Ga0268266_10028183 | 3300028379 | Bacteria | 4775 |
| 410 | Ga0268266_10059617 | 3300028379 | Unclassified | 3288 |
| 411 | Ga0268266_10081277 | 3300028379 | Bacteria | 2825 |
| 412 | Ga0268266_10145362 | 3300028379 | Unclassified | 2131 |
| 413 | Ga0268266_10310554 | 3300028379 | Bacteria | 1473 |
| 414 | Ga0268266_10434641 | 3300028379 | Bacteria | 1246 |
| 415 | Ga0268266_10465018 | 3300028379 | Bacteria | 1204 |
| 416 | Ga0268265_10117919 | 3300028380 | Bacteria | 2181 |
| 417 | Ga0268265_10120665 | 3300028380 | Bacteria | 2159 |
| 418 | Ga0268265_10296736 | 3300028380 | Unclassified | 1453 |
| 419 | Ga0268265_10781931 | 3300028380 | Unclassified | 929 |
| 420 | Ga0268265_10977123 | 3300028380 | Unclassified | 835 |
| 421 | Ga0268264_10000736 | 3300028381 | Bacteria | 37406 |
| 422 | Ga0268264_10287304 | 3300028381 | Bacteria | 1543 |
| 423 | Ga0268264_10614521 | 3300028381 | Bacteria | 1072 |
| 424 | Ga0268264_10754254 | 3300028381 | Unclassified | 970 |
| 425 | Ga0265319_1029612 | 3300028563 | Bacteria | 1921 |
| 426 | Ga0265334_10225268 | 3300028573 | Unclassified | 648 |
| 427 | Ga0265318_10001026 | 3300028577 | Bacteria | 17759 |
| 428 | Ga0265338_10149324 | 3300028800 | Unclassified | 1818 |
| 429 | Ga0307511_10000205 | 3300030521 | Bacteria | 59754 |
| 430 | Ga0307511_10114181 | 3300030521 | Bacteria | 1703 |
| 431 | Ga0307511_10180198 | 3300030521 | Unclassified | 1140 |
| 432 | Ga0265330_10003872 | 3300031235 | Bacteria | 7702 |
| 433 | Ga0265332_10003323 | 3300031238 | Bacteria | 7803 |
| 434 | Ga0265329_10001089 | 3300031242 | Bacteria | 13337 |
| 435 | Ga0265340_10031556 | 3300031247 | Bacteria | 2649 |
| 436 | Ga0265339_10049675 | 3300031249 | Bacteria | 2296 |
| 437 | Ga0265331_10002553 | 3300031250 | Bacteria | 12240 |
| 438 | Ga0265331_10003719 | 3300031250 | Bacteria | 9697 |
| 439 | Ga0265316_10008890 | 3300031344 | Bacteria | 9273 |
| 440 | Ga0307513_10010158 | 3300031456 | Bacteria | 11836 |
| 441 | Ga0307513_10131299 | 3300031456 | Bacteria | 2450 |
| 442 | Ga0307513_10192564 | 3300031456 | Bacteria | 1889 |
| 443 | Ga0307509_10000167 | 3300031507 | Bacteria | 103177 |
| 444 | Ga0307509_10074603 | 3300031507 | Unclassified | 3527 |
| 445 | Ga0307509_10288603 | 3300031507 | Bacteria | 1397 |
| 446 | Ga0307408_100119841 | 3300031548 | Bacteria | 2037 |
| 447 | Ga0307408_100298344 | 3300031548 | Bacteria | 1349 |
| 448 | Ga0316575_10187787 | 3300031665 | Bacteria | 859 |
| 449 | Ga0265314_10002268 | 3300031711 | Bacteria | 19911 |
| 450 | Ga0316576_10070324 | 3300031727 | Bacteria | 2581 |
| 451 | Ga0307516_10494927 | 3300031730 | Unclassified | 877 |
| 452 | Ga0316577_10263115 | 3300031733 | Bacteria | 976 |
| 453 | Ga0326468_10052413 | 3300031889 | Unclassified | 623 |
| 454 | Ga0307412_10392676 | 3300031911 | Unclassified | 1127 |
| 455 | Ga0307411_10203459 | 3300032005 | Bacteria | 1523 |
| 456 | Ga0307411_10511677 | 3300032005 | Bacteria | 1017 |
| 457 | Ga0307415_100216645 | 3300032126 | Bacteria | 1532 |
| 458 | Ga0307415_100792313 | 3300032126 | Unclassified | 864 |
| 459 | Ga0307510_10000009 | 3300033180 | Bacteria | 409702 |
| 460 | Ga0307510_10041650 | 3300033180 | Bacteria | 5016 |
| 461 | Ga0373928_0118048 | 3300035084 | Unclassified | 708 |
| 462 | Ga0373936_0016115 | 3300035113 | Unclassified | 2871 |
| 463 | Ga0373936_0027648 | 3300035113 | Bacteria | 2225 |
| 464 | Ga0373939_0135206 | 3300035114 | Unclassified | 884 |
| 465 | Ga0373954_0108224 | 3300035118 | Bacteria | 1344 |
| 466 | Ga0373954_0199791 | 3300035118 | Unclassified | 982 |
| 467 | Ga0373957_0219378 | 3300035120 | Bacteria | 796 |
| 468 | Ga0373943_0362606 | 3300035170 | Unclassified | 832 |
| 469 | Ga0373955_0038433 | 3300035172 | Bacteria | 2550 |
| 470 | Ga0373955_0044023 | 3300035172 | Bacteria | 2403 |
| 471 | Ga0373955_0609909 | 3300035172 | Bacteria | 668 |
| 472 | Ga0316574_0729567 | 3300035398 | Bacteria | 606 |
| 473 | Ga0373927_0049029 | 3300035695 | Bacteria | 2731 |
| 474 | Ga0373927_0537207 | 3300035695 | Unclassified | 773 |
| 475 | Ga0373933_0011477 | 3300035724 | Unclassified | 4886 |
| 476 | Ga0373947_0060514 | 3300035725 | Bacteria | 2300 |
| 477 | Ga0373937_0001197 | 3300036401 | Bacteria | 21800 |
| 478 | Ga0373937_0031862 | 3300036401 | Bacteria | 4779 |
| 479 | Ga0373937_0041078 | 3300036401 | Bacteria | 4219 |
| 480 | Ga0316582_0812123 | 3300036647 | Bacteria | 641 |
| 481 | Ga0316584_0083048 | 3300036712 | Bacteria | 2399 |
| 482 | Ga0373925_0247830 | 3300037068 | Bacteria | 1428 |
| 483 | Ga0395905_0748036 | 3300037471 | Bacteria | 880 |
| 484 | Ga0436364_0511138 | 3300037853 | Unclassified | 843 |
| 485 | Ga0436364_1263693 | 3300037853 | Bacteria | 933 |
| 486 | Ga0436364_1433804 | 3300037853 | Bacteria | 762 |
| 487 | Ga0436365_0738787 | 3300039437 | Bacteria | 7867 |
| 488 | Ga0436360_0281290 | 3300039438 | Bacteria | 2916 |
| 489 | Ga0436360_0477701 | 3300039438 | Bacteria | 649 |
| 490 | Ga0436360_1260296 | 3300039438 | Bacteria | 1192 |
| 491 | Ga0436361_0407670 | 3300039447 | Bacteria | 1192 |
| 492 | Ga0436361_1163383 | 3300039447 | Bacteria | 1405 |
| 493 | Ga0436361_1173204 | 3300039447 | Unclassified | 1685 |
| 494 | Ga0436363_0138643 | 3300039450 | Bacteria | 8554 |
| 495 | Ga0436363_0853019 | 3300039450 | Unclassified | 1393 |
| 496 | Ga0436363_0895754 | 3300039450 | Unclassified | 762 |
| 497 | Ga0436363_0944041 | 3300039450 | Bacteria | 1759 |
| 498 | Ga0436363_1121322 | 3300039450 | Bacteria | 7625 |
| 499 | Ga0436363_1643864 | 3300039450 | Unclassified | 692 |
| 500 | Ga0451793_0118976 | 3300041452 | Bacteria | 1267 |
| 501 | Ga0451798_0916510 | 3300041458 | Bacteria | 2981 |
| 502 | Ga0451802_0496319 | 3300041460 | Bacteria | 680 |
| 503 | Ga0451833_1167638 | 3300041491 | Bacteria | 1679 |
| 504 | Ga0439449_0088831 | 3300042007 | Unclassified | 1141 |
| 505 | Ga0466969_0000425 | 3300044656 | Bacteria | 23054 |
| 506 | Ga0466969_0001362 | 3300044656 | Bacteria | 13168 |
| 507 | Ga0466972_0036588 | 3300044658 | Bacteria | 2401 |
| 508 | Ga0466966_0000285 | 3300044684 | Bacteria | 33126 |
| 509 | Ga0466966_0026246 | 3300044684 | Bacteria | 3804 |
| 510 | Ga0466961_0109819 | 3300044693 | Bacteria | 1736 |
| 511 | Ga0466964_0000393 | 3300044706 | Bacteria | 13311 |
| 512 | Ga0466971_0006649 | 3300044719 | Bacteria | 5028 |
| 513 | Ga0466971_0129466 | 3300044719 | Bacteria | 1171 |
| 514 | Ga0466968_0015970 | 3300044735 | Bacteria | 2984 |
| 515 | Ga0466968_0051691 | 3300044735 | Unclassified | 1756 |
| 516 | Ga0466970_0005912 | 3300044765 | Bacteria | 6096 |
| 517 | Ga0466957_0069242 | 3300044842 | Unclassified | 2180 |
| 518 | Ga0466960_0030401 | 3300044901 | Bacteria | 2485 |
| 519 | Ga0466959_0004362 | 3300045049 | Bacteria | 9464 |
| 520 | Ga0466959_0006207 | 3300045049 | Bacteria | 8260 |
| 521 | Ga0466959_0042845 | 3300045049 | Bacteria | 3338 |
| 522 | Ga0466958_0179729 | 3300045836 | Bacteria | 1342 |
| 523 | Ga0495590_0028526 | 3300046457 | Unclassified | 1957 |
| 524 | Ga0495638_0001279 | 3300046460 | Bacteria | 23471 |
| 525 | Ga0495638_0019850 | 3300046460 | Bacteria | 4444 |
| 526 | Ga0495641_0063586 | 3300046461 | Unclassified | 1663 |
| 527 | Ga0495580_0062193 | 3300046472 | Bacteria | 2620 |
| 528 | Ga0495580_0147970 | 3300046472 | Bacteria | 1627 |
| 529 | Ga0495580_0313653 | 3300046472 | Bacteria | 1066 |
| 530 | Ga0495585_0331932 | 3300046492 | Unclassified | 742 |
| 531 | Ga0495583_0060331 | 3300046506 | Bacteria | 1696 |
| 532 | Ga0495616_0045416 | 3300046513 | Unclassified | 2223 |
| 533 | Ga0495618_0172999 | 3300046514 | Bacteria | 1374 |
| 534 | Ga0495628_0071937 | 3300046516 | Bacteria | 2695 |
| 535 | Ga0495630_0392822 | 3300046517 | Bacteria | 1063 |
| 536 | Ga0495632_0043607 | 3300046519 | Bacteria | 2241 |
| 537 | Ga0495632_0190911 | 3300046519 | Unclassified | 936 |
| 538 | Ga0495632_0312520 | 3300046519 | Unclassified | 695 |
| 539 | Ga0495640_0292042 | 3300046533 | Bacteria | 1014 |
| 540 | Ga0495587_0045287 | 3300046536 | Unclassified | 2615 |
| 541 | Ga0495645_0379916 | 3300046543 | Bacteria | 904 |
| 542 | Ga0495625_0001239 | 3300046660 | Bacteria | 32208 |
| 543 | Ga0495625_0015653 | 3300046660 | Bacteria | 5998 |
| 544 | Ga0495625_0067579 | 3300046660 | Unclassified | 2515 |
| 545 | Ga0495657_0295280 | 3300046675 | Bacteria | 967 |
| 546 | Ga0495623_0110944 | 3300046679 | Unclassified | 1662 |
| 547 | Ga0495658_0307157 | 3300046683 | Bacteria | 1004 |
| 548 | Ga0495600_0305618 | 3300046809 | Bacteria | 1003 |
| 549 | Ga0495581_0213532 | 3300047315 | Bacteria | 1128 |
| 550 | Ga0495687_014634 | 3300047443 | Unclassified | 4026 |
| 551 | Ga0495675_0127150 | 3300047444 | Bacteria | 1585 |
| 552 | Ga0495686_0106791 | 3300047472 | Bacteria | 1683 |
| 553 | Ga0495593_0501870 | 3300047673 | Bacteria | 608 |
| 554 | Ga0495602_0106535 | 3300048088 | Unclassified | 2288 |
| 555 | Ga0496100_1074130 | 3300048903 | Unclassified | 634 |
| 556 | Ga0496101_0002164 | 3300048904 | Bacteria | 12007 |
| 557 | Ga0496102_0007024 | 3300048905 | Bacteria | 9614 |
| 558 | Ga0496102_0015062 | 3300048905 | Bacteria | 6731 |
| 559 | Ga0496102_0067437 | 3300048905 | Bacteria | 3282 |
| 560 | Ga0496102_0088319 | 3300048905 | Bacteria | 2865 |
| 561 | Ga0496103_0100853 | 3300048906 | Bacteria | 1827 |
| 562 | Ga0496104_0196072 | 3300048907 | Bacteria | 1931 |
| 563 | Ga0496104_0441728 | 3300048907 | Unclassified | 1213 |
| 564 | Ga0496105_0011414 | 3300048908 | Bacteria | 7017 |
| 565 | Ga0496105_0020408 | 3300048908 | Bacteria | 5354 |
| 566 | Ga0496105_0116720 | 3300048908 | Bacteria | 2202 |
| 567 | Ga0496106_0340156 | 3300048909 | Bacteria | 1205 |
| 568 | Ga0496106_0508579 | 3300048909 | Bacteria | 967 |
| 569 | Ga0496107_0009320 | 3300048910 | Bacteria | 6804 |
| 570 | Ga0496107_1099798 | 3300048910 | Bacteria | 574 |
| 571 | Ga0496108_0006755 | 3300048911 | Bacteria | 9287 |
| 572 | Ga0496108_0124832 | 3300048911 | Unclassified | 2209 |
| 573 | Ga0496108_0387703 | 3300048911 | Bacteria | 1220 |
| 574 | Ga0496109_0001391 | 3300048912 | Bacteria | 20067 |
| 575 | Ga0496109_0030449 | 3300048912 | Bacteria | 4836 |
| 576 | Ga0496110_0005095 | 3300048913 | Bacteria | 10264 |
| 577 | Ga0496110_0147271 | 3300048913 | Unclassified | 2130 |
| 578 | Ga0496111_0003948 | 3300048914 | Bacteria | 9307 |
| 579 | Ga0496112_0075507 | 3300048915 | Bacteria | 3333 |
| 580 | Ga0496113_0014370 | 3300048916 | Bacteria | 5400 |
| 581 | Ga0496114_0130769 | 3300048917 | Bacteria | 2167 |
| 582 | Ga0496114_0158930 | 3300048917 | Bacteria | 1964 |
| 583 | Ga0496115_0177255 | 3300048918 | Bacteria | 1762 |
| 584 | Ga0496115_0514037 | 3300048918 | Bacteria | 961 |
| 585 | Ga0496116_0006366 | 3300048919 | Bacteria | 10739 |
| 586 | Ga0496117_0000099 | 3300048920 | Bacteria | 194987 |
| 587 | Ga0496118_0000105 | 3300048921 | Bacteria | 156739 |
| 588 | Ga0496118_0093276 | 3300048921 | Bacteria | 2063 |
| 589 | Ga0496118_0127266 | 3300048921 | Unclassified | 1644 |
| 590 | Ga0496119_0005649 | 3300048922 | Bacteria | 11872 |
| 591 | Ga0496119_0022550 | 3300048922 | Bacteria | 4501 |
| 592 | Ga0496120_0000612 | 3300048923 | Bacteria | 54154 |
| 593 | Ga0496120_0057067 | 3300048923 | Bacteria | 2199 |
| 594 | Ga0496121_0000772 | 3300048924 | Bacteria | 58665 |
| 595 | Ga0496121_0038922 | 3300048924 | Unclassified | 4201 |
| 596 | Ga0496121_0089235 | 3300048924 | Bacteria | 2414 |
| 597 | Ga0496121_0140187 | 3300048924 | Bacteria | 1795 |
| 598 | Ga0496124_0199380 | 3300048927 | Bacteria | 1523 |
| 599 | Ga0496124_0342332 | 3300048927 | Unclassified | 1061 |
| 600 | Ga0496125_0000186 | 3300048928 | Bacteria | 135128 |
| 601 | Ga0496125_0001407 | 3300048928 | Bacteria | 35110 |
| 602 | Ga0496125_0015680 | 3300048928 | Bacteria | 7310 |
| 603 | Ga0496126_0045294 | 3300048929 | Bacteria | 4044 |
| 604 | Ga0496126_0071161 | 3300048929 | Bacteria | 3097 |
| 605 | Ga0496126_0881160 | 3300048929 | Bacteria | 680 |
| 606 | Ga0495682_0077389 | 3300049460 | Unclassified | 1197 |
| 607 | Ga0501080_0183001 | 3300049742 | Unclassified | 1928 |
| 608 | nmdc:mga0rr50_623801_c1 | 3300050513 | Bacteria | 919 |
| 609 | nmdc:mga08x19_54419_c1 | 3300050514 | Bacteria | 2576 |
| 610 | Ga0495601_0290053 | 3300053077 | Bacteria | 1067 |
| 611 | Ga0500646_0153609 | 3300053090 | Unclassified | 764 |
| 612 | Ga0500583_0009635 | 3300053092 | Bacteria | 3542 |
| 613 | Ga0500583_0078901 | 3300053092 | Bacteria | 1588 |
| 614 | Ga0500650_0172459 | 3300053098 | Unclassified | 994 |
| 615 | Ga0500556_0000174 | 3300053104 | Bacteria | 52844 |
| 616 | Ga0500558_130287 | 3300053106 | Bacteria | 962 |
| 617 | Ga0500594_0014664 | 3300053118 | Bacteria | 1880 |
| 618 | Ga0500642_0274619 | 3300053130 | Bacteria | 767 |
| 619 | Ga0500655_004693 | 3300053133 | Bacteria | 2457 |
| 620 | Ga0500658_0028219 | 3300053134 | Bacteria | 2176 |
| 621 | Ga0500658_0095886 | 3300053134 | Bacteria | 1289 |
| 622 | Ga0500658_0396633 | 3300053134 | Unclassified | 632 |
| 623 | Ga0500559_0043615 | 3300053136 | Unclassified | 1960 |
| 624 | Ga0500568_0197249 | 3300053139 | Unclassified | 738 |
| 625 | Ga0500588_0004234 | 3300053146 | Bacteria | 3093 |
| 626 | Ga0500589_240320 | 3300053147 | Unclassified | 670 |
| 627 | Ga0500622_0001768 | 3300053156 | Bacteria | 16579 |
| 628 | Ga0500627_0256826 | 3300053158 | Unclassified | 772 |
| 629 | Ga0500633_0064749 | 3300053160 | Bacteria | 1293 |
| 630 | Ga0500639_018575 | 3300053163 | Unclassified | 3670 |
| 631 | Ga0500596_058780 | 3300053735 | Unclassified | 640 |
| 632 | Ga0590075_044119 | 3300059424 | Bacteria | 1141 |
| 633 | Ga0587111_0098526 | 3300060346 | Bacteria | 725 |
| 634 | Ga0466962_0000191 | 3300061719 | Bacteria | 25547 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0093276 | Ga0496118_0093276_1555_2052 | 135 |
| 2 | 3300013297 | Ga0157378_10001014 | Ga0157378_100010145 | 139 |
| 3 | 3300039438 | Ga0436360_0477701 | Ga0436360_0477701_214_636 | 140 |
| 4 | 3300047315 | Ga0495581_0213532 | Ga0495581_0213532_693_1115 | 140 |
| 5 | 3300003316 | rootH1_10011139 | rootH1_100111392 | 145 |
| 6 | 3300036647 | Ga0316582_0812123 | Ga0316582_0812123_169_627 | 147 |
| 7 | 3300048927 | Ga0496124_0342332 | Ga0496124_0342332_51_554 | 147 |
| 8 | 3300014326 | Ga0157380_10050148 | Ga0157380_100501484 | 148 |
| 9 | 3300009093 | Ga0105240_10259107 | Ga0105240_102591073 | 150 |
| 10 | 3300009551 | Ga0105238_10104264 | Ga0105238_101042643 | 150 |
| 11 | 3300005327 | Ga0070658_10502858 | Ga0070658_105028581 | 159 |
| 12 | 3300005543 | Ga0070672_100477862 | Ga0070672_1004778622 | 159 |
| 13 | 3300025940 | Ga0207691_10477695 | Ga0207691_104776952 | 159 |
| 14 | 3300053092 | Ga0500583_0078901 | Ga0500583_0078901_607_1125 | 159 |
| 15 | 3300005563 | Ga0068855_100004460 | Ga0068855_1000044607 | 160 |
| 16 | 3300036712 | Ga0316584_0083048 | Ga0316584_0083048_1022_1519 | 160 |
| 17 | 3300031548 | Ga0307408_100119841 | Ga0307408_1001198412 | 161 |
| 18 | 3300006948 | Ga0099826_10037321 | Ga0099826_100373212 | 162 |
| 19 | 3300032126 | Ga0307415_100792313 | Ga0307415_1007923132 | 162 |
| 20 | 3300037471 | Ga0395905_0748036 | Ga0395905_0748036_309_869 | 162 |
| 21 | 3300042007 | Ga0439449_0088831 | Ga0439449_0088831_567_1124 | 162 |
| 22 | 3300059424 | Ga0590075_044119 | Ga0590075_044119_79_636 | 162 |
| 23 | 3300005331 | Ga0070670_100130094 | Ga0070670_1001300941 | 163 |
| 24 | 3300005337 | Ga0070682_100423119 | Ga0070682_1004231191 | 163 |
| 25 | 3300005338 | Ga0068868_100448289 | Ga0068868_1004482892 | 163 |
| 26 | 3300005353 | Ga0070669_101244314 | Ga0070669_1012443141 | 163 |
| 27 | 3300005354 | Ga0070675_100902814 | Ga0070675_1009028141 | 163 |
| 28 | 3300005466 | Ga0070685_10465259 | Ga0070685_104652592 | 163 |
| 29 | 3300005544 | Ga0070686_100292858 | Ga0070686_1002928582 | 163 |
| 30 | 3300005548 | Ga0070665_100026693 | Ga0070665_1000266936 | 163 |
| 31 | 3300005548 | Ga0070665_100200303 | Ga0070665_1002003032 | 163 |
| 32 | 3300005564 | Ga0070664_100015641 | Ga0070664_1000156414 | 163 |
| 33 | 3300005577 | Ga0068857_100600129 | Ga0068857_1006001292 | 163 |
| 34 | 3300005617 | Ga0068859_100749193 | Ga0068859_1007491932 | 163 |
| 35 | 3300005719 | Ga0068861_100176092 | Ga0068861_1001760922 | 163 |
| 36 | 3300005719 | Ga0068861_100607621 | Ga0068861_1006076212 | 163 |
| 37 | 3300005840 | Ga0068870_10086096 | Ga0068870_100860962 | 163 |
| 38 | 3300005840 | Ga0068870_10147013 | Ga0068870_101470133 | 163 |
| 39 | 3300005844 | Ga0068862_100154458 | Ga0068862_1001544582 | 163 |
| 40 | 3300005844 | Ga0068862_100327460 | Ga0068862_1003274602 | 163 |
| 41 | 3300006931 | Ga0097620_100749120 | Ga0097620_1007491202 | 163 |
| 42 | 3300013308 | Ga0157375_11719139 | Ga0157375_117191391 | 163 |
| 43 | 3300025925 | Ga0207650_10092483 | Ga0207650_100924832 | 163 |
| 44 | 3300025932 | Ga0207690_10104171 | Ga0207690_101041713 | 163 |
| 45 | 3300025933 | Ga0207706_10339258 | Ga0207706_103392582 | 163 |
| 46 | 3300025934 | Ga0207686_10357637 | Ga0207686_103576372 | 163 |
| 47 | 3300025940 | Ga0207691_10292272 | Ga0207691_102922722 | 163 |
| 48 | 3300025945 | Ga0207679_10396857 | Ga0207679_103968572 | 163 |
| 49 | 3300025945 | Ga0207679_10580660 | Ga0207679_105806602 | 163 |
| 50 | 3300026075 | Ga0207708_10971680 | Ga0207708_109716802 | 163 |
| 51 | 3300026118 | Ga0207675_100103102 | Ga0207675_1001031023 | 163 |
| 52 | 3300026121 | Ga0207683_10270825 | Ga0207683_102708252 | 163 |
| 53 | 3300028379 | Ga0268266_10012525 | Ga0268266_100125257 | 163 |
| 54 | 3300028380 | Ga0268265_10120665 | Ga0268265_101206652 | 163 |
| 55 | 3300028380 | Ga0268265_10296736 | Ga0268265_102967363 | 163 |
| 56 | 3300031548 | Ga0307408_100298344 | Ga0307408_1002983442 | 163 |
| 57 | 3300031911 | Ga0307412_10392676 | Ga0307412_103926762 | 163 |
| 58 | 3300032005 | Ga0307411_10203459 | Ga0307411_102034592 | 163 |
| 59 | 3300041460 | Ga0451802_0496319 | Ga0451802_0496319_49_552 | 163 |
| 60 | 3300046460 | Ga0495638_0019850 | Ga0495638_0019850_212_715 | 163 |
| 61 | 3300046513 | Ga0495616_0045416 | Ga0495616_0045416_312_815 | 163 |
| 62 | 3300046519 | Ga0495632_0190911 | Ga0495632_0190911_134_697 | 163 |
| 63 | 3300046660 | Ga0495625_0015653 | Ga0495625_0015653_450_953 | 163 |
| 64 | 3300053134 | Ga0500658_0396633 | Ga0500658_0396633_19_582 | 163 |
| 65 | 3300005330 | Ga0070690_100406723 | Ga0070690_1004067232 | 164 |
| 66 | 3300005843 | Ga0068860_100217323 | Ga0068860_1002173232 | 164 |
| 67 | 3300006237 | Ga0097621_100192057 | Ga0097621_1001920573 | 164 |
| 68 | 3300009093 | Ga0105240_10001059 | Ga0105240_100010598 | 164 |
| 69 | 3300009093 | Ga0105240_10108436 | Ga0105240_101084363 | 164 |
| 70 | 3300009093 | Ga0105240_10148269 | Ga0105240_101482694 | 164 |
| 71 | 3300009101 | Ga0105247_10122147 | Ga0105247_101221473 | 164 |
| 72 | 3300009545 | Ga0105237_10054088 | Ga0105237_100540882 | 164 |
| 73 | 3300009545 | Ga0105237_10530997 | Ga0105237_105309972 | 164 |
| 74 | 3300010375 | Ga0105239_10031025 | Ga0105239_100310256 | 164 |
| 75 | 3300010375 | Ga0105239_11324358 | Ga0105239_113243582 | 164 |
| 76 | 3300013307 | Ga0157372_10127596 | Ga0157372_101275964 | 164 |
| 77 | 3300025900 | Ga0207710_10406539 | Ga0207710_104065391 | 164 |
| 78 | 3300025936 | Ga0207670_10122643 | Ga0207670_101226432 | 164 |
| 79 | 3300025942 | Ga0207689_10724305 | Ga0207689_107243052 | 164 |
| 80 | 3300025944 | Ga0207661_10090182 | Ga0207661_100901824 | 164 |
| 81 | 3300026041 | Ga0207639_10399180 | Ga0207639_103991802 | 164 |
| 82 | 3300028379 | Ga0268266_10465018 | Ga0268266_104650182 | 164 |
| 83 | 3300028381 | Ga0268264_10614521 | Ga0268264_106145212 | 164 |
| 84 | 3300031456 | Ga0307513_10010158 | Ga0307513_1001015812 | 164 |
| 85 | 3300031456 | Ga0307513_10131299 | Ga0307513_101312994 | 164 |
| 86 | 3300031456 | Ga0307513_10192564 | Ga0307513_101925642 | 164 |
| 87 | 3300032005 | Ga0307411_10511677 | Ga0307411_105116772 | 164 |
| 88 | 3300032126 | Ga0307415_100216645 | Ga0307415_1002166452 | 164 |
| 89 | 3300039450 | Ga0436363_0895754 | Ga0436363_0895754_254_748 | 164 |
| 90 | 3300041452 | Ga0451793_0118976 | Ga0451793_0118976_315_821 | 164 |
| 91 | 3300041458 | Ga0451798_0916510 | Ga0451798_0916510_1240_1746 | 164 |
| 92 | 3300044656 | Ga0466969_0001362 | Ga0466969_0001362_11761_12255 | 164 |
| 93 | 3300044658 | Ga0466972_0036588 | Ga0466972_0036588_683_1177 | 164 |
| 94 | 3300044684 | Ga0466966_0026246 | Ga0466966_0026246_1309_1803 | 164 |
| 95 | 3300046461 | Ga0495641_0063586 | Ga0495641_0063586_922_1428 | 164 |
| 96 | 3300049742 | Ga0501080_0183001 | Ga0501080_0183001_1072_1578 | 164 |
| 97 | 3300053118 | Ga0500594_0014664 | Ga0500594_0014664_323_889 | 164 |
| 98 | 3300053134 | Ga0500658_0095886 | Ga0500658_0095886_26_592 | 164 |
| 99 | 3300053156 | Ga0500622_0001768 | Ga0500622_0001768_15768_16337 | 164 |
| 100 | 3300053160 | Ga0500633_0064749 | Ga0500633_0064749_655_1221 | 164 |
| 101 | 3300001990 | JGI24737J22298_10202343 | JGI24737J22298_102023431 | 165 |
| 102 | 3300003316 | rootH1_10044715 | rootH1_100447153 | 165 |
| 103 | 3300003320 | rootH2_10170203 | rootH2_101702037 | 165 |
| 104 | 3300003322 | rootL2_10147116 | rootL2_101471163 | 165 |
| 105 | 3300003323 | rootH1_10044975 | rootH1_100449757 | 165 |
| 106 | 3300005331 | Ga0070670_100014751 | Ga0070670_1000147512 | 165 |
| 107 | 3300005335 | Ga0070666_10128110 | Ga0070666_101281102 | 165 |
| 108 | 3300005337 | Ga0070682_100255558 | Ga0070682_1002555582 | 165 |
| 109 | 3300005355 | Ga0070671_100470997 | Ga0070671_1004709972 | 165 |
| 110 | 3300005367 | Ga0070667_100153774 | Ga0070667_1001537742 | 165 |
| 111 | 3300005441 | Ga0070700_100254961 | Ga0070700_1002549612 | 165 |
| 112 | 3300005455 | Ga0070663_100100043 | Ga0070663_1001000432 | 165 |
| 113 | 3300005466 | Ga0070685_10688872 | Ga0070685_106888722 | 165 |
| 114 | 3300005539 | Ga0068853_100427694 | Ga0068853_1004276942 | 165 |
| 115 | 3300005548 | Ga0070665_100018269 | Ga0070665_1000182695 | 165 |
| 116 | 3300005577 | Ga0068857_100097074 | Ga0068857_1000970743 | 165 |
| 117 | 3300005578 | Ga0068854_100713753 | Ga0068854_1007137532 | 165 |
| 118 | 3300005614 | Ga0068856_100053312 | Ga0068856_1000533123 | 165 |
| 119 | 3300005617 | Ga0068859_100019340 | Ga0068859_1000193406 | 165 |
| 120 | 3300005618 | Ga0068864_100083624 | Ga0068864_1000836242 | 165 |
| 121 | 3300005719 | Ga0068861_100026201 | Ga0068861_1000262015 | 165 |
| 122 | 3300005841 | Ga0068863_100011745 | Ga0068863_1000117457 | 165 |
| 123 | 3300005842 | Ga0068858_100061164 | Ga0068858_1000611642 | 165 |
| 124 | 3300005843 | Ga0068860_100446538 | Ga0068860_1004465381 | 165 |
| 125 | 3300005844 | Ga0068862_101301914 | Ga0068862_1013019142 | 165 |
| 126 | 3300006237 | Ga0097621_100144460 | Ga0097621_1001444602 | 165 |
| 127 | 3300006358 | Ga0068871_100141161 | Ga0068871_1001411613 | 165 |
| 128 | 3300006931 | Ga0097620_100019340 | Ga0097620_1000193406 | 165 |
| 129 | 3300009101 | Ga0105247_10000558 | Ga0105247_1000055811 | 165 |
| 130 | 3300009101 | Ga0105247_10020368 | Ga0105247_100203682 | 165 |
| 131 | 3300009177 | Ga0105248_10041193 | Ga0105248_100411932 | 165 |
| 132 | 3300009177 | Ga0105248_10925351 | Ga0105248_109253511 | 165 |
| 133 | 3300009545 | Ga0105237_10220496 | Ga0105237_102204962 | 165 |
| 134 | 3300009551 | Ga0105238_10872594 | Ga0105238_108725942 | 165 |
| 135 | 3300010159 | Ga0099796_10101289 | Ga0099796_101012892 | 165 |
| 136 | 3300011119 | Ga0105246_10053653 | Ga0105246_100536534 | 165 |
| 137 | 3300013100 | Ga0157373_10522839 | Ga0157373_105228392 | 165 |
| 138 | 3300013296 | Ga0157374_10808941 | Ga0157374_108089412 | 165 |
| 139 | 3300013306 | Ga0163162_10068378 | Ga0163162_100683782 | 165 |
| 140 | 3300014325 | Ga0163163_10383653 | Ga0163163_103836532 | 165 |
| 141 | 3300014326 | Ga0157380_10437129 | Ga0157380_104371293 | 165 |
| 142 | 3300014968 | Ga0157379_10291537 | Ga0157379_102915371 | 165 |
| 143 | 3300014969 | Ga0157376_10090699 | Ga0157376_100906992 | 165 |
| 144 | 3300025903 | Ga0207680_10325703 | Ga0207680_103257032 | 165 |
| 145 | 3300025904 | Ga0207647_10032062 | Ga0207647_100320624 | 165 |
| 146 | 3300025911 | Ga0207654_10020098 | Ga0207654_100200983 | 165 |
| 147 | 3300025924 | Ga0207694_10219810 | Ga0207694_102198102 | 165 |
| 148 | 3300025925 | Ga0207650_10044645 | Ga0207650_100446452 | 165 |
| 149 | 3300025931 | Ga0207644_10025961 | Ga0207644_100259615 | 165 |
| 150 | 3300025941 | Ga0207711_10306933 | Ga0207711_103069332 | 165 |
| 151 | 3300025981 | Ga0207640_10424969 | Ga0207640_104249692 | 165 |
| 152 | 3300025986 | Ga0207658_10036219 | Ga0207658_100362195 | 165 |
| 153 | 3300026035 | Ga0207703_10003474 | Ga0207703_100034743 | 165 |
| 154 | 3300026078 | Ga0207702_10212225 | Ga0207702_102122252 | 165 |
| 155 | 3300026088 | Ga0207641_10001822 | Ga0207641_1000182219 | 165 |
| 156 | 3300026088 | Ga0207641_11245633 | Ga0207641_112456332 | 165 |
| 157 | 3300026116 | Ga0207674_10212247 | Ga0207674_102122473 | 165 |
| 158 | 3300026118 | Ga0207675_100014060 | Ga0207675_1000140604 | 165 |
| 159 | 3300028379 | Ga0268266_10145362 | Ga0268266_101453622 | 165 |
| 160 | 3300028379 | Ga0268266_10434641 | Ga0268266_104346412 | 165 |
| 161 | 3300028380 | Ga0268265_10781931 | Ga0268265_107819311 | 165 |
| 162 | 3300028381 | Ga0268264_10000736 | Ga0268264_100007365 | 165 |
| 163 | 3300030521 | Ga0307511_10180198 | Ga0307511_101801982 | 165 |
| 164 | 3300031507 | Ga0307509_10074603 | Ga0307509_100746032 | 165 |
| 165 | 3300031889 | Ga0326468_10052413 | Ga0326468_100524132 | 165 |
| 166 | 3300035113 | Ga0373936_0027648 | Ga0373936_0027648_947_1444 | 165 |
| 167 | 3300035114 | Ga0373939_0135206 | Ga0373939_0135206_273_782 | 165 |
| 168 | 3300035170 | Ga0373943_0362606 | Ga0373943_0362606_36_533 | 165 |
| 169 | 3300035695 | Ga0373927_0537207 | Ga0373927_0537207_233_751 | 165 |
| 170 | 3300036401 | Ga0373937_0031862 | Ga0373937_0031862_2265_2783 | 165 |
| 171 | 3300039437 | Ga0436365_0738787 | Ga0436365_0738787_4749_5246 | 165 |
| 172 | 3300039450 | Ga0436363_0853019 | Ga0436363_0853019_268_765 | 165 |
| 173 | 3300041491 | Ga0451833_1167638 | Ga0451833_1167638_131_640 | 165 |
| 174 | 3300044656 | Ga0466969_0000425 | Ga0466969_0000425_10886_11383 | 165 |
| 175 | 3300044684 | Ga0466966_0000285 | Ga0466966_0000285_27687_28184 | 165 |
| 176 | 3300044706 | Ga0466964_0000393 | Ga0466964_0000393_11607_12104 | 165 |
| 177 | 3300044719 | Ga0466971_0006649 | Ga0466971_0006649_2214_2711 | 165 |
| 178 | 3300044735 | Ga0466968_0051691 | Ga0466968_0051691_1180_1677 | 165 |
| 179 | 3300044765 | Ga0466970_0005912 | Ga0466970_0005912_3386_3883 | 165 |
| 180 | 3300044842 | Ga0466957_0069242 | Ga0466957_0069242_297_794 | 165 |
| 181 | 3300045049 | Ga0466959_0004362 | Ga0466959_0004362_5207_5704 | 165 |
| 182 | 3300045836 | Ga0466958_0179729 | Ga0466958_0179729_171_668 | 165 |
| 183 | 3300046457 | Ga0495590_0028526 | Ga0495590_0028526_594_1103 | 165 |
| 184 | 3300046519 | Ga0495632_0043607 | Ga0495632_0043607_113_622 | 165 |
| 185 | 3300046660 | Ga0495625_0067579 | Ga0495625_0067579_1089_1598 | 165 |
| 186 | 3300047443 | Ga0495687_014634 | Ga0495687_014634_1323_1820 | 165 |
| 187 | 3300048905 | Ga0496102_0007024 | Ga0496102_0007024_4753_5250 | 165 |
| 188 | 3300048907 | Ga0496104_0441728 | Ga0496104_0441728_273_770 | 165 |
| 189 | 3300048908 | Ga0496105_0116720 | Ga0496105_0116720_1467_1964 | 165 |
| 190 | 3300048910 | Ga0496107_1099798 | Ga0496107_1099798_26_523 | 165 |
| 191 | 3300048911 | Ga0496108_0387703 | Ga0496108_0387703_685_1182 | 165 |
| 192 | 3300048917 | Ga0496114_0158930 | Ga0496114_0158930_337_834 | 165 |
| 193 | 3300048918 | Ga0496115_0514037 | Ga0496115_0514037_273_770 | 165 |
| 194 | 3300048919 | Ga0496116_0006366 | Ga0496116_0006366_9080_9577 | 165 |
| 195 | 3300048920 | Ga0496117_0000099 | Ga0496117_0000099_37502_37999 | 165 |
| 196 | 3300048921 | Ga0496118_0000105 | Ga0496118_0000105_43671_44168 | 165 |
| 197 | 3300048922 | Ga0496119_0005649 | Ga0496119_0005649_2379_2876 | 165 |
| 198 | 3300048922 | Ga0496119_0022550 | Ga0496119_0022550_1090_1587 | 165 |
| 199 | 3300048923 | Ga0496120_0000612 | Ga0496120_0000612_51285_51782 | 165 |
| 200 | 3300048923 | Ga0496120_0057067 | Ga0496120_0057067_1568_2065 | 165 |
| 201 | 3300048924 | Ga0496121_0089235 | Ga0496121_0089235_1655_2152 | 165 |
| 202 | 3300048924 | Ga0496121_0140187 | Ga0496121_0140187_653_1150 | 165 |
| 203 | 3300048927 | Ga0496124_0199380 | Ga0496124_0199380_584_1081 | 165 |
| 204 | 3300048928 | Ga0496125_0000186 | Ga0496125_0000186_60686_61183 | 165 |
| 205 | 3300048928 | Ga0496125_0015680 | Ga0496125_0015680_1998_2495 | 165 |
| 206 | 3300048929 | Ga0496126_0045294 | Ga0496126_0045294_456_953 | 165 |
| 207 | 3300048929 | Ga0496126_0071161 | Ga0496126_0071161_1472_1969 | 165 |
| 208 | 3300048929 | Ga0496126_0881160 | Ga0496126_0881160_134_631 | 165 |
| 209 | 3300049460 | Ga0495682_0077389 | Ga0495682_0077389_46_543 | 165 |
| 210 | 3300053106 | Ga0500558_130287 | Ga0500558_130287_420_944 | 165 |
| 211 | 3300060346 | Ga0587111_0098526 | Ga0587111_0098526_200_709 | 165 |
| 212 | 3300061719 | Ga0466962_0000191 | Ga0466962_0000191_19240_19737 | 165 |
| 213 | 3300005289 | Ga0065704_10412331 | Ga0065704_104123312 | 166 |
| 214 | 3300005295 | Ga0065707_10085501 | Ga0065707_100855014 | 166 |
| 215 | 3300005467 | Ga0070706_100186170 | Ga0070706_1001861702 | 166 |
| 216 | 3300005548 | Ga0070665_100111566 | Ga0070665_1001115663 | 166 |
| 217 | 3300005719 | Ga0068861_100004230 | Ga0068861_1000042309 | 166 |
| 218 | 3300013306 | Ga0163162_10784906 | Ga0163162_107849062 | 166 |
| 219 | 3300025910 | Ga0207684_10268254 | Ga0207684_102682542 | 166 |
| 220 | 3300026118 | Ga0207675_100038984 | Ga0207675_1000389842 | 166 |
| 221 | 3300028379 | Ga0268266_10081277 | Ga0268266_100812773 | 166 |
| 222 | 3300033180 | Ga0307510_10041650 | Ga0307510_100416504 | 166 |
| 223 | 3300046460 | Ga0495638_0001279 | Ga0495638_0001279_13390_13944 | 166 |
| 224 | 3300046660 | Ga0495625_0001239 | Ga0495625_0001239_29857_30411 | 166 |
| 225 | 3300047472 | Ga0495686_0106791 | Ga0495686_0106791_223_786 | 166 |
| 226 | 3300048924 | Ga0496121_0038922 | Ga0496121_0038922_1903_2460 | 166 |
| 227 | 3300005535 | Ga0070684_100217258 | Ga0070684_1002172583 | 167 |
| 228 | 3300005563 | Ga0068855_100277140 | Ga0068855_1002771402 | 167 |
| 229 | 3300005616 | Ga0068852_100559421 | Ga0068852_1005594212 | 167 |
| 230 | 3300013105 | Ga0157369_10202208 | Ga0157369_102022082 | 167 |
| 231 | 3300025913 | Ga0207695_10033634 | Ga0207695_100336346 | 167 |
| 232 | 3300026067 | Ga0207678_10031411 | Ga0207678_100314112 | 167 |
| 233 | 3300026142 | Ga0207698_10832645 | Ga0207698_108326451 | 167 |
| 234 | 3300031665 | Ga0316575_10187787 | Ga0316575_101877872 | 169 |
| 235 | 3300031727 | Ga0316576_10070324 | Ga0316576_100703242 | 169 |
| 236 | 3300031733 | Ga0316577_10263115 | Ga0316577_102631152 | 169 |
| 237 | 3300035398 | Ga0316574_0729567 | Ga0316574_0729567_28_561 | 169 |
| 238 | 3300013307 | Ga0157372_10561362 | Ga0157372_105613622 | 172 |
| 239 | 3300014968 | Ga0157379_10391145 | Ga0157379_103911452 | 172 |
| 240 | 3300037853 | Ga0436364_1263693 | Ga0436364_1263693_379_897 | 172 |
| 241 | 3300039447 | Ga0436361_0407670 | Ga0436361_0407670_531_1049 | 172 |
| 242 | 3300046514 | Ga0495618_0172999 | Ga0495618_0172999_472_990 | 172 |
| 243 | 3300003203 | JGI25406J46586_10008835 | JGI25406J46586_100088354 | 173 |
| 244 | 3300003911 | JGI25405J52794_10038036 | JGI25405J52794_100380362 | 173 |
| 245 | 3300005334 | Ga0068869_100219047 | Ga0068869_1002190472 | 173 |
| 246 | 3300005434 | Ga0070709_10035320 | Ga0070709_100353203 | 173 |
| 247 | 3300005434 | Ga0070709_10310753 | Ga0070709_103107531 | 173 |
| 248 | 3300005435 | Ga0070714_100030181 | Ga0070714_1000301812 | 173 |
| 249 | 3300005444 | Ga0070694_100235170 | Ga0070694_1002351702 | 173 |
| 250 | 3300005456 | Ga0070678_101567056 | Ga0070678_1015670561 | 173 |
| 251 | 3300005458 | Ga0070681_10014820 | Ga0070681_100148205 | 173 |
| 252 | 3300005458 | Ga0070681_10026771 | Ga0070681_100267715 | 173 |
| 253 | 3300005518 | Ga0070699_100229044 | Ga0070699_1002290443 | 173 |
| 254 | 3300005535 | Ga0070684_100025558 | Ga0070684_1000255586 | 173 |
| 255 | 3300005539 | Ga0068853_101302920 | Ga0068853_1013029201 | 173 |
| 256 | 3300005545 | Ga0070695_100021238 | Ga0070695_1000212382 | 173 |
| 257 | 3300005548 | Ga0070665_100337746 | Ga0070665_1003377462 | 173 |
| 258 | 3300005563 | Ga0068855_100001037 | Ga0068855_10000103714 | 173 |
| 259 | 3300005719 | Ga0068861_100010429 | Ga0068861_1000104296 | 173 |
| 260 | 3300005842 | Ga0068858_100726675 | Ga0068858_1007266752 | 173 |
| 261 | 3300005844 | Ga0068862_100131523 | Ga0068862_1001315233 | 173 |
| 262 | 3300005937 | Ga0081455_10000057 | Ga0081455_1000005721 | 173 |
| 263 | 3300005985 | Ga0081539_10000038 | Ga0081539_10000038234 | 173 |
| 264 | 3300006237 | Ga0097621_100586124 | Ga0097621_1005861242 | 173 |
| 265 | 3300006237 | Ga0097621_101233752 | Ga0097621_1012337522 | 173 |
| 266 | 3300006358 | Ga0068871_100419146 | Ga0068871_1004191462 | 173 |
| 267 | 3300009093 | Ga0105240_10344273 | Ga0105240_103442732 | 173 |
| 268 | 3300009098 | Ga0105245_10761294 | Ga0105245_107612942 | 173 |
| 269 | 3300009551 | Ga0105238_11184384 | Ga0105238_111843841 | 173 |
| 270 | 3300009553 | Ga0105249_10212896 | Ga0105249_102128963 | 173 |
| 271 | 3300013105 | Ga0157369_10148671 | Ga0157369_101486714 | 173 |
| 272 | 3300014325 | Ga0163163_11233371 | Ga0163163_112333711 | 173 |
| 273 | 3300021377 | Ga0213874_10103921 | Ga0213874_101039212 | 173 |
| 274 | 3300025898 | Ga0207692_10148310 | Ga0207692_101483102 | 173 |
| 275 | 3300025906 | Ga0207699_10037269 | Ga0207699_100372693 | 173 |
| 276 | 3300025906 | Ga0207699_10090182 | Ga0207699_100901822 | 173 |
| 277 | 3300025912 | Ga0207707_10003173 | Ga0207707_100031735 | 173 |
| 278 | 3300025912 | Ga0207707_10028857 | Ga0207707_100288574 | 173 |
| 279 | 3300025913 | Ga0207695_10019323 | Ga0207695_100193237 | 173 |
| 280 | 3300025913 | Ga0207695_10083519 | Ga0207695_100835193 | 173 |
| 281 | 3300025913 | Ga0207695_10450806 | Ga0207695_104508062 | 173 |
| 282 | 3300025914 | Ga0207671_10170205 | Ga0207671_101702052 | 173 |
| 283 | 3300025917 | Ga0207660_10154717 | Ga0207660_101547173 | 173 |
| 284 | 3300025917 | Ga0207660_10195431 | Ga0207660_101954311 | 173 |
| 285 | 3300025929 | Ga0207664_10098002 | Ga0207664_100980022 | 173 |
| 286 | 3300025949 | Ga0207667_10016427 | Ga0207667_100164276 | 173 |
| 287 | 3300025961 | Ga0207712_10148861 | Ga0207712_101488612 | 173 |
| 288 | 3300026041 | Ga0207639_11516275 | Ga0207639_115162751 | 173 |
| 289 | 3300026118 | Ga0207675_100044390 | Ga0207675_1000443905 | 173 |
| 290 | 3300028379 | Ga0268266_10310554 | Ga0268266_103105542 | 173 |
| 291 | 3300028380 | Ga0268265_10117919 | Ga0268265_101179192 | 173 |
| 292 | 3300028381 | Ga0268264_10754254 | Ga0268264_107542542 | 173 |
| 293 | 3300028573 | Ga0265334_10225268 | Ga0265334_102252681 | 173 |
| 294 | 3300028800 | Ga0265338_10149324 | Ga0265338_101493243 | 173 |
| 295 | 3300031247 | Ga0265340_10031556 | Ga0265340_100315562 | 173 |
| 296 | 3300031250 | Ga0265331_10003719 | Ga0265331_100037194 | 173 |
| 297 | 3300031507 | Ga0307509_10288603 | Ga0307509_102886032 | 173 |
| 298 | 3300031730 | Ga0307516_10494927 | Ga0307516_104949272 | 173 |
| 299 | 3300035084 | Ga0373928_0118048 | Ga0373928_0118048_142_663 | 173 |
| 300 | 3300037853 | Ga0436364_0511138 | Ga0436364_0511138_193_714 | 173 |
| 301 | 3300037853 | Ga0436364_1433804 | Ga0436364_1433804_120_641 | 173 |
| 302 | 3300039438 | Ga0436360_1260296 | Ga0436360_1260296_540_1064 | 173 |
| 303 | 3300039447 | Ga0436361_1173204 | Ga0436361_1173204_669_1190 | 173 |
| 304 | 3300039450 | Ga0436363_0944041 | Ga0436363_0944041_860_1381 | 173 |
| 305 | 3300044693 | Ga0466961_0109819 | Ga0466961_0109819_245_766 | 173 |
| 306 | 3300044719 | Ga0466971_0129466 | Ga0466971_0129466_45_566 | 173 |
| 307 | 3300044735 | Ga0466968_0015970 | Ga0466968_0015970_1359_1880 | 173 |
| 308 | 3300044901 | Ga0466960_0030401 | Ga0466960_0030401_1823_2344 | 173 |
| 309 | 3300045049 | Ga0466959_0006207 | Ga0466959_0006207_7470_7991 | 173 |
| 310 | 3300045049 | Ga0466959_0042845 | Ga0466959_0042845_1366_1887 | 173 |
| 311 | 3300046519 | Ga0495632_0312520 | Ga0495632_0312520_111_632 | 173 |
| 312 | 3300048905 | Ga0496102_0015062 | Ga0496102_0015062_258_779 | 173 |
| 313 | 3300048921 | Ga0496118_0127266 | Ga0496118_0127266_816_1337 | 173 |
| 314 | 3300050513 | nmdc:mga0rr50_623801_c1 | nmdc:mga0rr50_623801_c1_209_730 | 173 |
| 315 | 3300053090 | Ga0500646_0153609 | Ga0500646_0153609_169_690 | 173 |
| 316 | 3300053092 | Ga0500583_0009635 | Ga0500583_0009635_757_1278 | 173 |
| 317 | 3300053098 | Ga0500650_0172459 | Ga0500650_0172459_311_832 | 173 |
| 318 | 3300053130 | Ga0500642_0274619 | Ga0500642_0274619_213_734 | 173 |
| 319 | 3300053133 | Ga0500655_004693 | Ga0500655_004693_1812_2333 | 173 |
| 320 | 3300053134 | Ga0500658_0028219 | Ga0500658_0028219_189_710 | 173 |
| 321 | 3300053139 | Ga0500568_0197249 | Ga0500568_0197249_163_684 | 173 |
| 322 | 3300053146 | Ga0500588_0004234 | Ga0500588_0004234_984_1505 | 173 |
| 323 | 3300053147 | Ga0500589_240320 | Ga0500589_240320_110_631 | 173 |
| 324 | 3300053158 | Ga0500627_0256826 | Ga0500627_0256826_63_584 | 173 |
| 325 | 2162886006 | SwRhRL3b_contig_177223 | SwRhRL3b_0834.00001610 | 174 |
| 326 | 2162886007 | SwRhRL2b_contig_2453594 | SwRhRL2b_0680.00000710 | 174 |
| 327 | 3300002070 | JGI24750J21931_1017657 | JGI24750J21931_10176571 | 174 |
| 328 | 3300005289 | Ga0065704_10183317 | Ga0065704_101833172 | 174 |
| 329 | 3300005295 | Ga0065707_10084023 | Ga0065707_100840236 | 174 |
| 330 | 3300005329 | Ga0070683_100748313 | Ga0070683_1007483132 | 174 |
| 331 | 3300005330 | Ga0070690_100016306 | Ga0070690_1000163065 | 174 |
| 332 | 3300005335 | Ga0070666_10000825 | Ga0070666_1000082510 | 174 |
| 333 | 3300005335 | Ga0070666_10001705 | Ga0070666_100017055 | 174 |
| 334 | 3300005335 | Ga0070666_10018124 | Ga0070666_100181244 | 174 |
| 335 | 3300005335 | Ga0070666_10037127 | Ga0070666_100371272 | 174 |
| 336 | 3300005336 | Ga0070680_100042749 | Ga0070680_1000427495 | 174 |
| 337 | 3300005336 | Ga0070680_100592338 | Ga0070680_1005923381 | 174 |
| 338 | 3300005337 | Ga0070682_100101279 | Ga0070682_1001012792 | 174 |
| 339 | 3300005338 | Ga0068868_100001561 | Ga0068868_10000156111 | 174 |
| 340 | 3300005338 | Ga0068868_100076840 | Ga0068868_1000768402 | 174 |
| 341 | 3300005341 | Ga0070691_10054009 | Ga0070691_100540093 | 174 |
| 342 | 3300005355 | Ga0070671_100010657 | Ga0070671_1000106573 | 174 |
| 343 | 3300005355 | Ga0070671_100048018 | Ga0070671_1000480183 | 174 |
| 344 | 3300005355 | Ga0070671_100048894 | Ga0070671_1000488942 | 174 |
| 345 | 3300005364 | Ga0070673_100013882 | Ga0070673_1000138826 | 174 |
| 346 | 3300005364 | Ga0070673_100116901 | Ga0070673_1001169013 | 174 |
| 347 | 3300005367 | Ga0070667_100000116 | Ga0070667_1000001169 | 174 |
| 348 | 3300005367 | Ga0070667_100000809 | Ga0070667_1000008094 | 174 |
| 349 | 3300005367 | Ga0070667_100009226 | Ga0070667_1000092265 | 174 |
| 350 | 3300005367 | Ga0070667_100018866 | Ga0070667_1000188664 | 174 |
| 351 | 3300005434 | Ga0070709_10459081 | Ga0070709_104590812 | 174 |
| 352 | 3300005435 | Ga0070714_100018526 | Ga0070714_1000185266 | 174 |
| 353 | 3300005435 | Ga0070714_100340839 | Ga0070714_1003408391 | 174 |
| 354 | 3300005436 | Ga0070713_100003775 | Ga0070713_1000037756 | 174 |
| 355 | 3300005436 | Ga0070713_100032889 | Ga0070713_1000328894 | 174 |
| 356 | 3300005436 | Ga0070713_100589677 | Ga0070713_1005896772 | 174 |
| 357 | 3300005439 | Ga0070711_100000263 | Ga0070711_10000026311 | 174 |
| 358 | 3300005439 | Ga0070711_101080016 | Ga0070711_1010800161 | 174 |
| 359 | 3300005456 | Ga0070678_100000129 | Ga0070678_10000012917 | 174 |
| 360 | 3300005458 | Ga0070681_10005968 | Ga0070681_100059689 | 174 |
| 361 | 3300005458 | Ga0070681_10020355 | Ga0070681_100203554 | 174 |
| 362 | 3300005458 | Ga0070681_10173564 | Ga0070681_101735643 | 174 |
| 363 | 3300005459 | Ga0068867_100502754 | Ga0068867_1005027542 | 174 |
| 364 | 3300005466 | Ga0070685_10898285 | Ga0070685_108982851 | 174 |
| 365 | 3300005530 | Ga0070679_100061132 | Ga0070679_1000611323 | 174 |
| 366 | 3300005530 | Ga0070679_100061488 | Ga0070679_1000614885 | 174 |
| 367 | 3300005539 | Ga0068853_100877703 | Ga0068853_1008777031 | 174 |
| 368 | 3300005544 | Ga0070686_100105361 | Ga0070686_1001053613 | 174 |
| 369 | 3300005546 | Ga0070696_100134617 | Ga0070696_1001346172 | 174 |
| 370 | 3300005546 | Ga0070696_100329379 | Ga0070696_1003293792 | 174 |
| 371 | 3300005548 | Ga0070665_100009357 | Ga0070665_1000093575 | 174 |
| 372 | 3300005548 | Ga0070665_100015218 | Ga0070665_1000152185 | 174 |
| 373 | 3300005548 | Ga0070665_100029947 | Ga0070665_1000299475 | 174 |
| 374 | 3300005548 | Ga0070665_100035039 | Ga0070665_1000350392 | 174 |
| 375 | 3300005549 | Ga0070704_100386752 | Ga0070704_1003867522 | 174 |
| 376 | 3300005563 | Ga0068855_100025633 | Ga0068855_1000256336 | 174 |
| 377 | 3300005563 | Ga0068855_100895068 | Ga0068855_1008950682 | 174 |
| 378 | 3300005563 | Ga0068855_100995790 | Ga0068855_1009957902 | 174 |
| 379 | 3300005614 | Ga0068856_100018387 | Ga0068856_1000183873 | 174 |
| 380 | 3300005617 | Ga0068859_100000196 | Ga0068859_10000019649 | 174 |
| 381 | 3300005617 | Ga0068859_100192899 | Ga0068859_1001928992 | 174 |
| 382 | 3300005617 | Ga0068859_102294138 | Ga0068859_1022941381 | 174 |
| 383 | 3300005618 | Ga0068864_100005637 | Ga0068864_1000056379 | 174 |
| 384 | 3300005718 | Ga0068866_10001569 | Ga0068866_100015696 | 174 |
| 385 | 3300005718 | Ga0068866_10028941 | Ga0068866_100289413 | 174 |
| 386 | 3300005719 | Ga0068861_100117764 | Ga0068861_1001177643 | 174 |
| 387 | 3300005834 | Ga0068851_10026731 | Ga0068851_100267313 | 174 |
| 388 | 3300005841 | Ga0068863_100001617 | Ga0068863_10000161720 | 174 |
| 389 | 3300005841 | Ga0068863_100064177 | Ga0068863_1000641774 | 174 |
| 390 | 3300005841 | Ga0068863_100196358 | Ga0068863_1001963582 | 174 |
| 391 | 3300005841 | Ga0068863_100274406 | Ga0068863_1002744062 | 174 |
| 392 | 3300005842 | Ga0068858_100004518 | Ga0068858_1000045186 | 174 |
| 393 | 3300005842 | Ga0068858_100006646 | Ga0068858_10000664610 | 174 |
| 394 | 3300005843 | Ga0068860_100005516 | Ga0068860_1000055161 | 174 |
| 395 | 3300005843 | Ga0068860_100006186 | Ga0068860_1000061865 | 174 |
| 396 | 3300005843 | Ga0068860_100015455 | Ga0068860_1000154555 | 174 |
| 397 | 3300005844 | Ga0068862_100460009 | Ga0068862_1004600093 | 174 |
| 398 | 3300006163 | Ga0070715_10006658 | Ga0070715_100066582 | 174 |
| 399 | 3300006163 | Ga0070715_10164930 | Ga0070715_101649302 | 174 |
| 400 | 3300006173 | Ga0070716_100027399 | Ga0070716_1000273992 | 174 |
| 401 | 3300006173 | Ga0070716_100133894 | Ga0070716_1001338943 | 174 |
| 402 | 3300006173 | Ga0070716_100595851 | Ga0070716_1005958512 | 174 |
| 403 | 3300006175 | Ga0070712_100006678 | Ga0070712_1000066786 | 174 |
| 404 | 3300006175 | Ga0070712_100070870 | Ga0070712_1000708702 | 174 |
| 405 | 3300006237 | Ga0097621_100006379 | Ga0097621_1000063796 | 174 |
| 406 | 3300006237 | Ga0097621_100012611 | Ga0097621_1000126116 | 174 |
| 407 | 3300006358 | Ga0068871_100023046 | Ga0068871_1000230466 | 174 |
| 408 | 3300006358 | Ga0068871_100103575 | Ga0068871_1001035753 | 174 |
| 409 | 3300006881 | Ga0068865_100023316 | Ga0068865_1000233162 | 174 |
| 410 | 3300006881 | Ga0068865_100092153 | Ga0068865_1000921532 | 174 |
| 411 | 3300006914 | Ga0075436_100057368 | Ga0075436_1000573682 | 174 |
| 412 | 3300006931 | Ga0097620_100000196 | Ga0097620_1000001965 | 174 |
| 413 | 3300006931 | Ga0097620_100192898 | Ga0097620_1001928983 | 174 |
| 414 | 3300006931 | Ga0097620_102295545 | Ga0097620_1022955451 | 174 |
| 415 | 3300007788 | Ga0099795_10000034 | Ga0099795_1000003426 | 174 |
| 416 | 3300009011 | Ga0105251_10293355 | Ga0105251_102933551 | 174 |
| 417 | 3300009093 | Ga0105240_10002425 | Ga0105240_100024259 | 174 |
| 418 | 3300009093 | Ga0105240_10264502 | Ga0105240_102645022 | 174 |
| 419 | 3300009093 | Ga0105240_10800909 | Ga0105240_108009092 | 174 |
| 420 | 3300009093 | Ga0105240_11432824 | Ga0105240_114328242 | 174 |
| 421 | 3300009098 | Ga0105245_10009828 | Ga0105245_100098285 | 174 |
| 422 | 3300009098 | Ga0105245_10011723 | Ga0105245_100117236 | 174 |
| 423 | 3300009101 | Ga0105247_10007392 | Ga0105247_100073922 | 174 |
| 424 | 3300009101 | Ga0105247_10029035 | Ga0105247_100290354 | 174 |
| 425 | 3300009101 | Ga0105247_10076456 | Ga0105247_100764563 | 174 |
| 426 | 3300009148 | Ga0105243_10457762 | Ga0105243_104577622 | 174 |
| 427 | 3300009174 | Ga0105241_10044123 | Ga0105241_100441232 | 174 |
| 428 | 3300009176 | Ga0105242_10001505 | Ga0105242_1000150511 | 174 |
| 429 | 3300009176 | Ga0105242_10006373 | Ga0105242_100063735 | 174 |
| 430 | 3300009177 | Ga0105248_10002404 | Ga0105248_1000240410 | 174 |
| 431 | 3300009177 | Ga0105248_10010045 | Ga0105248_100100454 | 174 |
| 432 | 3300009177 | Ga0105248_10010440 | Ga0105248_100104408 | 174 |
| 433 | 3300009177 | Ga0105248_10109384 | Ga0105248_101093845 | 174 |
| 434 | 3300009551 | Ga0105238_10000966 | Ga0105238_1000096627 | 174 |
| 435 | 3300009551 | Ga0105238_10027386 | Ga0105238_100273863 | 174 |
| 436 | 3300009551 | Ga0105238_10037863 | Ga0105238_100378632 | 174 |
| 437 | 3300009551 | Ga0105238_10415859 | Ga0105238_104158592 | 174 |
| 438 | 3300009553 | Ga0105249_10015712 | Ga0105249_100157126 | 174 |
| 439 | 3300009553 | Ga0105249_10108489 | Ga0105249_101084892 | 174 |
| 440 | 3300010159 | Ga0099796_10000042 | Ga0099796_1000004217 | 174 |
| 441 | 3300010375 | Ga0105239_10019609 | Ga0105239_100196096 | 174 |
| 442 | 3300010375 | Ga0105239_10317592 | Ga0105239_103175921 | 174 |
| 443 | 3300010375 | Ga0105239_11393335 | Ga0105239_113933351 | 174 |
| 444 | 3300013100 | Ga0157373_10135919 | Ga0157373_101359193 | 174 |
| 445 | 3300013104 | Ga0157370_10004643 | Ga0157370_1000464311 | 174 |
| 446 | 3300013105 | Ga0157369_10044939 | Ga0157369_100449392 | 174 |
| 447 | 3300013105 | Ga0157369_10203429 | Ga0157369_102034292 | 174 |
| 448 | 3300013296 | Ga0157374_10001326 | Ga0157374_100013265 | 174 |
| 449 | 3300013296 | Ga0157374_10014106 | Ga0157374_100141062 | 174 |
| 450 | 3300013297 | Ga0157378_10011814 | Ga0157378_100118145 | 174 |
| 451 | 3300013306 | Ga0163162_10026906 | Ga0163162_100269065 | 174 |
| 452 | 3300013306 | Ga0163162_10160254 | Ga0163162_101602542 | 174 |
| 453 | 3300013307 | Ga0157372_10138209 | Ga0157372_101382093 | 174 |
| 454 | 3300013307 | Ga0157372_10241175 | Ga0157372_102411753 | 174 |
| 455 | 3300013308 | Ga0157375_10062319 | Ga0157375_100623195 | 174 |
| 456 | 3300014968 | Ga0157379_10002640 | Ga0157379_100026405 | 174 |
| 457 | 3300014968 | Ga0157379_10034571 | Ga0157379_100345716 | 174 |
| 458 | 3300014968 | Ga0157379_10186075 | Ga0157379_101860751 | 174 |
| 459 | 3300014968 | Ga0157379_10326670 | Ga0157379_103266702 | 174 |
| 460 | 3300014969 | Ga0157376_10017747 | Ga0157376_100177475 | 174 |
| 461 | 3300014969 | Ga0157376_10047983 | Ga0157376_100479835 | 174 |
| 462 | 3300015262 | Ga0182007_10065640 | Ga0182007_100656402 | 174 |
| 463 | 3300017792 | Ga0163161_10117965 | Ga0163161_101179653 | 174 |
| 464 | 3300020081 | Ga0206354_10136901 | Ga0206354_101369012 | 174 |
| 465 | 3300020082 | Ga0206353_10401490 | Ga0206353_104014902 | 174 |
| 466 | 3300021361 | Ga0213872_10165784 | Ga0213872_101657842 | 174 |
| 467 | 3300021377 | Ga0213874_10008195 | Ga0213874_100081952 | 174 |
| 468 | 3300021384 | Ga0213876_10025709 | Ga0213876_100257092 | 174 |
| 469 | 3300021441 | Ga0213871_10023011 | Ga0213871_100230112 | 174 |
| 470 | 3300024227 | Ga0228598_1018914 | Ga0228598_10189141 | 174 |
| 471 | 3300025898 | Ga0207692_10782059 | Ga0207692_107820591 | 174 |
| 472 | 3300025899 | Ga0207642_10010284 | Ga0207642_100102844 | 174 |
| 473 | 3300025900 | Ga0207710_10000134 | Ga0207710_1000013446 | 174 |
| 474 | 3300025903 | Ga0207680_10022394 | Ga0207680_100223942 | 174 |
| 475 | 3300025903 | Ga0207680_10044186 | Ga0207680_100441864 | 174 |
| 476 | 3300025903 | Ga0207680_10150480 | Ga0207680_101504802 | 174 |
| 477 | 3300025906 | Ga0207699_10008419 | Ga0207699_100084192 | 174 |
| 478 | 3300025906 | Ga0207699_10009199 | Ga0207699_100091992 | 174 |
| 479 | 3300025909 | Ga0207705_10133043 | Ga0207705_101330433 | 174 |
| 480 | 3300025912 | Ga0207707_10001543 | Ga0207707_1000154313 | 174 |
| 481 | 3300025912 | Ga0207707_10051661 | Ga0207707_100516613 | 174 |
| 482 | 3300025912 | Ga0207707_10067384 | Ga0207707_100673844 | 174 |
| 483 | 3300025912 | Ga0207707_10083596 | Ga0207707_100835964 | 174 |
| 484 | 3300025912 | Ga0207707_10088373 | Ga0207707_100883733 | 174 |
| 485 | 3300025913 | Ga0207695_10016760 | Ga0207695_100167606 | 174 |
| 486 | 3300025913 | Ga0207695_10056194 | Ga0207695_100561943 | 174 |
| 487 | 3300025913 | Ga0207695_10508252 | Ga0207695_105082521 | 174 |
| 488 | 3300025913 | Ga0207695_10897266 | Ga0207695_108972661 | 174 |
| 489 | 3300025914 | Ga0207671_10251384 | Ga0207671_102513843 | 174 |
| 490 | 3300025914 | Ga0207671_11065719 | Ga0207671_110657191 | 174 |
| 491 | 3300025915 | Ga0207693_10000060 | Ga0207693_1000006068 | 174 |
| 492 | 3300025916 | Ga0207663_10095510 | Ga0207663_100955103 | 174 |
| 493 | 3300025916 | Ga0207663_10214000 | Ga0207663_102140002 | 174 |
| 494 | 3300025916 | Ga0207663_10914313 | Ga0207663_109143131 | 174 |
| 495 | 3300025917 | Ga0207660_10008463 | Ga0207660_100084636 | 174 |
| 496 | 3300025917 | Ga0207660_10081294 | Ga0207660_100812943 | 174 |
| 497 | 3300025919 | Ga0207657_10158674 | Ga0207657_101586742 | 174 |
| 498 | 3300025920 | Ga0207649_10074366 | Ga0207649_100743663 | 174 |
| 499 | 3300025921 | Ga0207652_10004353 | Ga0207652_100043534 | 174 |
| 500 | 3300025921 | Ga0207652_10088628 | Ga0207652_100886283 | 174 |
| 501 | 3300025924 | Ga0207694_10007297 | Ga0207694_100072976 | 174 |
| 502 | 3300025924 | Ga0207694_10177420 | Ga0207694_101774202 | 174 |
| 503 | 3300025924 | Ga0207694_10200503 | Ga0207694_102005032 | 174 |
| 504 | 3300025927 | Ga0207687_10020018 | Ga0207687_100200184 | 174 |
| 505 | 3300025928 | Ga0207700_10036854 | Ga0207700_100368544 | 174 |
| 506 | 3300025928 | Ga0207700_10107088 | Ga0207700_101070882 | 174 |
| 507 | 3300025928 | Ga0207700_10427089 | Ga0207700_104270892 | 174 |
| 508 | 3300025928 | Ga0207700_10599524 | Ga0207700_105995242 | 174 |
| 509 | 3300025929 | Ga0207664_10026898 | Ga0207664_100268985 | 174 |
| 510 | 3300025929 | Ga0207664_10303019 | Ga0207664_103030192 | 174 |
| 511 | 3300025931 | Ga0207644_10028162 | Ga0207644_100281624 | 174 |
| 512 | 3300025931 | Ga0207644_10451303 | Ga0207644_104513032 | 174 |
| 513 | 3300025931 | Ga0207644_10624763 | Ga0207644_106247632 | 174 |
| 514 | 3300025933 | Ga0207706_10303335 | Ga0207706_103033351 | 174 |
| 515 | 3300025934 | Ga0207686_10029965 | Ga0207686_100299654 | 174 |
| 516 | 3300025934 | Ga0207686_10220486 | Ga0207686_102204862 | 174 |
| 517 | 3300025935 | Ga0207709_10812924 | Ga0207709_108129241 | 174 |
| 518 | 3300025937 | Ga0207669_10577357 | Ga0207669_105773571 | 174 |
| 519 | 3300025938 | Ga0207704_10010187 | Ga0207704_100101872 | 174 |
| 520 | 3300025939 | Ga0207665_10013127 | Ga0207665_100131273 | 174 |
| 521 | 3300025939 | Ga0207665_10062406 | Ga0207665_100624062 | 174 |
| 522 | 3300025939 | Ga0207665_10212608 | Ga0207665_102126082 | 174 |
| 523 | 3300025941 | Ga0207711_10016352 | Ga0207711_100163524 | 174 |
| 524 | 3300025941 | Ga0207711_10033562 | Ga0207711_100335624 | 174 |
| 525 | 3300025941 | Ga0207711_10264937 | Ga0207711_102649373 | 174 |
| 526 | 3300025941 | Ga0207711_10611543 | Ga0207711_106115432 | 174 |
| 527 | 3300025941 | Ga0207711_10682763 | Ga0207711_106827632 | 174 |
| 528 | 3300025942 | Ga0207689_10705373 | Ga0207689_107053731 | 174 |
| 529 | 3300025944 | Ga0207661_10609646 | Ga0207661_106096461 | 174 |
| 530 | 3300025949 | Ga0207667_10100314 | Ga0207667_101003144 | 174 |
| 531 | 3300025949 | Ga0207667_10799060 | Ga0207667_107990602 | 174 |
| 532 | 3300025960 | Ga0207651_10103967 | Ga0207651_101039673 | 174 |
| 533 | 3300025961 | Ga0207712_10073839 | Ga0207712_100738393 | 174 |
| 534 | 3300025986 | Ga0207658_10000746 | Ga0207658_100007469 | 174 |
| 535 | 3300025986 | Ga0207658_10032600 | Ga0207658_100326005 | 174 |
| 536 | 3300025986 | Ga0207658_10035725 | Ga0207658_100357252 | 174 |
| 537 | 3300026023 | Ga0207677_10355308 | Ga0207677_103553082 | 174 |
| 538 | 3300026035 | Ga0207703_10006491 | Ga0207703_100064918 | 174 |
| 539 | 3300026035 | Ga0207703_10130641 | Ga0207703_101306412 | 174 |
| 540 | 3300026035 | Ga0207703_10643681 | Ga0207703_106436812 | 174 |
| 541 | 3300026041 | Ga0207639_10823011 | Ga0207639_108230111 | 174 |
| 542 | 3300026078 | Ga0207702_10109134 | Ga0207702_101091342 | 174 |
| 543 | 3300026088 | Ga0207641_10032206 | Ga0207641_100322064 | 174 |
| 544 | 3300026088 | Ga0207641_10332765 | Ga0207641_103327652 | 174 |
| 545 | 3300026088 | Ga0207641_11744600 | Ga0207641_117446002 | 174 |
| 546 | 3300026089 | Ga0207648_10427578 | Ga0207648_104275782 | 174 |
| 547 | 3300026089 | Ga0207648_10584002 | Ga0207648_105840022 | 174 |
| 548 | 3300026118 | Ga0207675_100073376 | Ga0207675_1000733763 | 174 |
| 549 | 3300026121 | Ga0207683_10000725 | Ga0207683_1000072517 | 174 |
| 550 | 3300027512 | Ga0209179_1000027 | Ga0209179_100002713 | 174 |
| 551 | 3300028379 | Ga0268266_10004065 | Ga0268266_100040656 | 174 |
| 552 | 3300028379 | Ga0268266_10028183 | Ga0268266_100281836 | 174 |
| 553 | 3300028379 | Ga0268266_10059617 | Ga0268266_100596175 | 174 |
| 554 | 3300028380 | Ga0268265_10977123 | Ga0268265_109771232 | 174 |
| 555 | 3300028381 | Ga0268264_10287304 | Ga0268264_102873042 | 174 |
| 556 | 3300028563 | Ga0265319_1029612 | Ga0265319_10296122 | 174 |
| 557 | 3300028577 | Ga0265318_10001026 | Ga0265318_100010268 | 174 |
| 558 | 3300030521 | Ga0307511_10000205 | Ga0307511_1000020519 | 174 |
| 559 | 3300030521 | Ga0307511_10114181 | Ga0307511_101141813 | 174 |
| 560 | 3300031235 | Ga0265330_10003872 | Ga0265330_100038724 | 174 |
| 561 | 3300031238 | Ga0265332_10003323 | Ga0265332_100033236 | 174 |
| 562 | 3300031242 | Ga0265329_10001089 | Ga0265329_100010895 | 174 |
| 563 | 3300031249 | Ga0265339_10049675 | Ga0265339_100496753 | 174 |
| 564 | 3300031250 | Ga0265331_10002553 | Ga0265331_100025535 | 174 |
| 565 | 3300031344 | Ga0265316_10008890 | Ga0265316_100088906 | 174 |
| 566 | 3300031507 | Ga0307509_10000167 | Ga0307509_1000016785 | 174 |
| 567 | 3300031711 | Ga0265314_10002268 | Ga0265314_100022687 | 174 |
| 568 | 3300033180 | Ga0307510_10000009 | Ga0307510_10000009183 | 174 |
| 569 | 3300035113 | Ga0373936_0016115 | Ga0373936_0016115_993_1517 | 174 |
| 570 | 3300035118 | Ga0373954_0108224 | Ga0373954_0108224_492_1016 | 174 |
| 571 | 3300035118 | Ga0373954_0199791 | Ga0373954_0199791_211_735 | 174 |
| 572 | 3300035120 | Ga0373957_0219378 | Ga0373957_0219378_145_669 | 174 |
| 573 | 3300035172 | Ga0373955_0038433 | Ga0373955_0038433_1305_1829 | 174 |
| 574 | 3300035172 | Ga0373955_0044023 | Ga0373955_0044023_825_1349 | 174 |
| 575 | 3300035172 | Ga0373955_0609909 | Ga0373955_0609909_26_550 | 174 |
| 576 | 3300035695 | Ga0373927_0049029 | Ga0373927_0049029_576_1100 | 174 |
| 577 | 3300035724 | Ga0373933_0011477 | Ga0373933_0011477_1672_2196 | 174 |
| 578 | 3300035725 | Ga0373947_0060514 | Ga0373947_0060514_1130_1654 | 174 |
| 579 | 3300036401 | Ga0373937_0001197 | Ga0373937_0001197_14084_14608 | 174 |
| 580 | 3300036401 | Ga0373937_0041078 | Ga0373937_0041078_1907_2431 | 174 |
| 581 | 3300037068 | Ga0373925_0247830 | Ga0373925_0247830_226_750 | 174 |
| 582 | 3300039438 | Ga0436360_0281290 | Ga0436360_0281290_454_978 | 174 |
| 583 | 3300039447 | Ga0436361_1163383 | Ga0436361_1163383_776_1300 | 174 |
| 584 | 3300039450 | Ga0436363_0138643 | Ga0436363_0138643_1851_2375 | 174 |
| 585 | 3300039450 | Ga0436363_1121322 | Ga0436363_1121322_5337_5861 | 174 |
| 586 | 3300039450 | Ga0436363_1643864 | Ga0436363_1643864_67_591 | 174 |
| 587 | 3300046472 | Ga0495580_0062193 | Ga0495580_0062193_406_930 | 174 |
| 588 | 3300046472 | Ga0495580_0147970 | Ga0495580_0147970_723_1247 | 174 |
| 589 | 3300046472 | Ga0495580_0313653 | Ga0495580_0313653_125_649 | 174 |
| 590 | 3300046492 | Ga0495585_0331932 | Ga0495585_0331932_114_644 | 174 |
| 591 | 3300046506 | Ga0495583_0060331 | Ga0495583_0060331_1081_1605 | 174 |
| 592 | 3300046516 | Ga0495628_0071937 | Ga0495628_0071937_1439_1963 | 174 |
| 593 | 3300046517 | Ga0495630_0392822 | Ga0495630_0392822_397_921 | 174 |
| 594 | 3300046533 | Ga0495640_0292042 | Ga0495640_0292042_399_923 | 174 |
| 595 | 3300046536 | Ga0495587_0045287 | Ga0495587_0045287_1461_1985 | 174 |
| 596 | 3300046543 | Ga0495645_0379916 | Ga0495645_0379916_44_568 | 174 |
| 597 | 3300046675 | Ga0495657_0295280 | Ga0495657_0295280_243_767 | 174 |
| 598 | 3300046679 | Ga0495623_0110944 | Ga0495623_0110944_762_1286 | 174 |
| 599 | 3300046683 | Ga0495658_0307157 | Ga0495658_0307157_262_807 | 174 |
| 600 | 3300046809 | Ga0495600_0305618 | Ga0495600_0305618_93_617 | 174 |
| 601 | 3300047444 | Ga0495675_0127150 | Ga0495675_0127150_1017_1541 | 174 |
| 602 | 3300047673 | Ga0495593_0501870 | Ga0495593_0501870_50_574 | 174 |
| 603 | 3300048088 | Ga0495602_0106535 | Ga0495602_0106535_910_1434 | 174 |
| 604 | 3300048903 | Ga0496100_1074130 | Ga0496100_1074130_16_561 | 174 |
| 605 | 3300048904 | Ga0496101_0002164 | Ga0496101_0002164_2814_3338 | 174 |
| 606 | 3300048905 | Ga0496102_0067437 | Ga0496102_0067437_1587_2111 | 174 |
| 607 | 3300048905 | Ga0496102_0088319 | Ga0496102_0088319_2042_2566 | 174 |
| 608 | 3300048906 | Ga0496103_0100853 | Ga0496103_0100853_1139_1663 | 174 |
| 609 | 3300048907 | Ga0496104_0196072 | Ga0496104_0196072_789_1313 | 174 |
| 610 | 3300048908 | Ga0496105_0011414 | Ga0496105_0011414_3059_3583 | 174 |
| 611 | 3300048908 | Ga0496105_0020408 | Ga0496105_0020408_3128_3673 | 174 |
| 612 | 3300048909 | Ga0496106_0340156 | Ga0496106_0340156_153_677 | 174 |
| 613 | 3300048909 | Ga0496106_0508579 | Ga0496106_0508579_365_889 | 174 |
| 614 | 3300048910 | Ga0496107_0009320 | Ga0496107_0009320_4631_5155 | 174 |
| 615 | 3300048911 | Ga0496108_0006755 | Ga0496108_0006755_1644_2168 | 174 |
| 616 | 3300048911 | Ga0496108_0124832 | Ga0496108_0124832_1522_2067 | 174 |
| 617 | 3300048912 | Ga0496109_0001391 | Ga0496109_0001391_13262_13786 | 174 |
| 618 | 3300048912 | Ga0496109_0030449 | Ga0496109_0030449_4085_4630 | 174 |
| 619 | 3300048913 | Ga0496110_0005095 | Ga0496110_0005095_2626_3150 | 174 |
| 620 | 3300048913 | Ga0496110_0147271 | Ga0496110_0147271_418_963 | 174 |
| 621 | 3300048914 | Ga0496111_0003948 | Ga0496111_0003948_98_622 | 174 |
| 622 | 3300048915 | Ga0496112_0075507 | Ga0496112_0075507_241_765 | 174 |
| 623 | 3300048916 | Ga0496113_0014370 | Ga0496113_0014370_3271_3795 | 174 |
| 624 | 3300048917 | Ga0496114_0130769 | Ga0496114_0130769_183_707 | 174 |
| 625 | 3300048918 | Ga0496115_0177255 | Ga0496115_0177255_1034_1558 | 174 |
| 626 | 3300048924 | Ga0496121_0000772 | Ga0496121_0000772_28811_29335 | 174 |
| 627 | 3300048928 | Ga0496125_0001407 | Ga0496125_0001407_5429_5953 | 174 |
| 628 | 3300050514 | nmdc:mga08x19_54419_c1 | nmdc:mga08x19_54419_c1_1068_1592 | 174 |
| 629 | 3300053077 | Ga0495601_0290053 | Ga0495601_0290053_454_978 | 174 |
| 630 | 3300053104 | Ga0500556_0000174 | Ga0500556_0000174_1863_2387 | 174 |
| 631 | 3300053136 | Ga0500559_0043615 | Ga0500559_0043615_593_1117 | 174 |
| 632 | 3300053163 | Ga0500639_018575 | Ga0500639_018575_1911_2435 | 174 |
| 633 | 3300053735 | Ga0500596_058780 | Ga0500596_058780_50_574 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i0i-assembly1.cif.gz_A | analysis of an invariant aspartic acid in hprts-glutamine mutant | 0.8228 | 127 | 160 |
| 4rqa-assembly1.cif.gz_A | crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group) | 0.8102 | 125 | 160 |
| 7cmj-assembly1.cif.gz_A-2 | crystal structure of l.donovani hypoxanthine-guanine phosphoribosyl transferase (hgprt) | 0.7933 | 122 | 160 |
| 1i13-assembly1.cif.gz_A | analysis of an invariant aspartic acid in hprts-alanine mutant | 0.7927 | 122 | 160 |
| 4rqb-assembly1.cif.gz_A | crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (tetragonal space group) | 0.7842 | 122 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8ILM5_15_201_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7311 | 122 | 159 | 3.30.420.40 |
| af_P47117_6_208_3.60.160.10 | Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 | 0.7274 | 122 | 159 | 3.60.160.10 |
| 4icsB01 | Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) | 0.719 | 126 | 160 | 3.40.1830.10 |
| 3n05B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7142 | 121 | 161 | 3.40.50.620 |
| af_Q54Z95_1_113_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.6585 | 119 | 164 | 3.80.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534ANQ5-F1-model_v4 | Uncharacterized protein | 0.8423 | 73 | 174 |
|
| AF-A0A534ANQ5-F1-model_v4 | Uncharacterized protein | 0.8347 | 73 | 174 |
|
| AF-X1GAR8-F1-model_v4 | Uncharacterized protein | 0.7713 | 55 | 163 |
|
| AF-A0A3E0X334-F1-model_v4 | Biopolymer transporter ExbD | 0.7617 | 44 | 170 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A1G7D1J3-F1-model_v4 | BlaR1 peptidase M56 | 0.7595 | 69 | 164 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar