F471091

General Info

Members Datasets Scaffolds Average Seq Length
633 309 634 172

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10465018|Ga0268266_104650182
Length 189
Sequence MINRIKRHRSRQKGGAEAGGHMTLVPFIDMLMILTVFLLVHNSDTDILPNTKAISIPASLSDKKPRPSVVVMITKEDLLVDGKAIAKVADVISSQESVIQPLKVALQGQADIVLADAAKQEIKDREVTIMGDKNTPYSVLRKIMATCTDADYGKVSLAVVEREGANKVPPSASGRTAAFNASPSNAVGS

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
112 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
219 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
220 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
233 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
290 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
291 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
301 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
302 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
303 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
304 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
305 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
306 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
307 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0.16
Rhizoplane 5.21
Rhizosphere 83.1
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_177223 2162886006 Unclassified 948
2 SwRhRL2b_contig_2453594 2162886007 Unclassified 1049
3 JGI24737J22298_10202343 3300001990 Unclassified 586
4 JGI24750J21931_1017657 3300002070 Bacteria 977
5 JGI25406J46586_10008835 3300003203 Bacteria 4537
6 rootH1_10011139 3300003316 Unclassified 1531
7 rootH1_10044715 3300003316 Bacteria 6276
8 rootH1_10044715 3300003323 Bacteria 1594
9 rootH2_10170203 3300003320 Unclassified 4199
10 rootL2_10147116 3300003322 Bacteria 5980
11 rootH1_10044975 3300003323 Bacteria 5612
12 JGI25405J52794_10038036 3300003911 Bacteria 1012
13 Ga0065704_10183317 3300005289 Unclassified 1226
14 Ga0065704_10412331 3300005289 Unclassified 740
15 Ga0065707_10084023 3300005295 Bacteria 7813
16 Ga0065707_10085501 3300005295 Bacteria 6105
17 Ga0070658_10502858 3300005327 Bacteria 1047
18 Ga0070683_100748313 3300005329 Unclassified 936
19 Ga0070690_100016306 3300005330 Bacteria 4447
20 Ga0070690_100406723 3300005330 Bacteria 1001
21 Ga0070670_100014751 3300005331 Bacteria 6709
22 Ga0070670_100130094 3300005331 Unclassified 2173
23 Ga0068869_100219047 3300005334 Unclassified 1508
24 Ga0070666_10000825 3300005335 Bacteria 18805
25 Ga0070666_10001705 3300005335 Bacteria 13402
26 Ga0070666_10018124 3300005335 Bacteria 4522
27 Ga0070666_10037127 3300005335 Unclassified 3238
28 Ga0070666_10128110 3300005335 Unclassified 1762
29 Ga0070680_100042749 3300005336 Unclassified 3678
30 Ga0070680_100592338 3300005336 Bacteria 951
31 Ga0070682_100101279 3300005337 Unclassified 1902
32 Ga0070682_100255558 3300005337 Bacteria 1265
33 Ga0070682_100423119 3300005337 Unclassified 1013
34 Ga0068868_100001561 3300005338 Bacteria 15635
35 Ga0068868_100076840 3300005338 Bacteria 2670
36 Ga0068868_100448289 3300005338 Bacteria 1122
37 Ga0070691_10054009 3300005341 Bacteria 1923
38 Ga0070669_101244314 3300005353 Bacteria 644
39 Ga0070675_100902814 3300005354 Unclassified 810
40 Ga0070671_100010657 3300005355 Bacteria 7378
41 Ga0070671_100048018 3300005355 Bacteria 3549
42 Ga0070671_100048894 3300005355 Bacteria 3518
43 Ga0070671_100470997 3300005355 Unclassified 1079
44 Ga0070673_100013882 3300005364 Bacteria 5591
45 Ga0070673_100116901 3300005364 Unclassified 2219
46 Ga0070667_100000116 3300005367 Bacteria 102137
47 Ga0070667_100000809 3300005367 Bacteria 29230
48 Ga0070667_100009226 3300005367 Bacteria 8170
49 Ga0070667_100018866 3300005367 Bacteria 5719
50 Ga0070667_100153774 3300005367 Unclassified 2022
51 Ga0070709_10035320 3300005434 Bacteria 3037
52 Ga0070709_10310753 3300005434 Unclassified 1154
53 Ga0070709_10459081 3300005434 Bacteria 961
54 Ga0070714_100018526 3300005435 Bacteria 5658
55 Ga0070714_100030181 3300005435 Bacteria 4511
56 Ga0070714_100340839 3300005435 Bacteria 1406
57 Ga0070713_100003775 3300005436 Bacteria 10029
58 Ga0070713_100032889 3300005436 Bacteria 4148
59 Ga0070713_100589677 3300005436 Bacteria 1055
60 Ga0070711_100000263 3300005439 Bacteria 26963
61 Ga0070711_101080016 3300005439 Bacteria 691
62 Ga0070700_100254961 3300005441 Unclassified 1260
63 Ga0070694_100235170 3300005444 Unclassified 1380
64 Ga0070663_100100043 3300005455 Unclassified 2162
65 Ga0070678_100000129 3300005456 Bacteria 30238
66 Ga0070678_101567056 3300005456 Bacteria 618
67 Ga0070681_10005968 3300005458 Bacteria 11796
68 Ga0070681_10014820 3300005458 Bacteria 7752
69 Ga0070681_10020355 3300005458 Bacteria 6650
70 Ga0070681_10026771 3300005458 Bacteria 5798
71 Ga0070681_10173564 3300005458 Bacteria 2077
72 Ga0068867_100502754 3300005459 Bacteria 1042
73 Ga0070685_10465259 3300005466 Unclassified 888
74 Ga0070685_10688872 3300005466 Unclassified 744
75 Ga0070685_10898285 3300005466 Bacteria 659
76 Ga0070706_100186170 3300005467 Bacteria 1940
77 Ga0070699_100229044 3300005518 Bacteria 1657
78 Ga0070679_100061132 3300005530 Bacteria 3755
79 Ga0070679_100061488 3300005530 Unclassified 3743
80 Ga0070684_100025558 3300005535 Unclassified 4966
81 Ga0070684_100217258 3300005535 Unclassified 1744
82 Ga0068853_100427694 3300005539 Unclassified 1243
83 Ga0068853_100877703 3300005539 Bacteria 861
84 Ga0068853_101302920 3300005539 Bacteria 702
85 Ga0070672_100477862 3300005543 Bacteria 1076
86 Ga0070686_100105361 3300005544 Bacteria 1912
87 Ga0070686_100292858 3300005544 Bacteria 1205
88 Ga0070695_100021238 3300005545 Bacteria 3970
89 Ga0070696_100134617 3300005546 Bacteria 1801
90 Ga0070696_100329379 3300005546 Bacteria 1177
91 Ga0070665_100009357 3300005548 Bacteria 9915
92 Ga0070665_100015218 3300005548 Bacteria 7723
93 Ga0070665_100018269 3300005548 Bacteria 7033
94 Ga0070665_100026693 3300005548 Bacteria 5815
95 Ga0070665_100029947 3300005548 Bacteria 5478
96 Ga0070665_100035039 3300005548 Bacteria 5048
97 Ga0070665_100111566 3300005548 Bacteria 2737
98 Ga0070665_100200303 3300005548 Bacteria 1997
99 Ga0070665_100337746 3300005548 Bacteria 1511
100 Ga0070704_100386752 3300005549 Bacteria 1190
101 Ga0068855_100001037 3300005563 Bacteria 34574
102 Ga0068855_100004460 3300005563 Bacteria 17110
103 Ga0068855_100025633 3300005563 Bacteria 7053
104 Ga0068855_100277140 3300005563 Bacteria 1863
105 Ga0068855_100895068 3300005563 Bacteria 938
106 Ga0068855_100995790 3300005563 Bacteria 881
107 Ga0070664_100015641 3300005564 Bacteria 6208
108 Ga0068857_100097074 3300005577 Unclassified 2642
109 Ga0068857_100600129 3300005577 Bacteria 1041
110 Ga0068854_100713753 3300005578 Unclassified 867
111 Ga0068856_100018387 3300005614 Bacteria 6773
112 Ga0068856_100053312 3300005614 Unclassified 3987
113 Ga0068852_100559421 3300005616 Unclassified 1145
114 Ga0068859_100000196 3300005617 Bacteria 59010
115 Ga0068859_100019340 3300005617 Bacteria 6843
116 Ga0068859_100192899 3300005617 Bacteria 2121
117 Ga0068859_100749193 3300005617 Bacteria 1066
118 Ga0068859_102294138 3300005617 Unclassified 595
119 Ga0068864_100005637 3300005618 Bacteria 10263
120 Ga0068864_100083624 3300005618 Unclassified 2803
121 Ga0068866_10001569 3300005718 Bacteria 9713
122 Ga0068866_10028941 3300005718 Unclassified 2644
123 Ga0068861_100004230 3300005719 Bacteria 9631
124 Ga0068861_100010429 3300005719 Bacteria 6451
125 Ga0068861_100026201 3300005719 Bacteria 4237
126 Ga0068861_100117764 3300005719 Bacteria 2138
127 Ga0068861_100176092 3300005719 Bacteria 1776
128 Ga0068861_100607621 3300005719 Unclassified 1005
129 Ga0068851_10026731 3300005834 Bacteria 2839
130 Ga0068870_10086096 3300005840 Bacteria 1748
131 Ga0068870_10147013 3300005840 Unclassified 1384
132 Ga0068863_100001617 3300005841 Bacteria 22268
133 Ga0068863_100011745 3300005841 Bacteria 8470
134 Ga0068863_100064177 3300005841 Bacteria 3473
135 Ga0068863_100196358 3300005841 Bacteria 1940
136 Ga0068863_100274406 3300005841 Bacteria 1633
137 Ga0068858_100004518 3300005842 Bacteria 13641
138 Ga0068858_100006646 3300005842 Bacteria 11246
139 Ga0068858_100061164 3300005842 Bacteria 3481
140 Ga0068858_100726675 3300005842 Unclassified 967
141 Ga0068860_100005516 3300005843 Bacteria 12806
142 Ga0068860_100006186 3300005843 Bacteria 12043
143 Ga0068860_100015455 3300005843 Bacteria 7453
144 Ga0068860_100217323 3300005843 Bacteria 1855
145 Ga0068860_100446538 3300005843 Unclassified 1285
146 Ga0068862_100131523 3300005844 Bacteria 2214
147 Ga0068862_100154458 3300005844 Bacteria 2045
148 Ga0068862_100327460 3300005844 Bacteria 1416
149 Ga0068862_100460009 3300005844 Unclassified 1201
150 Ga0068862_101301914 3300005844 Unclassified 728
151 Ga0081455_10000057 3300005937 Bacteria 119751
152 Ga0081539_10000038 3300005985 Bacteria 296079
153 Ga0070715_10006658 3300006163 Bacteria 3942
154 Ga0070715_10164930 3300006163 Bacteria 1098
155 Ga0070716_100027399 3300006173 Bacteria 3061
156 Ga0070716_100133894 3300006173 Bacteria 1571
157 Ga0070716_100595851 3300006173 Bacteria 831
158 Ga0070712_100006678 3300006175 Bacteria 7170
159 Ga0070712_100070870 3300006175 Bacteria 2492
160 Ga0097621_100006379 3300006237 Bacteria 8371
161 Ga0097621_100012611 3300006237 Bacteria 6271
162 Ga0097621_100144460 3300006237 Unclassified 2035
163 Ga0097621_100192057 3300006237 Bacteria 1769
164 Ga0097621_100586124 3300006237 Unclassified 1018
165 Ga0097621_101233752 3300006237 Unclassified 705
166 Ga0068871_100023046 3300006358 Bacteria 4808
167 Ga0068871_100103575 3300006358 Unclassified 2386
168 Ga0068871_100141161 3300006358 Unclassified 2048
169 Ga0068871_100419146 3300006358 Unclassified 1195
170 Ga0068865_100023316 3300006881 Bacteria 4051
171 Ga0068865_100092153 3300006881 Unclassified 2201
172 Ga0075436_100057368 3300006914 Bacteria 2689
173 Ga0097620_100000196 3300006931 Bacteria 59010
174 Ga0097620_100019340 3300006931 Bacteria 6843
175 Ga0097620_100192898 3300006931 Bacteria 2121
176 Ga0097620_100749120 3300006931 Bacteria 1066
177 Ga0097620_102295545 3300006931 Unclassified 595
178 Ga0099826_10037321 3300006948 Unclassified 3425
179 Ga0099795_10000034 3300007788 Bacteria 36525
180 Ga0105251_10293355 3300009011 Bacteria 736
181 Ga0105240_10001059 3300009093 Bacteria 48690
182 Ga0105240_10002425 3300009093 Bacteria 29968
183 Ga0105240_10108436 3300009093 Bacteria 3364
184 Ga0105240_10148269 3300009093 Bacteria 2797
185 Ga0105240_10259107 3300009093 Bacteria 2007
186 Ga0105240_10264502 3300009093 Bacteria 1983
187 Ga0105240_10344273 3300009093 Bacteria 1693
188 Ga0105240_10800909 3300009093 Bacteria 1021
189 Ga0105240_11432824 3300009093 Unclassified 725
190 Ga0105245_10009828 3300009098 Bacteria 8336
191 Ga0105245_10011723 3300009098 Bacteria 7628
192 Ga0105245_10761294 3300009098 Unclassified 1005
193 Ga0105247_10000558 3300009101 Bacteria 30299
194 Ga0105247_10007392 3300009101 Bacteria 6744
195 Ga0105247_10020368 3300009101 Bacteria 3988
196 Ga0105247_10029035 3300009101 Bacteria 3349
197 Ga0105247_10076456 3300009101 Bacteria 2102
198 Ga0105247_10122147 3300009101 Unclassified 1689
199 Ga0105243_10457762 3300009148 Unclassified 1199
200 Ga0105241_10044123 3300009174 Bacteria 3378
201 Ga0105242_10001505 3300009176 Bacteria 18312
202 Ga0105242_10006373 3300009176 Bacteria 9084
203 Ga0105248_10002404 3300009177 Bacteria 20783
204 Ga0105248_10010045 3300009177 Bacteria 10424
205 Ga0105248_10010440 3300009177 Bacteria 10229
206 Ga0105248_10041193 3300009177 Bacteria 5177
207 Ga0105248_10109384 3300009177 Bacteria 3116
208 Ga0105248_10925351 3300009177 Bacteria 985
209 Ga0105237_10054088 3300009545 Unclassified 4022
210 Ga0105237_10220496 3300009545 Unclassified 1897
211 Ga0105237_10530997 3300009545 Bacteria 1183
212 Ga0105238_10000966 3300009551 Bacteria 29470
213 Ga0105238_10027386 3300009551 Bacteria 5807
214 Ga0105238_10037863 3300009551 Bacteria 4901
215 Ga0105238_10104264 3300009551 Bacteria 2817
216 Ga0105238_10415859 3300009551 Bacteria 1339
217 Ga0105238_10872594 3300009551 Bacteria 917
218 Ga0105238_11184384 3300009551 Bacteria 788
219 Ga0105249_10015712 3300009553 Bacteria 6704
220 Ga0105249_10108489 3300009553 Unclassified 2621
221 Ga0105249_10212896 3300009553 Bacteria 1897
222 Ga0099796_10000042 3300010159 Bacteria 25551
223 Ga0099796_10101289 3300010159 Unclassified 1084
224 Ga0105239_10019609 3300010375 Bacteria 7464
225 Ga0105239_10031025 3300010375 Bacteria 5880
226 Ga0105239_10317592 3300010375 Bacteria 1756
227 Ga0105239_11324358 3300010375 Bacteria 831
228 Ga0105239_11393335 3300010375 Bacteria 809
229 Ga0105246_10053653 3300011119 Unclassified 2775
230 Ga0157373_10135919 3300013100 Bacteria 1728
231 Ga0157373_10522839 3300013100 Bacteria 859
232 Ga0157370_10004643 3300013104 Bacteria 15700
233 Ga0157369_10044939 3300013105 Bacteria 4806
234 Ga0157369_10148671 3300013105 Unclassified 2476
235 Ga0157369_10202208 3300013105 Unclassified 2085
236 Ga0157369_10203429 3300013105 Unclassified 2078
237 Ga0157374_10001326 3300013296 Bacteria 21038
238 Ga0157374_10014106 3300013296 Bacteria 6985
239 Ga0157374_10808941 3300013296 Bacteria 953
240 Ga0157378_10001014 3300013297 Bacteria 25676
241 Ga0157378_10011814 3300013297 Bacteria 7644
242 Ga0163162_10026906 3300013306 Bacteria 5688
243 Ga0163162_10068378 3300013306 Unclassified 3603
244 Ga0163162_10160254 3300013306 Bacteria 2371
245 Ga0163162_10784906 3300013306 Bacteria 1071
246 Ga0157372_10127596 3300013307 Unclassified 2925
247 Ga0157372_10138209 3300013307 Bacteria 2807
248 Ga0157372_10241175 3300013307 Bacteria 2098
249 Ga0157372_10561362 3300013307 Bacteria 1331
250 Ga0157375_10062319 3300013308 Bacteria 3705
251 Ga0157375_11719139 3300013308 Bacteria 743
252 Ga0163163_10383653 3300014325 Unclassified 1463
253 Ga0163163_11233371 3300014325 Unclassified 810
254 Ga0157380_10050148 3300014326 Bacteria 3296
255 Ga0157380_10437129 3300014326 Bacteria 1253
256 Ga0157379_10002640 3300014968 Bacteria 15084
257 Ga0157379_10034571 3300014968 Bacteria 4507
258 Ga0157379_10186075 3300014968 Bacteria 1877
259 Ga0157379_10291537 3300014968 Bacteria 1486
260 Ga0157379_10326670 3300014968 Unclassified 1401
261 Ga0157379_10391145 3300014968 Unclassified 1277
262 Ga0157376_10017747 3300014969 Bacteria 5438
263 Ga0157376_10047983 3300014969 Bacteria 3528
264 Ga0157376_10090699 3300014969 Bacteria 2645
265 Ga0182007_10065640 3300015262 Bacteria 1189
266 Ga0163161_10117965 3300017792 Unclassified 1991
267 Ga0206354_10136901 3300020081 Bacteria 756
268 Ga0206353_10401490 3300020082 Bacteria 2162
269 Ga0213872_10165784 3300021361 Bacteria 960
270 Ga0213874_10008195 3300021377 Bacteria 2539
271 Ga0213874_10103921 3300021377 Unclassified 948
272 Ga0213876_10025709 3300021384 Bacteria 3105
273 Ga0213871_10023011 3300021441 Bacteria 1566
274 Ga0228598_1018914 3300024227 Bacteria 1359
275 Ga0207692_10148310 3300025898 Unclassified 1341
276 Ga0207692_10782059 3300025898 Bacteria 623
277 Ga0207642_10010284 3300025899 Bacteria 3292
278 Ga0207710_10000134 3300025900 Bacteria 87269
279 Ga0207710_10406539 3300025900 Unclassified 699
280 Ga0207680_10022394 3300025903 Bacteria 3435
281 Ga0207680_10044186 3300025903 Bacteria 2618
282 Ga0207680_10150480 3300025903 Unclassified 1551
283 Ga0207680_10325703 3300025903 Unclassified 1075
284 Ga0207647_10032062 3300025904 Unclassified 3379
285 Ga0207699_10008419 3300025906 Bacteria 5090
286 Ga0207699_10009199 3300025906 Bacteria 4908
287 Ga0207699_10037269 3300025906 Bacteria 2778
288 Ga0207699_10090182 3300025906 Bacteria 1923
289 Ga0207705_10133043 3300025909 Bacteria 1852
290 Ga0207684_10268254 3300025910 Bacteria 1473
291 Ga0207654_10020098 3300025911 Unclassified 3535
292 Ga0207707_10001543 3300025912 Bacteria 21211
293 Ga0207707_10003173 3300025912 Bacteria 14592
294 Ga0207707_10028857 3300025912 Bacteria 4849
295 Ga0207707_10051661 3300025912 Bacteria 3580
296 Ga0207707_10067384 3300025912 Bacteria 3118
297 Ga0207707_10083596 3300025912 Bacteria 2787
298 Ga0207707_10088373 3300025912 Bacteria 2707
299 Ga0207695_10016760 3300025913 Bacteria 8555
300 Ga0207695_10019323 3300025913 Bacteria 7846
301 Ga0207695_10033634 3300025913 Bacteria 5587
302 Ga0207695_10056194 3300025913 Bacteria 4097
303 Ga0207695_10083519 3300025913 Bacteria 3226
304 Ga0207695_10450806 3300025913 Bacteria 1169
305 Ga0207695_10508252 3300025913 Unclassified 1087
306 Ga0207695_10897266 3300025913 Bacteria 766
307 Ga0207671_10170205 3300025914 Unclassified 1691
308 Ga0207671_10251384 3300025914 Bacteria 1390
309 Ga0207671_11065719 3300025914 Unclassified 636
310 Ga0207693_10000060 3300025915 Bacteria 93715
311 Ga0207663_10095510 3300025916 Bacteria 1983
312 Ga0207663_10214000 3300025916 Bacteria 1398
313 Ga0207663_10914313 3300025916 Bacteria 702
314 Ga0207660_10008463 3300025917 Bacteria 6655
315 Ga0207660_10081294 3300025917 Bacteria 2381
316 Ga0207660_10154717 3300025917 Bacteria 1764
317 Ga0207660_10195431 3300025917 Unclassified 1578
318 Ga0207657_10158674 3300025919 Unclassified 1838
319 Ga0207649_10074366 3300025920 Bacteria 2180
320 Ga0207652_10004353 3300025921 Bacteria 11541
321 Ga0207652_10088628 3300025921 Bacteria 2715
322 Ga0207694_10007297 3300025924 Bacteria 8388
323 Ga0207694_10177420 3300025924 Bacteria 1726
324 Ga0207694_10200503 3300025924 Unclassified 1623
325 Ga0207694_10219810 3300025924 Unclassified 1549
326 Ga0207650_10044645 3300025925 Unclassified 3257
327 Ga0207650_10092483 3300025925 Unclassified 2313
328 Ga0207687_10020018 3300025927 Bacteria 4438
329 Ga0207700_10036854 3300025928 Bacteria 3536
330 Ga0207700_10107088 3300025928 Unclassified 2242
331 Ga0207700_10427089 3300025928 Bacteria 1165
332 Ga0207700_10599524 3300025928 Bacteria 980
333 Ga0207664_10026898 3300025929 Bacteria 4354
334 Ga0207664_10098002 3300025929 Bacteria 2417
335 Ga0207664_10303019 3300025929 Bacteria 1406
336 Ga0207644_10025961 3300025931 Unclassified 4032
337 Ga0207644_10028162 3300025931 Bacteria 3886
338 Ga0207644_10451303 3300025931 Unclassified 1056
339 Ga0207644_10624763 3300025931 Bacteria 895
340 Ga0207690_10104171 3300025932 Unclassified 2032
341 Ga0207706_10303335 3300025933 Unclassified 1391
342 Ga0207706_10339258 3300025933 Bacteria 1307
343 Ga0207686_10029965 3300025934 Bacteria 3216
344 Ga0207686_10220486 3300025934 Unclassified 1369
345 Ga0207686_10357637 3300025934 Bacteria 1101
346 Ga0207709_10812924 3300025935 Unclassified 755
347 Ga0207670_10122643 3300025936 Unclassified 1892
348 Ga0207669_10577357 3300025937 Bacteria 911
349 Ga0207704_10010187 3300025938 Bacteria 4571
350 Ga0207665_10013127 3300025939 Bacteria 5446
351 Ga0207665_10062406 3300025939 Bacteria 2528
352 Ga0207665_10212608 3300025939 Bacteria 1414
353 Ga0207691_10292272 3300025940 Unclassified 1401
354 Ga0207691_10477695 3300025940 Bacteria 1059
355 Ga0207711_10016352 3300025941 Bacteria 6166
356 Ga0207711_10033562 3300025941 Bacteria 4344
357 Ga0207711_10264937 3300025941 Bacteria 1580
358 Ga0207711_10306933 3300025941 Bacteria 1464
359 Ga0207711_10611543 3300025941 Bacteria 1017
360 Ga0207711_10682763 3300025941 Bacteria 958
361 Ga0207689_10705373 3300025942 Bacteria 851
362 Ga0207689_10724305 3300025942 Bacteria 839
363 Ga0207661_10090182 3300025944 Unclassified 2552
364 Ga0207661_10609646 3300025944 Unclassified 1002
365 Ga0207679_10396857 3300025945 Bacteria 1213
366 Ga0207679_10580660 3300025945 Unclassified 1008
367 Ga0207667_10016427 3300025949 Bacteria 8367
368 Ga0207667_10100314 3300025949 Unclassified 2986
369 Ga0207667_10799060 3300025949 Bacteria 940
370 Ga0207651_10103967 3300025960 Bacteria 2115
371 Ga0207712_10073839 3300025961 Unclassified 2461
372 Ga0207712_10148861 3300025961 Bacteria 1806
373 Ga0207640_10424969 3300025981 Unclassified 1088
374 Ga0207658_10000746 3300025986 Bacteria 27992
375 Ga0207658_10032600 3300025986 Bacteria 3709
376 Ga0207658_10035725 3300025986 Bacteria 3560
377 Ga0207658_10036219 3300025986 Bacteria 3537
378 Ga0207677_10355308 3300026023 Bacteria 1229
379 Ga0207703_10003474 3300026035 Bacteria 13199
380 Ga0207703_10006491 3300026035 Bacteria 9337
381 Ga0207703_10130641 3300026035 Bacteria 2168
382 Ga0207703_10643681 3300026035 Bacteria 1005
383 Ga0207639_10399180 3300026041 Bacteria 1238
384 Ga0207639_10823011 3300026041 Unclassified 866
385 Ga0207639_11516275 3300026041 Bacteria 629
386 Ga0207678_10031411 3300026067 Bacteria 4632
387 Ga0207708_10971680 3300026075 Bacteria 737
388 Ga0207702_10109134 3300026078 Bacteria 2456
389 Ga0207702_10212225 3300026078 Unclassified 1800
390 Ga0207641_10001822 3300026088 Bacteria 20498
391 Ga0207641_10032206 3300026088 Bacteria 4352
392 Ga0207641_10332765 3300026088 Bacteria 1443
393 Ga0207641_11245633 3300026088 Unclassified 744
394 Ga0207641_11744600 3300026088 Bacteria 624
395 Ga0207648_10427578 3300026089 Bacteria 1203
396 Ga0207648_10584002 3300026089 Unclassified 1029
397 Ga0207674_10212247 3300026116 Unclassified 1885
398 Ga0207675_100014060 3300026118 Bacteria 7464
399 Ga0207675_100038984 3300026118 Bacteria 4434
400 Ga0207675_100044390 3300026118 Bacteria 4154
401 Ga0207675_100073376 3300026118 Bacteria 3202
402 Ga0207675_100103102 3300026118 Bacteria 2688
403 Ga0207683_10000725 3300026121 Bacteria 29989
404 Ga0207683_10270825 3300026121 Unclassified 1551
405 Ga0207698_10832645 3300026142 Unclassified 927
406 Ga0209179_1000027 3300027512 Bacteria 35217
407 Ga0268266_10004065 3300028379 Bacteria 14142
408 Ga0268266_10012525 3300028379 Bacteria 7329
409 Ga0268266_10028183 3300028379 Bacteria 4775
410 Ga0268266_10059617 3300028379 Unclassified 3288
411 Ga0268266_10081277 3300028379 Bacteria 2825
412 Ga0268266_10145362 3300028379 Unclassified 2131
413 Ga0268266_10310554 3300028379 Bacteria 1473
414 Ga0268266_10434641 3300028379 Bacteria 1246
415 Ga0268266_10465018 3300028379 Bacteria 1204
416 Ga0268265_10117919 3300028380 Bacteria 2181
417 Ga0268265_10120665 3300028380 Bacteria 2159
418 Ga0268265_10296736 3300028380 Unclassified 1453
419 Ga0268265_10781931 3300028380 Unclassified 929
420 Ga0268265_10977123 3300028380 Unclassified 835
421 Ga0268264_10000736 3300028381 Bacteria 37406
422 Ga0268264_10287304 3300028381 Bacteria 1543
423 Ga0268264_10614521 3300028381 Bacteria 1072
424 Ga0268264_10754254 3300028381 Unclassified 970
425 Ga0265319_1029612 3300028563 Bacteria 1921
426 Ga0265334_10225268 3300028573 Unclassified 648
427 Ga0265318_10001026 3300028577 Bacteria 17759
428 Ga0265338_10149324 3300028800 Unclassified 1818
429 Ga0307511_10000205 3300030521 Bacteria 59754
430 Ga0307511_10114181 3300030521 Bacteria 1703
431 Ga0307511_10180198 3300030521 Unclassified 1140
432 Ga0265330_10003872 3300031235 Bacteria 7702
433 Ga0265332_10003323 3300031238 Bacteria 7803
434 Ga0265329_10001089 3300031242 Bacteria 13337
435 Ga0265340_10031556 3300031247 Bacteria 2649
436 Ga0265339_10049675 3300031249 Bacteria 2296
437 Ga0265331_10002553 3300031250 Bacteria 12240
438 Ga0265331_10003719 3300031250 Bacteria 9697
439 Ga0265316_10008890 3300031344 Bacteria 9273
440 Ga0307513_10010158 3300031456 Bacteria 11836
441 Ga0307513_10131299 3300031456 Bacteria 2450
442 Ga0307513_10192564 3300031456 Bacteria 1889
443 Ga0307509_10000167 3300031507 Bacteria 103177
444 Ga0307509_10074603 3300031507 Unclassified 3527
445 Ga0307509_10288603 3300031507 Bacteria 1397
446 Ga0307408_100119841 3300031548 Bacteria 2037
447 Ga0307408_100298344 3300031548 Bacteria 1349
448 Ga0316575_10187787 3300031665 Bacteria 859
449 Ga0265314_10002268 3300031711 Bacteria 19911
450 Ga0316576_10070324 3300031727 Bacteria 2581
451 Ga0307516_10494927 3300031730 Unclassified 877
452 Ga0316577_10263115 3300031733 Bacteria 976
453 Ga0326468_10052413 3300031889 Unclassified 623
454 Ga0307412_10392676 3300031911 Unclassified 1127
455 Ga0307411_10203459 3300032005 Bacteria 1523
456 Ga0307411_10511677 3300032005 Bacteria 1017
457 Ga0307415_100216645 3300032126 Bacteria 1532
458 Ga0307415_100792313 3300032126 Unclassified 864
459 Ga0307510_10000009 3300033180 Bacteria 409702
460 Ga0307510_10041650 3300033180 Bacteria 5016
461 Ga0373928_0118048 3300035084 Unclassified 708
462 Ga0373936_0016115 3300035113 Unclassified 2871
463 Ga0373936_0027648 3300035113 Bacteria 2225
464 Ga0373939_0135206 3300035114 Unclassified 884
465 Ga0373954_0108224 3300035118 Bacteria 1344
466 Ga0373954_0199791 3300035118 Unclassified 982
467 Ga0373957_0219378 3300035120 Bacteria 796
468 Ga0373943_0362606 3300035170 Unclassified 832
469 Ga0373955_0038433 3300035172 Bacteria 2550
470 Ga0373955_0044023 3300035172 Bacteria 2403
471 Ga0373955_0609909 3300035172 Bacteria 668
472 Ga0316574_0729567 3300035398 Bacteria 606
473 Ga0373927_0049029 3300035695 Bacteria 2731
474 Ga0373927_0537207 3300035695 Unclassified 773
475 Ga0373933_0011477 3300035724 Unclassified 4886
476 Ga0373947_0060514 3300035725 Bacteria 2300
477 Ga0373937_0001197 3300036401 Bacteria 21800
478 Ga0373937_0031862 3300036401 Bacteria 4779
479 Ga0373937_0041078 3300036401 Bacteria 4219
480 Ga0316582_0812123 3300036647 Bacteria 641
481 Ga0316584_0083048 3300036712 Bacteria 2399
482 Ga0373925_0247830 3300037068 Bacteria 1428
483 Ga0395905_0748036 3300037471 Bacteria 880
484 Ga0436364_0511138 3300037853 Unclassified 843
485 Ga0436364_1263693 3300037853 Bacteria 933
486 Ga0436364_1433804 3300037853 Bacteria 762
487 Ga0436365_0738787 3300039437 Bacteria 7867
488 Ga0436360_0281290 3300039438 Bacteria 2916
489 Ga0436360_0477701 3300039438 Bacteria 649
490 Ga0436360_1260296 3300039438 Bacteria 1192
491 Ga0436361_0407670 3300039447 Bacteria 1192
492 Ga0436361_1163383 3300039447 Bacteria 1405
493 Ga0436361_1173204 3300039447 Unclassified 1685
494 Ga0436363_0138643 3300039450 Bacteria 8554
495 Ga0436363_0853019 3300039450 Unclassified 1393
496 Ga0436363_0895754 3300039450 Unclassified 762
497 Ga0436363_0944041 3300039450 Bacteria 1759
498 Ga0436363_1121322 3300039450 Bacteria 7625
499 Ga0436363_1643864 3300039450 Unclassified 692
500 Ga0451793_0118976 3300041452 Bacteria 1267
501 Ga0451798_0916510 3300041458 Bacteria 2981
502 Ga0451802_0496319 3300041460 Bacteria 680
503 Ga0451833_1167638 3300041491 Bacteria 1679
504 Ga0439449_0088831 3300042007 Unclassified 1141
505 Ga0466969_0000425 3300044656 Bacteria 23054
506 Ga0466969_0001362 3300044656 Bacteria 13168
507 Ga0466972_0036588 3300044658 Bacteria 2401
508 Ga0466966_0000285 3300044684 Bacteria 33126
509 Ga0466966_0026246 3300044684 Bacteria 3804
510 Ga0466961_0109819 3300044693 Bacteria 1736
511 Ga0466964_0000393 3300044706 Bacteria 13311
512 Ga0466971_0006649 3300044719 Bacteria 5028
513 Ga0466971_0129466 3300044719 Bacteria 1171
514 Ga0466968_0015970 3300044735 Bacteria 2984
515 Ga0466968_0051691 3300044735 Unclassified 1756
516 Ga0466970_0005912 3300044765 Bacteria 6096
517 Ga0466957_0069242 3300044842 Unclassified 2180
518 Ga0466960_0030401 3300044901 Bacteria 2485
519 Ga0466959_0004362 3300045049 Bacteria 9464
520 Ga0466959_0006207 3300045049 Bacteria 8260
521 Ga0466959_0042845 3300045049 Bacteria 3338
522 Ga0466958_0179729 3300045836 Bacteria 1342
523 Ga0495590_0028526 3300046457 Unclassified 1957
524 Ga0495638_0001279 3300046460 Bacteria 23471
525 Ga0495638_0019850 3300046460 Bacteria 4444
526 Ga0495641_0063586 3300046461 Unclassified 1663
527 Ga0495580_0062193 3300046472 Bacteria 2620
528 Ga0495580_0147970 3300046472 Bacteria 1627
529 Ga0495580_0313653 3300046472 Bacteria 1066
530 Ga0495585_0331932 3300046492 Unclassified 742
531 Ga0495583_0060331 3300046506 Bacteria 1696
532 Ga0495616_0045416 3300046513 Unclassified 2223
533 Ga0495618_0172999 3300046514 Bacteria 1374
534 Ga0495628_0071937 3300046516 Bacteria 2695
535 Ga0495630_0392822 3300046517 Bacteria 1063
536 Ga0495632_0043607 3300046519 Bacteria 2241
537 Ga0495632_0190911 3300046519 Unclassified 936
538 Ga0495632_0312520 3300046519 Unclassified 695
539 Ga0495640_0292042 3300046533 Bacteria 1014
540 Ga0495587_0045287 3300046536 Unclassified 2615
541 Ga0495645_0379916 3300046543 Bacteria 904
542 Ga0495625_0001239 3300046660 Bacteria 32208
543 Ga0495625_0015653 3300046660 Bacteria 5998
544 Ga0495625_0067579 3300046660 Unclassified 2515
545 Ga0495657_0295280 3300046675 Bacteria 967
546 Ga0495623_0110944 3300046679 Unclassified 1662
547 Ga0495658_0307157 3300046683 Bacteria 1004
548 Ga0495600_0305618 3300046809 Bacteria 1003
549 Ga0495581_0213532 3300047315 Bacteria 1128
550 Ga0495687_014634 3300047443 Unclassified 4026
551 Ga0495675_0127150 3300047444 Bacteria 1585
552 Ga0495686_0106791 3300047472 Bacteria 1683
553 Ga0495593_0501870 3300047673 Bacteria 608
554 Ga0495602_0106535 3300048088 Unclassified 2288
555 Ga0496100_1074130 3300048903 Unclassified 634
556 Ga0496101_0002164 3300048904 Bacteria 12007
557 Ga0496102_0007024 3300048905 Bacteria 9614
558 Ga0496102_0015062 3300048905 Bacteria 6731
559 Ga0496102_0067437 3300048905 Bacteria 3282
560 Ga0496102_0088319 3300048905 Bacteria 2865
561 Ga0496103_0100853 3300048906 Bacteria 1827
562 Ga0496104_0196072 3300048907 Bacteria 1931
563 Ga0496104_0441728 3300048907 Unclassified 1213
564 Ga0496105_0011414 3300048908 Bacteria 7017
565 Ga0496105_0020408 3300048908 Bacteria 5354
566 Ga0496105_0116720 3300048908 Bacteria 2202
567 Ga0496106_0340156 3300048909 Bacteria 1205
568 Ga0496106_0508579 3300048909 Bacteria 967
569 Ga0496107_0009320 3300048910 Bacteria 6804
570 Ga0496107_1099798 3300048910 Bacteria 574
571 Ga0496108_0006755 3300048911 Bacteria 9287
572 Ga0496108_0124832 3300048911 Unclassified 2209
573 Ga0496108_0387703 3300048911 Bacteria 1220
574 Ga0496109_0001391 3300048912 Bacteria 20067
575 Ga0496109_0030449 3300048912 Bacteria 4836
576 Ga0496110_0005095 3300048913 Bacteria 10264
577 Ga0496110_0147271 3300048913 Unclassified 2130
578 Ga0496111_0003948 3300048914 Bacteria 9307
579 Ga0496112_0075507 3300048915 Bacteria 3333
580 Ga0496113_0014370 3300048916 Bacteria 5400
581 Ga0496114_0130769 3300048917 Bacteria 2167
582 Ga0496114_0158930 3300048917 Bacteria 1964
583 Ga0496115_0177255 3300048918 Bacteria 1762
584 Ga0496115_0514037 3300048918 Bacteria 961
585 Ga0496116_0006366 3300048919 Bacteria 10739
586 Ga0496117_0000099 3300048920 Bacteria 194987
587 Ga0496118_0000105 3300048921 Bacteria 156739
588 Ga0496118_0093276 3300048921 Bacteria 2063
589 Ga0496118_0127266 3300048921 Unclassified 1644
590 Ga0496119_0005649 3300048922 Bacteria 11872
591 Ga0496119_0022550 3300048922 Bacteria 4501
592 Ga0496120_0000612 3300048923 Bacteria 54154
593 Ga0496120_0057067 3300048923 Bacteria 2199
594 Ga0496121_0000772 3300048924 Bacteria 58665
595 Ga0496121_0038922 3300048924 Unclassified 4201
596 Ga0496121_0089235 3300048924 Bacteria 2414
597 Ga0496121_0140187 3300048924 Bacteria 1795
598 Ga0496124_0199380 3300048927 Bacteria 1523
599 Ga0496124_0342332 3300048927 Unclassified 1061
600 Ga0496125_0000186 3300048928 Bacteria 135128
601 Ga0496125_0001407 3300048928 Bacteria 35110
602 Ga0496125_0015680 3300048928 Bacteria 7310
603 Ga0496126_0045294 3300048929 Bacteria 4044
604 Ga0496126_0071161 3300048929 Bacteria 3097
605 Ga0496126_0881160 3300048929 Bacteria 680
606 Ga0495682_0077389 3300049460 Unclassified 1197
607 Ga0501080_0183001 3300049742 Unclassified 1928
608 nmdc:mga0rr50_623801_c1 3300050513 Bacteria 919
609 nmdc:mga08x19_54419_c1 3300050514 Bacteria 2576
610 Ga0495601_0290053 3300053077 Bacteria 1067
611 Ga0500646_0153609 3300053090 Unclassified 764
612 Ga0500583_0009635 3300053092 Bacteria 3542
613 Ga0500583_0078901 3300053092 Bacteria 1588
614 Ga0500650_0172459 3300053098 Unclassified 994
615 Ga0500556_0000174 3300053104 Bacteria 52844
616 Ga0500558_130287 3300053106 Bacteria 962
617 Ga0500594_0014664 3300053118 Bacteria 1880
618 Ga0500642_0274619 3300053130 Bacteria 767
619 Ga0500655_004693 3300053133 Bacteria 2457
620 Ga0500658_0028219 3300053134 Bacteria 2176
621 Ga0500658_0095886 3300053134 Bacteria 1289
622 Ga0500658_0396633 3300053134 Unclassified 632
623 Ga0500559_0043615 3300053136 Unclassified 1960
624 Ga0500568_0197249 3300053139 Unclassified 738
625 Ga0500588_0004234 3300053146 Bacteria 3093
626 Ga0500589_240320 3300053147 Unclassified 670
627 Ga0500622_0001768 3300053156 Bacteria 16579
628 Ga0500627_0256826 3300053158 Unclassified 772
629 Ga0500633_0064749 3300053160 Bacteria 1293
630 Ga0500639_018575 3300053163 Unclassified 3670
631 Ga0500596_058780 3300053735 Unclassified 640
632 Ga0590075_044119 3300059424 Bacteria 1141
633 Ga0587111_0098526 3300060346 Bacteria 725
634 Ga0466962_0000191 3300061719 Bacteria 25547

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0093276 Ga0496118_0093276_1555_2052 135
2 3300013297 Ga0157378_10001014 Ga0157378_100010145 139
3 3300039438 Ga0436360_0477701 Ga0436360_0477701_214_636 140
4 3300047315 Ga0495581_0213532 Ga0495581_0213532_693_1115 140
5 3300003316 rootH1_10011139 rootH1_100111392 145
6 3300036647 Ga0316582_0812123 Ga0316582_0812123_169_627 147
7 3300048927 Ga0496124_0342332 Ga0496124_0342332_51_554 147
8 3300014326 Ga0157380_10050148 Ga0157380_100501484 148
9 3300009093 Ga0105240_10259107 Ga0105240_102591073 150
10 3300009551 Ga0105238_10104264 Ga0105238_101042643 150
11 3300005327 Ga0070658_10502858 Ga0070658_105028581 159
12 3300005543 Ga0070672_100477862 Ga0070672_1004778622 159
13 3300025940 Ga0207691_10477695 Ga0207691_104776952 159
14 3300053092 Ga0500583_0078901 Ga0500583_0078901_607_1125 159
15 3300005563 Ga0068855_100004460 Ga0068855_1000044607 160
16 3300036712 Ga0316584_0083048 Ga0316584_0083048_1022_1519 160
17 3300031548 Ga0307408_100119841 Ga0307408_1001198412 161
18 3300006948 Ga0099826_10037321 Ga0099826_100373212 162
19 3300032126 Ga0307415_100792313 Ga0307415_1007923132 162
20 3300037471 Ga0395905_0748036 Ga0395905_0748036_309_869 162
21 3300042007 Ga0439449_0088831 Ga0439449_0088831_567_1124 162
22 3300059424 Ga0590075_044119 Ga0590075_044119_79_636 162
23 3300005331 Ga0070670_100130094 Ga0070670_1001300941 163
24 3300005337 Ga0070682_100423119 Ga0070682_1004231191 163
25 3300005338 Ga0068868_100448289 Ga0068868_1004482892 163
26 3300005353 Ga0070669_101244314 Ga0070669_1012443141 163
27 3300005354 Ga0070675_100902814 Ga0070675_1009028141 163
28 3300005466 Ga0070685_10465259 Ga0070685_104652592 163
29 3300005544 Ga0070686_100292858 Ga0070686_1002928582 163
30 3300005548 Ga0070665_100026693 Ga0070665_1000266936 163
31 3300005548 Ga0070665_100200303 Ga0070665_1002003032 163
32 3300005564 Ga0070664_100015641 Ga0070664_1000156414 163
33 3300005577 Ga0068857_100600129 Ga0068857_1006001292 163
34 3300005617 Ga0068859_100749193 Ga0068859_1007491932 163
35 3300005719 Ga0068861_100176092 Ga0068861_1001760922 163
36 3300005719 Ga0068861_100607621 Ga0068861_1006076212 163
37 3300005840 Ga0068870_10086096 Ga0068870_100860962 163
38 3300005840 Ga0068870_10147013 Ga0068870_101470133 163
39 3300005844 Ga0068862_100154458 Ga0068862_1001544582 163
40 3300005844 Ga0068862_100327460 Ga0068862_1003274602 163
41 3300006931 Ga0097620_100749120 Ga0097620_1007491202 163
42 3300013308 Ga0157375_11719139 Ga0157375_117191391 163
43 3300025925 Ga0207650_10092483 Ga0207650_100924832 163
44 3300025932 Ga0207690_10104171 Ga0207690_101041713 163
45 3300025933 Ga0207706_10339258 Ga0207706_103392582 163
46 3300025934 Ga0207686_10357637 Ga0207686_103576372 163
47 3300025940 Ga0207691_10292272 Ga0207691_102922722 163
48 3300025945 Ga0207679_10396857 Ga0207679_103968572 163
49 3300025945 Ga0207679_10580660 Ga0207679_105806602 163
50 3300026075 Ga0207708_10971680 Ga0207708_109716802 163
51 3300026118 Ga0207675_100103102 Ga0207675_1001031023 163
52 3300026121 Ga0207683_10270825 Ga0207683_102708252 163
53 3300028379 Ga0268266_10012525 Ga0268266_100125257 163
54 3300028380 Ga0268265_10120665 Ga0268265_101206652 163
55 3300028380 Ga0268265_10296736 Ga0268265_102967363 163
56 3300031548 Ga0307408_100298344 Ga0307408_1002983442 163
57 3300031911 Ga0307412_10392676 Ga0307412_103926762 163
58 3300032005 Ga0307411_10203459 Ga0307411_102034592 163
59 3300041460 Ga0451802_0496319 Ga0451802_0496319_49_552 163
60 3300046460 Ga0495638_0019850 Ga0495638_0019850_212_715 163
61 3300046513 Ga0495616_0045416 Ga0495616_0045416_312_815 163
62 3300046519 Ga0495632_0190911 Ga0495632_0190911_134_697 163
63 3300046660 Ga0495625_0015653 Ga0495625_0015653_450_953 163
64 3300053134 Ga0500658_0396633 Ga0500658_0396633_19_582 163
65 3300005330 Ga0070690_100406723 Ga0070690_1004067232 164
66 3300005843 Ga0068860_100217323 Ga0068860_1002173232 164
67 3300006237 Ga0097621_100192057 Ga0097621_1001920573 164
68 3300009093 Ga0105240_10001059 Ga0105240_100010598 164
69 3300009093 Ga0105240_10108436 Ga0105240_101084363 164
70 3300009093 Ga0105240_10148269 Ga0105240_101482694 164
71 3300009101 Ga0105247_10122147 Ga0105247_101221473 164
72 3300009545 Ga0105237_10054088 Ga0105237_100540882 164
73 3300009545 Ga0105237_10530997 Ga0105237_105309972 164
74 3300010375 Ga0105239_10031025 Ga0105239_100310256 164
75 3300010375 Ga0105239_11324358 Ga0105239_113243582 164
76 3300013307 Ga0157372_10127596 Ga0157372_101275964 164
77 3300025900 Ga0207710_10406539 Ga0207710_104065391 164
78 3300025936 Ga0207670_10122643 Ga0207670_101226432 164
79 3300025942 Ga0207689_10724305 Ga0207689_107243052 164
80 3300025944 Ga0207661_10090182 Ga0207661_100901824 164
81 3300026041 Ga0207639_10399180 Ga0207639_103991802 164
82 3300028379 Ga0268266_10465018 Ga0268266_104650182 164
83 3300028381 Ga0268264_10614521 Ga0268264_106145212 164
84 3300031456 Ga0307513_10010158 Ga0307513_1001015812 164
85 3300031456 Ga0307513_10131299 Ga0307513_101312994 164
86 3300031456 Ga0307513_10192564 Ga0307513_101925642 164
87 3300032005 Ga0307411_10511677 Ga0307411_105116772 164
88 3300032126 Ga0307415_100216645 Ga0307415_1002166452 164
89 3300039450 Ga0436363_0895754 Ga0436363_0895754_254_748 164
90 3300041452 Ga0451793_0118976 Ga0451793_0118976_315_821 164
91 3300041458 Ga0451798_0916510 Ga0451798_0916510_1240_1746 164
92 3300044656 Ga0466969_0001362 Ga0466969_0001362_11761_12255 164
93 3300044658 Ga0466972_0036588 Ga0466972_0036588_683_1177 164
94 3300044684 Ga0466966_0026246 Ga0466966_0026246_1309_1803 164
95 3300046461 Ga0495641_0063586 Ga0495641_0063586_922_1428 164
96 3300049742 Ga0501080_0183001 Ga0501080_0183001_1072_1578 164
97 3300053118 Ga0500594_0014664 Ga0500594_0014664_323_889 164
98 3300053134 Ga0500658_0095886 Ga0500658_0095886_26_592 164
99 3300053156 Ga0500622_0001768 Ga0500622_0001768_15768_16337 164
100 3300053160 Ga0500633_0064749 Ga0500633_0064749_655_1221 164
101 3300001990 JGI24737J22298_10202343 JGI24737J22298_102023431 165
102 3300003316 rootH1_10044715 rootH1_100447153 165
103 3300003320 rootH2_10170203 rootH2_101702037 165
104 3300003322 rootL2_10147116 rootL2_101471163 165
105 3300003323 rootH1_10044975 rootH1_100449757 165
106 3300005331 Ga0070670_100014751 Ga0070670_1000147512 165
107 3300005335 Ga0070666_10128110 Ga0070666_101281102 165
108 3300005337 Ga0070682_100255558 Ga0070682_1002555582 165
109 3300005355 Ga0070671_100470997 Ga0070671_1004709972 165
110 3300005367 Ga0070667_100153774 Ga0070667_1001537742 165
111 3300005441 Ga0070700_100254961 Ga0070700_1002549612 165
112 3300005455 Ga0070663_100100043 Ga0070663_1001000432 165
113 3300005466 Ga0070685_10688872 Ga0070685_106888722 165
114 3300005539 Ga0068853_100427694 Ga0068853_1004276942 165
115 3300005548 Ga0070665_100018269 Ga0070665_1000182695 165
116 3300005577 Ga0068857_100097074 Ga0068857_1000970743 165
117 3300005578 Ga0068854_100713753 Ga0068854_1007137532 165
118 3300005614 Ga0068856_100053312 Ga0068856_1000533123 165
119 3300005617 Ga0068859_100019340 Ga0068859_1000193406 165
120 3300005618 Ga0068864_100083624 Ga0068864_1000836242 165
121 3300005719 Ga0068861_100026201 Ga0068861_1000262015 165
122 3300005841 Ga0068863_100011745 Ga0068863_1000117457 165
123 3300005842 Ga0068858_100061164 Ga0068858_1000611642 165
124 3300005843 Ga0068860_100446538 Ga0068860_1004465381 165
125 3300005844 Ga0068862_101301914 Ga0068862_1013019142 165
126 3300006237 Ga0097621_100144460 Ga0097621_1001444602 165
127 3300006358 Ga0068871_100141161 Ga0068871_1001411613 165
128 3300006931 Ga0097620_100019340 Ga0097620_1000193406 165
129 3300009101 Ga0105247_10000558 Ga0105247_1000055811 165
130 3300009101 Ga0105247_10020368 Ga0105247_100203682 165
131 3300009177 Ga0105248_10041193 Ga0105248_100411932 165
132 3300009177 Ga0105248_10925351 Ga0105248_109253511 165
133 3300009545 Ga0105237_10220496 Ga0105237_102204962 165
134 3300009551 Ga0105238_10872594 Ga0105238_108725942 165
135 3300010159 Ga0099796_10101289 Ga0099796_101012892 165
136 3300011119 Ga0105246_10053653 Ga0105246_100536534 165
137 3300013100 Ga0157373_10522839 Ga0157373_105228392 165
138 3300013296 Ga0157374_10808941 Ga0157374_108089412 165
139 3300013306 Ga0163162_10068378 Ga0163162_100683782 165
140 3300014325 Ga0163163_10383653 Ga0163163_103836532 165
141 3300014326 Ga0157380_10437129 Ga0157380_104371293 165
142 3300014968 Ga0157379_10291537 Ga0157379_102915371 165
143 3300014969 Ga0157376_10090699 Ga0157376_100906992 165
144 3300025903 Ga0207680_10325703 Ga0207680_103257032 165
145 3300025904 Ga0207647_10032062 Ga0207647_100320624 165
146 3300025911 Ga0207654_10020098 Ga0207654_100200983 165
147 3300025924 Ga0207694_10219810 Ga0207694_102198102 165
148 3300025925 Ga0207650_10044645 Ga0207650_100446452 165
149 3300025931 Ga0207644_10025961 Ga0207644_100259615 165
150 3300025941 Ga0207711_10306933 Ga0207711_103069332 165
151 3300025981 Ga0207640_10424969 Ga0207640_104249692 165
152 3300025986 Ga0207658_10036219 Ga0207658_100362195 165
153 3300026035 Ga0207703_10003474 Ga0207703_100034743 165
154 3300026078 Ga0207702_10212225 Ga0207702_102122252 165
155 3300026088 Ga0207641_10001822 Ga0207641_1000182219 165
156 3300026088 Ga0207641_11245633 Ga0207641_112456332 165
157 3300026116 Ga0207674_10212247 Ga0207674_102122473 165
158 3300026118 Ga0207675_100014060 Ga0207675_1000140604 165
159 3300028379 Ga0268266_10145362 Ga0268266_101453622 165
160 3300028379 Ga0268266_10434641 Ga0268266_104346412 165
161 3300028380 Ga0268265_10781931 Ga0268265_107819311 165
162 3300028381 Ga0268264_10000736 Ga0268264_100007365 165
163 3300030521 Ga0307511_10180198 Ga0307511_101801982 165
164 3300031507 Ga0307509_10074603 Ga0307509_100746032 165
165 3300031889 Ga0326468_10052413 Ga0326468_100524132 165
166 3300035113 Ga0373936_0027648 Ga0373936_0027648_947_1444 165
167 3300035114 Ga0373939_0135206 Ga0373939_0135206_273_782 165
168 3300035170 Ga0373943_0362606 Ga0373943_0362606_36_533 165
169 3300035695 Ga0373927_0537207 Ga0373927_0537207_233_751 165
170 3300036401 Ga0373937_0031862 Ga0373937_0031862_2265_2783 165
171 3300039437 Ga0436365_0738787 Ga0436365_0738787_4749_5246 165
172 3300039450 Ga0436363_0853019 Ga0436363_0853019_268_765 165
173 3300041491 Ga0451833_1167638 Ga0451833_1167638_131_640 165
174 3300044656 Ga0466969_0000425 Ga0466969_0000425_10886_11383 165
175 3300044684 Ga0466966_0000285 Ga0466966_0000285_27687_28184 165
176 3300044706 Ga0466964_0000393 Ga0466964_0000393_11607_12104 165
177 3300044719 Ga0466971_0006649 Ga0466971_0006649_2214_2711 165
178 3300044735 Ga0466968_0051691 Ga0466968_0051691_1180_1677 165
179 3300044765 Ga0466970_0005912 Ga0466970_0005912_3386_3883 165
180 3300044842 Ga0466957_0069242 Ga0466957_0069242_297_794 165
181 3300045049 Ga0466959_0004362 Ga0466959_0004362_5207_5704 165
182 3300045836 Ga0466958_0179729 Ga0466958_0179729_171_668 165
183 3300046457 Ga0495590_0028526 Ga0495590_0028526_594_1103 165
184 3300046519 Ga0495632_0043607 Ga0495632_0043607_113_622 165
185 3300046660 Ga0495625_0067579 Ga0495625_0067579_1089_1598 165
186 3300047443 Ga0495687_014634 Ga0495687_014634_1323_1820 165
187 3300048905 Ga0496102_0007024 Ga0496102_0007024_4753_5250 165
188 3300048907 Ga0496104_0441728 Ga0496104_0441728_273_770 165
189 3300048908 Ga0496105_0116720 Ga0496105_0116720_1467_1964 165
190 3300048910 Ga0496107_1099798 Ga0496107_1099798_26_523 165
191 3300048911 Ga0496108_0387703 Ga0496108_0387703_685_1182 165
192 3300048917 Ga0496114_0158930 Ga0496114_0158930_337_834 165
193 3300048918 Ga0496115_0514037 Ga0496115_0514037_273_770 165
194 3300048919 Ga0496116_0006366 Ga0496116_0006366_9080_9577 165
195 3300048920 Ga0496117_0000099 Ga0496117_0000099_37502_37999 165
196 3300048921 Ga0496118_0000105 Ga0496118_0000105_43671_44168 165
197 3300048922 Ga0496119_0005649 Ga0496119_0005649_2379_2876 165
198 3300048922 Ga0496119_0022550 Ga0496119_0022550_1090_1587 165
199 3300048923 Ga0496120_0000612 Ga0496120_0000612_51285_51782 165
200 3300048923 Ga0496120_0057067 Ga0496120_0057067_1568_2065 165
201 3300048924 Ga0496121_0089235 Ga0496121_0089235_1655_2152 165
202 3300048924 Ga0496121_0140187 Ga0496121_0140187_653_1150 165
203 3300048927 Ga0496124_0199380 Ga0496124_0199380_584_1081 165
204 3300048928 Ga0496125_0000186 Ga0496125_0000186_60686_61183 165
205 3300048928 Ga0496125_0015680 Ga0496125_0015680_1998_2495 165
206 3300048929 Ga0496126_0045294 Ga0496126_0045294_456_953 165
207 3300048929 Ga0496126_0071161 Ga0496126_0071161_1472_1969 165
208 3300048929 Ga0496126_0881160 Ga0496126_0881160_134_631 165
209 3300049460 Ga0495682_0077389 Ga0495682_0077389_46_543 165
210 3300053106 Ga0500558_130287 Ga0500558_130287_420_944 165
211 3300060346 Ga0587111_0098526 Ga0587111_0098526_200_709 165
212 3300061719 Ga0466962_0000191 Ga0466962_0000191_19240_19737 165
213 3300005289 Ga0065704_10412331 Ga0065704_104123312 166
214 3300005295 Ga0065707_10085501 Ga0065707_100855014 166
215 3300005467 Ga0070706_100186170 Ga0070706_1001861702 166
216 3300005548 Ga0070665_100111566 Ga0070665_1001115663 166
217 3300005719 Ga0068861_100004230 Ga0068861_1000042309 166
218 3300013306 Ga0163162_10784906 Ga0163162_107849062 166
219 3300025910 Ga0207684_10268254 Ga0207684_102682542 166
220 3300026118 Ga0207675_100038984 Ga0207675_1000389842 166
221 3300028379 Ga0268266_10081277 Ga0268266_100812773 166
222 3300033180 Ga0307510_10041650 Ga0307510_100416504 166
223 3300046460 Ga0495638_0001279 Ga0495638_0001279_13390_13944 166
224 3300046660 Ga0495625_0001239 Ga0495625_0001239_29857_30411 166
225 3300047472 Ga0495686_0106791 Ga0495686_0106791_223_786 166
226 3300048924 Ga0496121_0038922 Ga0496121_0038922_1903_2460 166
227 3300005535 Ga0070684_100217258 Ga0070684_1002172583 167
228 3300005563 Ga0068855_100277140 Ga0068855_1002771402 167
229 3300005616 Ga0068852_100559421 Ga0068852_1005594212 167
230 3300013105 Ga0157369_10202208 Ga0157369_102022082 167
231 3300025913 Ga0207695_10033634 Ga0207695_100336346 167
232 3300026067 Ga0207678_10031411 Ga0207678_100314112 167
233 3300026142 Ga0207698_10832645 Ga0207698_108326451 167
234 3300031665 Ga0316575_10187787 Ga0316575_101877872 169
235 3300031727 Ga0316576_10070324 Ga0316576_100703242 169
236 3300031733 Ga0316577_10263115 Ga0316577_102631152 169
237 3300035398 Ga0316574_0729567 Ga0316574_0729567_28_561 169
238 3300013307 Ga0157372_10561362 Ga0157372_105613622 172
239 3300014968 Ga0157379_10391145 Ga0157379_103911452 172
240 3300037853 Ga0436364_1263693 Ga0436364_1263693_379_897 172
241 3300039447 Ga0436361_0407670 Ga0436361_0407670_531_1049 172
242 3300046514 Ga0495618_0172999 Ga0495618_0172999_472_990 172
243 3300003203 JGI25406J46586_10008835 JGI25406J46586_100088354 173
244 3300003911 JGI25405J52794_10038036 JGI25405J52794_100380362 173
245 3300005334 Ga0068869_100219047 Ga0068869_1002190472 173
246 3300005434 Ga0070709_10035320 Ga0070709_100353203 173
247 3300005434 Ga0070709_10310753 Ga0070709_103107531 173
248 3300005435 Ga0070714_100030181 Ga0070714_1000301812 173
249 3300005444 Ga0070694_100235170 Ga0070694_1002351702 173
250 3300005456 Ga0070678_101567056 Ga0070678_1015670561 173
251 3300005458 Ga0070681_10014820 Ga0070681_100148205 173
252 3300005458 Ga0070681_10026771 Ga0070681_100267715 173
253 3300005518 Ga0070699_100229044 Ga0070699_1002290443 173
254 3300005535 Ga0070684_100025558 Ga0070684_1000255586 173
255 3300005539 Ga0068853_101302920 Ga0068853_1013029201 173
256 3300005545 Ga0070695_100021238 Ga0070695_1000212382 173
257 3300005548 Ga0070665_100337746 Ga0070665_1003377462 173
258 3300005563 Ga0068855_100001037 Ga0068855_10000103714 173
259 3300005719 Ga0068861_100010429 Ga0068861_1000104296 173
260 3300005842 Ga0068858_100726675 Ga0068858_1007266752 173
261 3300005844 Ga0068862_100131523 Ga0068862_1001315233 173
262 3300005937 Ga0081455_10000057 Ga0081455_1000005721 173
263 3300005985 Ga0081539_10000038 Ga0081539_10000038234 173
264 3300006237 Ga0097621_100586124 Ga0097621_1005861242 173
265 3300006237 Ga0097621_101233752 Ga0097621_1012337522 173
266 3300006358 Ga0068871_100419146 Ga0068871_1004191462 173
267 3300009093 Ga0105240_10344273 Ga0105240_103442732 173
268 3300009098 Ga0105245_10761294 Ga0105245_107612942 173
269 3300009551 Ga0105238_11184384 Ga0105238_111843841 173
270 3300009553 Ga0105249_10212896 Ga0105249_102128963 173
271 3300013105 Ga0157369_10148671 Ga0157369_101486714 173
272 3300014325 Ga0163163_11233371 Ga0163163_112333711 173
273 3300021377 Ga0213874_10103921 Ga0213874_101039212 173
274 3300025898 Ga0207692_10148310 Ga0207692_101483102 173
275 3300025906 Ga0207699_10037269 Ga0207699_100372693 173
276 3300025906 Ga0207699_10090182 Ga0207699_100901822 173
277 3300025912 Ga0207707_10003173 Ga0207707_100031735 173
278 3300025912 Ga0207707_10028857 Ga0207707_100288574 173
279 3300025913 Ga0207695_10019323 Ga0207695_100193237 173
280 3300025913 Ga0207695_10083519 Ga0207695_100835193 173
281 3300025913 Ga0207695_10450806 Ga0207695_104508062 173
282 3300025914 Ga0207671_10170205 Ga0207671_101702052 173
283 3300025917 Ga0207660_10154717 Ga0207660_101547173 173
284 3300025917 Ga0207660_10195431 Ga0207660_101954311 173
285 3300025929 Ga0207664_10098002 Ga0207664_100980022 173
286 3300025949 Ga0207667_10016427 Ga0207667_100164276 173
287 3300025961 Ga0207712_10148861 Ga0207712_101488612 173
288 3300026041 Ga0207639_11516275 Ga0207639_115162751 173
289 3300026118 Ga0207675_100044390 Ga0207675_1000443905 173
290 3300028379 Ga0268266_10310554 Ga0268266_103105542 173
291 3300028380 Ga0268265_10117919 Ga0268265_101179192 173
292 3300028381 Ga0268264_10754254 Ga0268264_107542542 173
293 3300028573 Ga0265334_10225268 Ga0265334_102252681 173
294 3300028800 Ga0265338_10149324 Ga0265338_101493243 173
295 3300031247 Ga0265340_10031556 Ga0265340_100315562 173
296 3300031250 Ga0265331_10003719 Ga0265331_100037194 173
297 3300031507 Ga0307509_10288603 Ga0307509_102886032 173
298 3300031730 Ga0307516_10494927 Ga0307516_104949272 173
299 3300035084 Ga0373928_0118048 Ga0373928_0118048_142_663 173
300 3300037853 Ga0436364_0511138 Ga0436364_0511138_193_714 173
301 3300037853 Ga0436364_1433804 Ga0436364_1433804_120_641 173
302 3300039438 Ga0436360_1260296 Ga0436360_1260296_540_1064 173
303 3300039447 Ga0436361_1173204 Ga0436361_1173204_669_1190 173
304 3300039450 Ga0436363_0944041 Ga0436363_0944041_860_1381 173
305 3300044693 Ga0466961_0109819 Ga0466961_0109819_245_766 173
306 3300044719 Ga0466971_0129466 Ga0466971_0129466_45_566 173
307 3300044735 Ga0466968_0015970 Ga0466968_0015970_1359_1880 173
308 3300044901 Ga0466960_0030401 Ga0466960_0030401_1823_2344 173
309 3300045049 Ga0466959_0006207 Ga0466959_0006207_7470_7991 173
310 3300045049 Ga0466959_0042845 Ga0466959_0042845_1366_1887 173
311 3300046519 Ga0495632_0312520 Ga0495632_0312520_111_632 173
312 3300048905 Ga0496102_0015062 Ga0496102_0015062_258_779 173
313 3300048921 Ga0496118_0127266 Ga0496118_0127266_816_1337 173
314 3300050513 nmdc:mga0rr50_623801_c1 nmdc:mga0rr50_623801_c1_209_730 173
315 3300053090 Ga0500646_0153609 Ga0500646_0153609_169_690 173
316 3300053092 Ga0500583_0009635 Ga0500583_0009635_757_1278 173
317 3300053098 Ga0500650_0172459 Ga0500650_0172459_311_832 173
318 3300053130 Ga0500642_0274619 Ga0500642_0274619_213_734 173
319 3300053133 Ga0500655_004693 Ga0500655_004693_1812_2333 173
320 3300053134 Ga0500658_0028219 Ga0500658_0028219_189_710 173
321 3300053139 Ga0500568_0197249 Ga0500568_0197249_163_684 173
322 3300053146 Ga0500588_0004234 Ga0500588_0004234_984_1505 173
323 3300053147 Ga0500589_240320 Ga0500589_240320_110_631 173
324 3300053158 Ga0500627_0256826 Ga0500627_0256826_63_584 173
325 2162886006 SwRhRL3b_contig_177223 SwRhRL3b_0834.00001610 174
326 2162886007 SwRhRL2b_contig_2453594 SwRhRL2b_0680.00000710 174
327 3300002070 JGI24750J21931_1017657 JGI24750J21931_10176571 174
328 3300005289 Ga0065704_10183317 Ga0065704_101833172 174
329 3300005295 Ga0065707_10084023 Ga0065707_100840236 174
330 3300005329 Ga0070683_100748313 Ga0070683_1007483132 174
331 3300005330 Ga0070690_100016306 Ga0070690_1000163065 174
332 3300005335 Ga0070666_10000825 Ga0070666_1000082510 174
333 3300005335 Ga0070666_10001705 Ga0070666_100017055 174
334 3300005335 Ga0070666_10018124 Ga0070666_100181244 174
335 3300005335 Ga0070666_10037127 Ga0070666_100371272 174
336 3300005336 Ga0070680_100042749 Ga0070680_1000427495 174
337 3300005336 Ga0070680_100592338 Ga0070680_1005923381 174
338 3300005337 Ga0070682_100101279 Ga0070682_1001012792 174
339 3300005338 Ga0068868_100001561 Ga0068868_10000156111 174
340 3300005338 Ga0068868_100076840 Ga0068868_1000768402 174
341 3300005341 Ga0070691_10054009 Ga0070691_100540093 174
342 3300005355 Ga0070671_100010657 Ga0070671_1000106573 174
343 3300005355 Ga0070671_100048018 Ga0070671_1000480183 174
344 3300005355 Ga0070671_100048894 Ga0070671_1000488942 174
345 3300005364 Ga0070673_100013882 Ga0070673_1000138826 174
346 3300005364 Ga0070673_100116901 Ga0070673_1001169013 174
347 3300005367 Ga0070667_100000116 Ga0070667_1000001169 174
348 3300005367 Ga0070667_100000809 Ga0070667_1000008094 174
349 3300005367 Ga0070667_100009226 Ga0070667_1000092265 174
350 3300005367 Ga0070667_100018866 Ga0070667_1000188664 174
351 3300005434 Ga0070709_10459081 Ga0070709_104590812 174
352 3300005435 Ga0070714_100018526 Ga0070714_1000185266 174
353 3300005435 Ga0070714_100340839 Ga0070714_1003408391 174
354 3300005436 Ga0070713_100003775 Ga0070713_1000037756 174
355 3300005436 Ga0070713_100032889 Ga0070713_1000328894 174
356 3300005436 Ga0070713_100589677 Ga0070713_1005896772 174
357 3300005439 Ga0070711_100000263 Ga0070711_10000026311 174
358 3300005439 Ga0070711_101080016 Ga0070711_1010800161 174
359 3300005456 Ga0070678_100000129 Ga0070678_10000012917 174
360 3300005458 Ga0070681_10005968 Ga0070681_100059689 174
361 3300005458 Ga0070681_10020355 Ga0070681_100203554 174
362 3300005458 Ga0070681_10173564 Ga0070681_101735643 174
363 3300005459 Ga0068867_100502754 Ga0068867_1005027542 174
364 3300005466 Ga0070685_10898285 Ga0070685_108982851 174
365 3300005530 Ga0070679_100061132 Ga0070679_1000611323 174
366 3300005530 Ga0070679_100061488 Ga0070679_1000614885 174
367 3300005539 Ga0068853_100877703 Ga0068853_1008777031 174
368 3300005544 Ga0070686_100105361 Ga0070686_1001053613 174
369 3300005546 Ga0070696_100134617 Ga0070696_1001346172 174
370 3300005546 Ga0070696_100329379 Ga0070696_1003293792 174
371 3300005548 Ga0070665_100009357 Ga0070665_1000093575 174
372 3300005548 Ga0070665_100015218 Ga0070665_1000152185 174
373 3300005548 Ga0070665_100029947 Ga0070665_1000299475 174
374 3300005548 Ga0070665_100035039 Ga0070665_1000350392 174
375 3300005549 Ga0070704_100386752 Ga0070704_1003867522 174
376 3300005563 Ga0068855_100025633 Ga0068855_1000256336 174
377 3300005563 Ga0068855_100895068 Ga0068855_1008950682 174
378 3300005563 Ga0068855_100995790 Ga0068855_1009957902 174
379 3300005614 Ga0068856_100018387 Ga0068856_1000183873 174
380 3300005617 Ga0068859_100000196 Ga0068859_10000019649 174
381 3300005617 Ga0068859_100192899 Ga0068859_1001928992 174
382 3300005617 Ga0068859_102294138 Ga0068859_1022941381 174
383 3300005618 Ga0068864_100005637 Ga0068864_1000056379 174
384 3300005718 Ga0068866_10001569 Ga0068866_100015696 174
385 3300005718 Ga0068866_10028941 Ga0068866_100289413 174
386 3300005719 Ga0068861_100117764 Ga0068861_1001177643 174
387 3300005834 Ga0068851_10026731 Ga0068851_100267313 174
388 3300005841 Ga0068863_100001617 Ga0068863_10000161720 174
389 3300005841 Ga0068863_100064177 Ga0068863_1000641774 174
390 3300005841 Ga0068863_100196358 Ga0068863_1001963582 174
391 3300005841 Ga0068863_100274406 Ga0068863_1002744062 174
392 3300005842 Ga0068858_100004518 Ga0068858_1000045186 174
393 3300005842 Ga0068858_100006646 Ga0068858_10000664610 174
394 3300005843 Ga0068860_100005516 Ga0068860_1000055161 174
395 3300005843 Ga0068860_100006186 Ga0068860_1000061865 174
396 3300005843 Ga0068860_100015455 Ga0068860_1000154555 174
397 3300005844 Ga0068862_100460009 Ga0068862_1004600093 174
398 3300006163 Ga0070715_10006658 Ga0070715_100066582 174
399 3300006163 Ga0070715_10164930 Ga0070715_101649302 174
400 3300006173 Ga0070716_100027399 Ga0070716_1000273992 174
401 3300006173 Ga0070716_100133894 Ga0070716_1001338943 174
402 3300006173 Ga0070716_100595851 Ga0070716_1005958512 174
403 3300006175 Ga0070712_100006678 Ga0070712_1000066786 174
404 3300006175 Ga0070712_100070870 Ga0070712_1000708702 174
405 3300006237 Ga0097621_100006379 Ga0097621_1000063796 174
406 3300006237 Ga0097621_100012611 Ga0097621_1000126116 174
407 3300006358 Ga0068871_100023046 Ga0068871_1000230466 174
408 3300006358 Ga0068871_100103575 Ga0068871_1001035753 174
409 3300006881 Ga0068865_100023316 Ga0068865_1000233162 174
410 3300006881 Ga0068865_100092153 Ga0068865_1000921532 174
411 3300006914 Ga0075436_100057368 Ga0075436_1000573682 174
412 3300006931 Ga0097620_100000196 Ga0097620_1000001965 174
413 3300006931 Ga0097620_100192898 Ga0097620_1001928983 174
414 3300006931 Ga0097620_102295545 Ga0097620_1022955451 174
415 3300007788 Ga0099795_10000034 Ga0099795_1000003426 174
416 3300009011 Ga0105251_10293355 Ga0105251_102933551 174
417 3300009093 Ga0105240_10002425 Ga0105240_100024259 174
418 3300009093 Ga0105240_10264502 Ga0105240_102645022 174
419 3300009093 Ga0105240_10800909 Ga0105240_108009092 174
420 3300009093 Ga0105240_11432824 Ga0105240_114328242 174
421 3300009098 Ga0105245_10009828 Ga0105245_100098285 174
422 3300009098 Ga0105245_10011723 Ga0105245_100117236 174
423 3300009101 Ga0105247_10007392 Ga0105247_100073922 174
424 3300009101 Ga0105247_10029035 Ga0105247_100290354 174
425 3300009101 Ga0105247_10076456 Ga0105247_100764563 174
426 3300009148 Ga0105243_10457762 Ga0105243_104577622 174
427 3300009174 Ga0105241_10044123 Ga0105241_100441232 174
428 3300009176 Ga0105242_10001505 Ga0105242_1000150511 174
429 3300009176 Ga0105242_10006373 Ga0105242_100063735 174
430 3300009177 Ga0105248_10002404 Ga0105248_1000240410 174
431 3300009177 Ga0105248_10010045 Ga0105248_100100454 174
432 3300009177 Ga0105248_10010440 Ga0105248_100104408 174
433 3300009177 Ga0105248_10109384 Ga0105248_101093845 174
434 3300009551 Ga0105238_10000966 Ga0105238_1000096627 174
435 3300009551 Ga0105238_10027386 Ga0105238_100273863 174
436 3300009551 Ga0105238_10037863 Ga0105238_100378632 174
437 3300009551 Ga0105238_10415859 Ga0105238_104158592 174
438 3300009553 Ga0105249_10015712 Ga0105249_100157126 174
439 3300009553 Ga0105249_10108489 Ga0105249_101084892 174
440 3300010159 Ga0099796_10000042 Ga0099796_1000004217 174
441 3300010375 Ga0105239_10019609 Ga0105239_100196096 174
442 3300010375 Ga0105239_10317592 Ga0105239_103175921 174
443 3300010375 Ga0105239_11393335 Ga0105239_113933351 174
444 3300013100 Ga0157373_10135919 Ga0157373_101359193 174
445 3300013104 Ga0157370_10004643 Ga0157370_1000464311 174
446 3300013105 Ga0157369_10044939 Ga0157369_100449392 174
447 3300013105 Ga0157369_10203429 Ga0157369_102034292 174
448 3300013296 Ga0157374_10001326 Ga0157374_100013265 174
449 3300013296 Ga0157374_10014106 Ga0157374_100141062 174
450 3300013297 Ga0157378_10011814 Ga0157378_100118145 174
451 3300013306 Ga0163162_10026906 Ga0163162_100269065 174
452 3300013306 Ga0163162_10160254 Ga0163162_101602542 174
453 3300013307 Ga0157372_10138209 Ga0157372_101382093 174
454 3300013307 Ga0157372_10241175 Ga0157372_102411753 174
455 3300013308 Ga0157375_10062319 Ga0157375_100623195 174
456 3300014968 Ga0157379_10002640 Ga0157379_100026405 174
457 3300014968 Ga0157379_10034571 Ga0157379_100345716 174
458 3300014968 Ga0157379_10186075 Ga0157379_101860751 174
459 3300014968 Ga0157379_10326670 Ga0157379_103266702 174
460 3300014969 Ga0157376_10017747 Ga0157376_100177475 174
461 3300014969 Ga0157376_10047983 Ga0157376_100479835 174
462 3300015262 Ga0182007_10065640 Ga0182007_100656402 174
463 3300017792 Ga0163161_10117965 Ga0163161_101179653 174
464 3300020081 Ga0206354_10136901 Ga0206354_101369012 174
465 3300020082 Ga0206353_10401490 Ga0206353_104014902 174
466 3300021361 Ga0213872_10165784 Ga0213872_101657842 174
467 3300021377 Ga0213874_10008195 Ga0213874_100081952 174
468 3300021384 Ga0213876_10025709 Ga0213876_100257092 174
469 3300021441 Ga0213871_10023011 Ga0213871_100230112 174
470 3300024227 Ga0228598_1018914 Ga0228598_10189141 174
471 3300025898 Ga0207692_10782059 Ga0207692_107820591 174
472 3300025899 Ga0207642_10010284 Ga0207642_100102844 174
473 3300025900 Ga0207710_10000134 Ga0207710_1000013446 174
474 3300025903 Ga0207680_10022394 Ga0207680_100223942 174
475 3300025903 Ga0207680_10044186 Ga0207680_100441864 174
476 3300025903 Ga0207680_10150480 Ga0207680_101504802 174
477 3300025906 Ga0207699_10008419 Ga0207699_100084192 174
478 3300025906 Ga0207699_10009199 Ga0207699_100091992 174
479 3300025909 Ga0207705_10133043 Ga0207705_101330433 174
480 3300025912 Ga0207707_10001543 Ga0207707_1000154313 174
481 3300025912 Ga0207707_10051661 Ga0207707_100516613 174
482 3300025912 Ga0207707_10067384 Ga0207707_100673844 174
483 3300025912 Ga0207707_10083596 Ga0207707_100835964 174
484 3300025912 Ga0207707_10088373 Ga0207707_100883733 174
485 3300025913 Ga0207695_10016760 Ga0207695_100167606 174
486 3300025913 Ga0207695_10056194 Ga0207695_100561943 174
487 3300025913 Ga0207695_10508252 Ga0207695_105082521 174
488 3300025913 Ga0207695_10897266 Ga0207695_108972661 174
489 3300025914 Ga0207671_10251384 Ga0207671_102513843 174
490 3300025914 Ga0207671_11065719 Ga0207671_110657191 174
491 3300025915 Ga0207693_10000060 Ga0207693_1000006068 174
492 3300025916 Ga0207663_10095510 Ga0207663_100955103 174
493 3300025916 Ga0207663_10214000 Ga0207663_102140002 174
494 3300025916 Ga0207663_10914313 Ga0207663_109143131 174
495 3300025917 Ga0207660_10008463 Ga0207660_100084636 174
496 3300025917 Ga0207660_10081294 Ga0207660_100812943 174
497 3300025919 Ga0207657_10158674 Ga0207657_101586742 174
498 3300025920 Ga0207649_10074366 Ga0207649_100743663 174
499 3300025921 Ga0207652_10004353 Ga0207652_100043534 174
500 3300025921 Ga0207652_10088628 Ga0207652_100886283 174
501 3300025924 Ga0207694_10007297 Ga0207694_100072976 174
502 3300025924 Ga0207694_10177420 Ga0207694_101774202 174
503 3300025924 Ga0207694_10200503 Ga0207694_102005032 174
504 3300025927 Ga0207687_10020018 Ga0207687_100200184 174
505 3300025928 Ga0207700_10036854 Ga0207700_100368544 174
506 3300025928 Ga0207700_10107088 Ga0207700_101070882 174
507 3300025928 Ga0207700_10427089 Ga0207700_104270892 174
508 3300025928 Ga0207700_10599524 Ga0207700_105995242 174
509 3300025929 Ga0207664_10026898 Ga0207664_100268985 174
510 3300025929 Ga0207664_10303019 Ga0207664_103030192 174
511 3300025931 Ga0207644_10028162 Ga0207644_100281624 174
512 3300025931 Ga0207644_10451303 Ga0207644_104513032 174
513 3300025931 Ga0207644_10624763 Ga0207644_106247632 174
514 3300025933 Ga0207706_10303335 Ga0207706_103033351 174
515 3300025934 Ga0207686_10029965 Ga0207686_100299654 174
516 3300025934 Ga0207686_10220486 Ga0207686_102204862 174
517 3300025935 Ga0207709_10812924 Ga0207709_108129241 174
518 3300025937 Ga0207669_10577357 Ga0207669_105773571 174
519 3300025938 Ga0207704_10010187 Ga0207704_100101872 174
520 3300025939 Ga0207665_10013127 Ga0207665_100131273 174
521 3300025939 Ga0207665_10062406 Ga0207665_100624062 174
522 3300025939 Ga0207665_10212608 Ga0207665_102126082 174
523 3300025941 Ga0207711_10016352 Ga0207711_100163524 174
524 3300025941 Ga0207711_10033562 Ga0207711_100335624 174
525 3300025941 Ga0207711_10264937 Ga0207711_102649373 174
526 3300025941 Ga0207711_10611543 Ga0207711_106115432 174
527 3300025941 Ga0207711_10682763 Ga0207711_106827632 174
528 3300025942 Ga0207689_10705373 Ga0207689_107053731 174
529 3300025944 Ga0207661_10609646 Ga0207661_106096461 174
530 3300025949 Ga0207667_10100314 Ga0207667_101003144 174
531 3300025949 Ga0207667_10799060 Ga0207667_107990602 174
532 3300025960 Ga0207651_10103967 Ga0207651_101039673 174
533 3300025961 Ga0207712_10073839 Ga0207712_100738393 174
534 3300025986 Ga0207658_10000746 Ga0207658_100007469 174
535 3300025986 Ga0207658_10032600 Ga0207658_100326005 174
536 3300025986 Ga0207658_10035725 Ga0207658_100357252 174
537 3300026023 Ga0207677_10355308 Ga0207677_103553082 174
538 3300026035 Ga0207703_10006491 Ga0207703_100064918 174
539 3300026035 Ga0207703_10130641 Ga0207703_101306412 174
540 3300026035 Ga0207703_10643681 Ga0207703_106436812 174
541 3300026041 Ga0207639_10823011 Ga0207639_108230111 174
542 3300026078 Ga0207702_10109134 Ga0207702_101091342 174
543 3300026088 Ga0207641_10032206 Ga0207641_100322064 174
544 3300026088 Ga0207641_10332765 Ga0207641_103327652 174
545 3300026088 Ga0207641_11744600 Ga0207641_117446002 174
546 3300026089 Ga0207648_10427578 Ga0207648_104275782 174
547 3300026089 Ga0207648_10584002 Ga0207648_105840022 174
548 3300026118 Ga0207675_100073376 Ga0207675_1000733763 174
549 3300026121 Ga0207683_10000725 Ga0207683_1000072517 174
550 3300027512 Ga0209179_1000027 Ga0209179_100002713 174
551 3300028379 Ga0268266_10004065 Ga0268266_100040656 174
552 3300028379 Ga0268266_10028183 Ga0268266_100281836 174
553 3300028379 Ga0268266_10059617 Ga0268266_100596175 174
554 3300028380 Ga0268265_10977123 Ga0268265_109771232 174
555 3300028381 Ga0268264_10287304 Ga0268264_102873042 174
556 3300028563 Ga0265319_1029612 Ga0265319_10296122 174
557 3300028577 Ga0265318_10001026 Ga0265318_100010268 174
558 3300030521 Ga0307511_10000205 Ga0307511_1000020519 174
559 3300030521 Ga0307511_10114181 Ga0307511_101141813 174
560 3300031235 Ga0265330_10003872 Ga0265330_100038724 174
561 3300031238 Ga0265332_10003323 Ga0265332_100033236 174
562 3300031242 Ga0265329_10001089 Ga0265329_100010895 174
563 3300031249 Ga0265339_10049675 Ga0265339_100496753 174
564 3300031250 Ga0265331_10002553 Ga0265331_100025535 174
565 3300031344 Ga0265316_10008890 Ga0265316_100088906 174
566 3300031507 Ga0307509_10000167 Ga0307509_1000016785 174
567 3300031711 Ga0265314_10002268 Ga0265314_100022687 174
568 3300033180 Ga0307510_10000009 Ga0307510_10000009183 174
569 3300035113 Ga0373936_0016115 Ga0373936_0016115_993_1517 174
570 3300035118 Ga0373954_0108224 Ga0373954_0108224_492_1016 174
571 3300035118 Ga0373954_0199791 Ga0373954_0199791_211_735 174
572 3300035120 Ga0373957_0219378 Ga0373957_0219378_145_669 174
573 3300035172 Ga0373955_0038433 Ga0373955_0038433_1305_1829 174
574 3300035172 Ga0373955_0044023 Ga0373955_0044023_825_1349 174
575 3300035172 Ga0373955_0609909 Ga0373955_0609909_26_550 174
576 3300035695 Ga0373927_0049029 Ga0373927_0049029_576_1100 174
577 3300035724 Ga0373933_0011477 Ga0373933_0011477_1672_2196 174
578 3300035725 Ga0373947_0060514 Ga0373947_0060514_1130_1654 174
579 3300036401 Ga0373937_0001197 Ga0373937_0001197_14084_14608 174
580 3300036401 Ga0373937_0041078 Ga0373937_0041078_1907_2431 174
581 3300037068 Ga0373925_0247830 Ga0373925_0247830_226_750 174
582 3300039438 Ga0436360_0281290 Ga0436360_0281290_454_978 174
583 3300039447 Ga0436361_1163383 Ga0436361_1163383_776_1300 174
584 3300039450 Ga0436363_0138643 Ga0436363_0138643_1851_2375 174
585 3300039450 Ga0436363_1121322 Ga0436363_1121322_5337_5861 174
586 3300039450 Ga0436363_1643864 Ga0436363_1643864_67_591 174
587 3300046472 Ga0495580_0062193 Ga0495580_0062193_406_930 174
588 3300046472 Ga0495580_0147970 Ga0495580_0147970_723_1247 174
589 3300046472 Ga0495580_0313653 Ga0495580_0313653_125_649 174
590 3300046492 Ga0495585_0331932 Ga0495585_0331932_114_644 174
591 3300046506 Ga0495583_0060331 Ga0495583_0060331_1081_1605 174
592 3300046516 Ga0495628_0071937 Ga0495628_0071937_1439_1963 174
593 3300046517 Ga0495630_0392822 Ga0495630_0392822_397_921 174
594 3300046533 Ga0495640_0292042 Ga0495640_0292042_399_923 174
595 3300046536 Ga0495587_0045287 Ga0495587_0045287_1461_1985 174
596 3300046543 Ga0495645_0379916 Ga0495645_0379916_44_568 174
597 3300046675 Ga0495657_0295280 Ga0495657_0295280_243_767 174
598 3300046679 Ga0495623_0110944 Ga0495623_0110944_762_1286 174
599 3300046683 Ga0495658_0307157 Ga0495658_0307157_262_807 174
600 3300046809 Ga0495600_0305618 Ga0495600_0305618_93_617 174
601 3300047444 Ga0495675_0127150 Ga0495675_0127150_1017_1541 174
602 3300047673 Ga0495593_0501870 Ga0495593_0501870_50_574 174
603 3300048088 Ga0495602_0106535 Ga0495602_0106535_910_1434 174
604 3300048903 Ga0496100_1074130 Ga0496100_1074130_16_561 174
605 3300048904 Ga0496101_0002164 Ga0496101_0002164_2814_3338 174
606 3300048905 Ga0496102_0067437 Ga0496102_0067437_1587_2111 174
607 3300048905 Ga0496102_0088319 Ga0496102_0088319_2042_2566 174
608 3300048906 Ga0496103_0100853 Ga0496103_0100853_1139_1663 174
609 3300048907 Ga0496104_0196072 Ga0496104_0196072_789_1313 174
610 3300048908 Ga0496105_0011414 Ga0496105_0011414_3059_3583 174
611 3300048908 Ga0496105_0020408 Ga0496105_0020408_3128_3673 174
612 3300048909 Ga0496106_0340156 Ga0496106_0340156_153_677 174
613 3300048909 Ga0496106_0508579 Ga0496106_0508579_365_889 174
614 3300048910 Ga0496107_0009320 Ga0496107_0009320_4631_5155 174
615 3300048911 Ga0496108_0006755 Ga0496108_0006755_1644_2168 174
616 3300048911 Ga0496108_0124832 Ga0496108_0124832_1522_2067 174
617 3300048912 Ga0496109_0001391 Ga0496109_0001391_13262_13786 174
618 3300048912 Ga0496109_0030449 Ga0496109_0030449_4085_4630 174
619 3300048913 Ga0496110_0005095 Ga0496110_0005095_2626_3150 174
620 3300048913 Ga0496110_0147271 Ga0496110_0147271_418_963 174
621 3300048914 Ga0496111_0003948 Ga0496111_0003948_98_622 174
622 3300048915 Ga0496112_0075507 Ga0496112_0075507_241_765 174
623 3300048916 Ga0496113_0014370 Ga0496113_0014370_3271_3795 174
624 3300048917 Ga0496114_0130769 Ga0496114_0130769_183_707 174
625 3300048918 Ga0496115_0177255 Ga0496115_0177255_1034_1558 174
626 3300048924 Ga0496121_0000772 Ga0496121_0000772_28811_29335 174
627 3300048928 Ga0496125_0001407 Ga0496125_0001407_5429_5953 174
628 3300050514 nmdc:mga08x19_54419_c1 nmdc:mga08x19_54419_c1_1068_1592 174
629 3300053077 Ga0495601_0290053 Ga0495601_0290053_454_978 174
630 3300053104 Ga0500556_0000174 Ga0500556_0000174_1863_2387 174
631 3300053136 Ga0500559_0043615 Ga0500559_0043615_593_1117 174
632 3300053163 Ga0500639_018575 Ga0500639_018575_1911_2435 174
633 3300053735 Ga0500596_058780 Ga0500596_058780_50_574 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

17

162

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i0i-assembly1.cif.gz_A analysis of an invariant aspartic acid in hprts-glutamine mutant 0.8228 127 160
4rqa-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (orthorhombic space group) 0.8102 125 160
7cmj-assembly1.cif.gz_A-2 crystal structure of l.donovani hypoxanthine-guanine phosphoribosyl transferase (hgprt) 0.7933 122 160
1i13-assembly1.cif.gz_A analysis of an invariant aspartic acid in hprts-alanine mutant 0.7927 122 160
4rqb-assembly1.cif.gz_A crystal structure of a hypoxanthine phosphoribosyltransferase (target id nysgrc-029686) from staphylococcus aureus (tetragonal space group) 0.7842 122 160
ID Description Score Start End Superfamily
af_Q8ILM5_15_201_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7311 122 159 3.30.420.40
af_P47117_6_208_3.60.160.10 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Mitochondrial biogenesis AIM24 0.7274 122 159 3.60.160.10
4icsB01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.719 126 160 3.40.1830.10
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7142 121 161 3.40.50.620
af_Q54Z95_1_113_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6585 119 164 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A534ANQ5-F1-model_v4 Uncharacterized protein 0.8423 73 174
AF-A0A534ANQ5-F1-model_v4 Uncharacterized protein 0.8347 73 174
AF-X1GAR8-F1-model_v4 Uncharacterized protein 0.7713 55 163
AF-A0A3E0X334-F1-model_v4 Biopolymer transporter ExbD 0.7617 44 170 GO:0005886
GO:0015031
GO:0022857
AF-A0A1G7D1J3-F1-model_v4 BlaR1 peptidase M56 0.7595 69 164 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.15 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map