F471306

General Info

Members Datasets Scaffolds Average Seq Length
636 366 1272 305

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10074345|Ga0065714_100743453
Length 359
Sequence MPNCASSHKFFTENHVSSIPRANVGKGPLRPRHRNTIPRPDGPDFPELRTISFIFQPMPAPDLSSRQLRAFTALAEQRNFTRAAETCHLSQPAFSALIRTLEETLGARLFDRDTRSVQLTPEGRLFEPSARRLLDDMQGAIGDLADHTQRRKGRVSVAALPSLAAGWLPAILAEFMQAWPGITVELHDALSDACIAQLRSHQADFALAATGAGAAAASDLRGRKLCDDRFHLVCRKDHALATVPRLTAKQLAPWPFIQMARNSSVRQSLDVALHPLRLNAVFEVEHLATVMGLVEAGIGISVVPELTLFHFRRDTLVTRPLPLPGLTRTIYLVQRREGSLSVAAQTLHDLILARLGTLN

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
138 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
139 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
140 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
169 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
170 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
171 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
174 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
177 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
180 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
275 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
278 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
283 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
284 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
293 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
294 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
299 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
302 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
303 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
304 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
305 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
306 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
307 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
308 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
309 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
310 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
311 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
312 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
313 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
314 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
315 2643221658 Variovorax sp. Root411 Isolate Unclassified
316 2643221672 Variovorax sp. Root434 Isolate Unclassified
317 2643221683 Variovorax sp. Root473 Isolate Unclassified
318 2738541277 Variovorax sp. GV051 Isolate Unclassified
319 2738541307 Variovorax sp. GV008 Isolate Unclassified
320 2738543013 Variovorax sp. BT01 Isolate Unclassified
321 2738543019 Variovorax sp. GV040 Isolate Unclassified
322 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
323 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
324 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
325 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
326 2818991436 Collimonas arenae 515 Isolate Unclassified
327 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
328 2818991446 Variovorax sp. 1180 Isolate Unclassified
329 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
330 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
331 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
332 2842677519 Variovorax sp. R-72495 Isolate Unclassified
333 2842733646 Variovorax sp. R-72446 Isolate Unclassified
334 2842747753 Variovorax sp. R-72060 Isolate Unclassified
335 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
336 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
337 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
338 2855730933 Achromobacter sp. HZ28 Isolate Nodule
339 2855767633 Achromobacter sp. HZ34 Isolate Nodule
340 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
341 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
342 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
343 2885198086 Variovorax sp. 679 Isolate Unclassified
344 2885211737 Variovorax sp. 553 Isolate Unclassified
345 2885266251 Ralstonia sp. SET104 Isolate Nodule
346 2899924645 Variovorax sp. 369 Isolate Unclassified
347 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
348 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
349 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
350 2904456579 Variovorax sp. 2002 Isolate Unclassified
351 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
352 2928037797 Variovorax sp. 1126 Isolate Unclassified
353 2928044640 Variovorax sp. 1128 Isolate Unclassified
354 2928051484 Variovorax sp. 1133 Isolate Unclassified
355 2928058823 Ralstonia sp. 1138 Isolate Unclassified
356 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
357 2928070936 Variovorax gossypii 1167 Isolate Unclassified
358 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
359 2929520902 Variovorax beijingensis 502 Isolate Unclassified
360 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
361 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
362 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
363 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
364 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
365 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
366 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 1.1
Isolates 10.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.09
Nodule 2.2
Rhizoplane 1.26
Rhizosphere 43.87
Stem 0
Stem Tuber 0.16
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10074345 3300005288 Bacteria 3032
2 JGI24741J21665_1000174 3300001915 Bacteria 18584
3 JGI24740J21852_10000852 3300001979 Bacteria 13458
4 JGI24740J21852_10001192 3300001979 Bacteria 11728
5 JGI24740J21852_10004237 3300001979 Bacteria 6182
6 JGI24740J21852_10043788 3300001979 Bacteria 1332
7 JGI25155J39150_1000357 3300002704 Bacteria 14284
8 JGI25156J39149_1000398 3300002705 Bacteria 27303
9 JGI25162J39368_1000026 3300002737 Bacteria 227710
10 JGI25162J39368_1000027 3300002737 Bacteria 223163
11 JGI25154J39366_1000241 3300002738 Bacteria 35875
12 JGI25154J39366_1000349 3300002738 Bacteria 26415
13 JGI25154J39366_1000405 3300002738 Bacteria 23503
14 JGI25154J39366_1001245 3300002738 Bacteria 9581
15 JGI25158J39367_1001439 3300002739 Bacteria 4171
16 JGI25157J39369_1000105 3300002741 Bacteria 71453
17 JGI25152J39213_1014378 3300002773 Bacteria 1608
18 JGI25150J39212_1000679 3300002774 Bacteria 12436
19 JGI25150J39212_1003302 3300002774 Bacteria 3798
20 JGI25159J45721_1005058 3300002987 Bacteria 4203
21 JGI25159J45721_1006953 3300002987 Bacteria 3307
22 JGI25159J45721_1017845 3300002987 Bacteria 1451
23 JGI25151J46595_10000045 3300003187 Bacteria 169207
24 JGI25151J46595_10000285 3300003187 Bacteria 57259
25 JGI25151J46595_10000412 3300003187 Bacteria 43739
26 JGI25151J46595_10001901 3300003187 Bacteria 13275
27 JGI25165J46597_1000031 3300003214 Bacteria 296858
28 JGI25153J46596_10010430 3300003215 Bacteria 4203
29 JGI25153J46596_10021547 3300003215 Bacteria 2399
30 rootL2_10070966 3300003322 Bacteria 8408
31 rootL2_10112703 3300003322 Bacteria 3205
32 JGI25160J50197_1007660 3300003354 Bacteria 4203
33 JGI25160J50197_1009350 3300003354 Bacteria 3645
34 JGI25160J50197_1014814 3300003354 Bacteria 2588
35 Ga0006562J51391_1047816 3300003578 Bacteria 2920
36 Ga0006562J51391_1047817 3300003578 Bacteria 1970
37 Ga0006562J51391_1126290 3300003578 Bacteria 1520
38 Ga0006562J51391_1126291 3300003578 Bacteria 1370
39 Ga0006562J51391_1128109 3300003578 Bacteria 1520
40 Ga0006562J51391_1128110 3300003578 Bacteria 1736
41 Ga0055538_1000018 3300003751 Bacteria 296858
42 Ga0055538_1003595 3300003751 Bacteria 1933
43 Ga0055539_1000023 3300003752 Bacteria 296858
44 Ga0055539_1000053 3300003752 Bacteria 165149
45 Ga0055533_1000031 3300003756 Bacteria 296858
46 Ga0055533_1002112 3300003756 Bacteria 4773
47 Ga0055532_1000033 3300003758 Bacteria 214652
48 Ga0055532_1000051 3300003758 Bacteria 165365
49 Ga0055525_1000039 3300003759 Bacteria 296858
50 Ga0055525_1000440 3300003759 Bacteria 24091
51 Ga0055525_1000621 3300003759 Bacteria 14565
52 Ga0055535_1000024 3300003761 Bacteria 214652
53 Ga0055535_1000274 3300003761 Bacteria 54132
54 Ga0055542_1000027 3300003762 Bacteria 254819
55 Ga0055529_1000044 3300003763 Bacteria 214652
56 Ga0055526_1002868 3300003771 Bacteria 11363
57 Ga0055526_1007438 3300003771 Bacteria 5688
58 Ga0055526_1009818 3300003771 Bacteria 4546
59 Ga0055526_1010720 3300003771 Bacteria 4228
60 Ga0055526_1010795 3300003771 Bacteria 4203
61 Ga0055537_1000006 3300003773 Bacteria 147020
62 Ga0055537_1000162 3300003773 Bacteria 50062
63 Ga0055537_1000445 3300003773 Bacteria 26375
64 Ga0055537_1002317 3300003773 Bacteria 6501
65 Ga0055537_1003980 3300003773 Bacteria 4363
66 Ga0055537_1004001 3300003773 Bacteria 4339
67 Ga0055537_1004177 3300003773 Bacteria 4203
68 Ga0055524_1000032 3300003775 Bacteria 182182
69 Ga0055524_1000690 3300003775 Bacteria 23658
70 Ga0055524_1008604 3300003775 Bacteria 4228
71 Ga0055524_1008676 3300003775 Bacteria 4203
72 Ga0055524_1038591 3300003775 Bacteria 1246
73 Ga0055536_1000163 3300003781 Bacteria 56770
74 Ga0055536_1003187 3300003781 Bacteria 8888
75 Ga0055536_1016958 3300003781 Bacteria 2408
76 Ga0055534_1000128 3300003784 Bacteria 56698
77 Ga0055534_1001699 3300003784 Bacteria 8395
78 Ga0055534_1003814 3300003784 Bacteria 4615
79 Ga0055534_1004269 3300003784 Bacteria 4203
80 Ga0055534_1005845 3300003784 Bacteria 3213
81 Ga0055528_1000504 3300003790 Bacteria 30737
82 Ga0055528_1006119 3300003790 Bacteria 5497
83 Ga0055528_1009033 3300003790 Bacteria 4203
84 Ga0055528_1012244 3300003790 Bacteria 3345
85 Ga0055530_10000328 3300003791 Bacteria 42975
86 Ga0055530_10000866 3300003791 Bacteria 24928
87 Ga0055530_10003406 3300003791 Bacteria 9074
88 Ga0055530_10014544 3300003791 Bacteria 2615
89 Ga0055540_1000046 3300003792 Bacteria 148762
90 Ga0055540_1000813 3300003792 Bacteria 21129
91 Ga0055540_1004807 3300003792 Bacteria 5937
92 Ga0055540_1007252 3300003792 Bacteria 4229
93 Ga0055531_10000428 3300003794 Bacteria 39914
94 Ga0055531_10002570 3300003794 Bacteria 12051
95 Ga0055531_10011137 3300003794 Bacteria 4378
96 Ga0055531_10014498 3300003794 Bacteria 3543
97 Ga0055531_10034955 3300003794 Bacteria 1584
98 Ga0055541_1000016 3300003841 Bacteria 296861
99 Ga0055541_1000303 3300003841 Bacteria 16411
100 Ga0055543_1003838 3300004625 Bacteria 4266
101 Ga0055543_1003866 3300004625 Bacteria 4241
102 Ga0065165_1007662 3300005262 Bacteria 5243
103 Ga0065165_1009778 3300005262 Bacteria 4241
104 Ga0070658_10134468 3300005327 Bacteria 2062
105 Ga0070660_100007159 3300005339 Bacteria 7757
106 Ga0070661_100000021 3300005344 Bacteria 128510
107 Ga0070669_100087562 3300005353 Bacteria 2329
108 Ga0070673_100445481 3300005364 Unclassified 1164
109 Ga0070659_100000839 3300005366 Bacteria 22393
110 Ga0070663_100000004 3300005455 Bacteria 254839
111 Ga0070679_100094032 3300005530 Bacteria 2985
112 Ga0068853_100005678 3300005539 Bacteria 9811
113 Ga0068853_100341405 3300005539 Bacteria 1392
114 Ga0068855_100120233 3300005563 Bacteria 3006
115 Ga0068855_100504858 3300005563 Bacteria 1314
116 Ga0068855_100510097 3300005563 Bacteria 1306
117 Ga0070664_100000007 3300005564 Bacteria 176744
118 Ga0068857_100016420 3300005577 Bacteria 6487
119 Ga0068854_100000045 3300005578 Bacteria 91844
120 Ga0068856_100000004 3300005614 Bacteria 233761
121 Ga0068856_100236266 3300005614 Bacteria 1843
122 Ga0075365_10001542 3300006038 Bacteria 10541
123 Ga0075363_100004545 3300006048 Bacteria 6083
124 Ga0075364_10003241 3300006051 Bacteria 9217
125 Ga0075364_10029645 3300006051 Bacteria 3510
126 Ga0075364_10082317 3300006051 Bacteria 2130
127 Ga0075432_10002170 3300006058 Bacteria 6527
128 Ga0075432_10017820 3300006058 Bacteria 2422
129 Ga0075362_10002812 3300006177 Bacteria 5938
130 Ga0075362_10095521 3300006177 Bacteria 1384
131 Ga0075366_10002392 3300006195 Bacteria 9626
132 Ga0075366_10016252 3300006195 Bacteria 4275
133 Ga0075366_10069943 3300006195 Bacteria 2090
134 Ga0075370_10000759 3300006353 Bacteria 12912
135 Ga0075370_10047873 3300006353 Bacteria 2421
136 Ga0079104_1007154 3300006946 Bacteria 4091
137 Ga0079104_1016174 3300006946 Bacteria 2189
138 Ga0079104_1020222 3300006946 Bacteria 1840
139 Ga0099826_10000065 3300006948 Bacteria 60649
140 Ga0099826_10000122 3300006948 Bacteria 35250
141 Ga0105251_10078738 3300009011 Bacteria 1526
142 Ga0105240_10014225 3300009093 Bacteria 10869
143 Ga0105240_10113980 3300009093 Bacteria 3266
144 Ga0105240_10264636 3300009093 Bacteria 1982
145 Ga0105240_10281036 3300009093 Bacteria 1912
146 Ga0105243_10017120 3300009148 Bacteria 5482
147 Ga0105239_10402938 3300010375 Bacteria 1548
148 Ga0157347_1000228 3300012502 Bacteria 3257
149 Ga0157373_10003146 3300013100 Bacteria 12471
150 Ga0157373_10037094 3300013100 Bacteria 3496
151 Ga0157371_10000001 3300013102 Bacteria 1162285
152 Ga0157371_10000028 3300013102 Bacteria 254964
153 Ga0157370_10000002 3300013104 Bacteria 431400
154 Ga0157370_10001308 3300013104 Bacteria 31056
155 Ga0157370_10224212 3300013104 Bacteria 1740
156 Ga0157369_10002517 3300013105 Bacteria 21909
157 Ga0157369_10007328 3300013105 Bacteria 12697
158 Ga0157372_10000619 3300013307 Bacteria 38787
159 Ga0182008_10001266 3300014497 Bacteria 17367
160 Ga0182008_10026396 3300014497 Bacteria 2946
161 Ga0182008_10113687 3300014497 Bacteria 1342
162 Ga0182006_1008186 3300015261 Bacteria 4742
163 Ga0182007_10004904 3300015262 Bacteria 5974
164 Ga0182005_1000252 3300015265 Bacteria 34129
165 Ga0183362_10001 3300015683 Bacteria 2046624
166 Ga0163161_10000079 3300017792 Bacteria 97522
167 Ga0163161_10001508 3300017792 Bacteria 17221
168 Ga0163161_10020413 3300017792 Bacteria 4649
169 Ga0163161_10087750 3300017792 Bacteria 2298
170 Ga0163161_10176756 3300017792 Bacteria 1635
171 Ga0206351_10260248 3300020077 Bacteria 2756
172 Ga0209435_100028 3300025206 Bacteria 182520
173 Ga0209435_100037 3300025206 Bacteria 124928
174 Ga0209760_101921 3300025207 Bacteria 2043
175 Ga0209436_102723 3300025208 Bacteria 5092
176 Ga0209784_100024 3300025224 Bacteria 394613
177 Ga0209784_100027 3300025224 Bacteria 363933
178 Ga0209784_100525 3300025224 Bacteria 14438
179 Ga0209784_101405 3300025224 Bacteria 3266
180 Ga0209566_100018 3300025225 Bacteria 448638
181 Ga0209566_100027 3300025225 Bacteria 363933
182 Ga0209566_100129 3300025225 Bacteria 92878
183 Ga0209674_100044 3300025226 Bacteria 363933
184 Ga0209674_100225 3300025226 Bacteria 51780
185 Ga0209674_100305 3300025226 Bacteria 33309
186 Ga0209674_100775 3300025226 Bacteria 10818
187 Ga0209672_100068 3300025228 Bacteria 175572
188 Ga0209672_104679 3300025228 Bacteria 2493
189 Ga0209147_100004 3300025229 Bacteria 1371850
190 Ga0209147_100008 3300025229 Bacteria 777096
191 Ga0209147_100940 3300025229 Bacteria 12877
192 Ga0209563_100039 3300025230 Bacteria 409717
193 Ga0209563_100048 3300025230 Bacteria 363933
194 Ga0209563_102266 3300025230 Bacteria 4444
195 Ga0207427_100616 3300025231 Bacteria 17528
196 Ga0209437_100053 3300025233 Bacteria 375580
197 Ga0209437_100055 3300025233 Bacteria 363933
198 Ga0209258_100013 3300025242 Bacteria 777096
199 Ga0209258_100048 3300025242 Bacteria 365881
200 Ga0209258_100398 3300025242 Bacteria 54737
201 Ga0207425_1000107 3300025245 Bacteria 77829
202 Ga0209646_1000021 3300025246 Bacteria 461083
203 Ga0209646_1000063 3300025246 Bacteria 248065
204 Ga0209646_1000095 3300025246 Bacteria 182520
205 Ga0209026_1000110 3300025250 Bacteria 141989
206 Ga0209026_1007165 3300025250 Bacteria 2572
207 Ga0209677_100024 3300025253 Bacteria 406035
208 Ga0209677_100028 3300025253 Bacteria 363933
209 Ga0209148_1000019 3300025254 Bacteria 748518
210 Ga0209148_1000040 3300025254 Bacteria 473531
211 Ga0209148_1004104 3300025254 Bacteria 3683
212 Ga0209759_1000080 3300025256 Bacteria 171186
213 Ga0209759_1000115 3300025256 Bacteria 141877
214 Ga0209759_1000155 3300025256 Bacteria 118819
215 Ga0209759_1001910 3300025256 Bacteria 10220
216 Ga0209759_1007204 3300025256 Bacteria 3615
217 Ga0209129_1000007 3300025258 Bacteria 771325
218 Ga0209129_1001384 3300025258 Bacteria 13561
219 Ga0209129_1007676 3300025258 Bacteria 3148
220 Ga0209233_1000070 3300025261 Bacteria 363933
221 Ga0209565_1000016 3300025263 Bacteria 477707
222 Ga0209565_1000178 3300025263 Bacteria 80603
223 Ga0209565_1000196 3300025263 Bacteria 72238
224 Ga0209565_1000229 3300025263 Bacteria 61660
225 Ga0209565_1000336 3300025263 Bacteria 41751
226 Ga0209565_1001871 3300025263 Bacteria 8381
227 Ga0209565_1014648 3300025263 Bacteria 1793
228 Ga0209565_1021622 3300025263 Bacteria 1342
229 Ga0209455_1000042 3300025272 Bacteria 419638
230 Ga0209455_1007520 3300025272 Bacteria 3066
231 Ga0209673_1000073 3300025273 Bacteria 233645
232 Ga0209673_1000463 3300025273 Bacteria 68460
233 Ga0209673_1000764 3300025273 Bacteria 43642
234 Ga0209673_1000884 3300025273 Bacteria 38736
235 Ga0209673_1009344 3300025273 Bacteria 4260
236 Ga0209673_1041756 3300025273 Bacteria 1298
237 Ga0209130_1000210 3300025284 Bacteria 77155
238 Ga0209130_1000263 3300025284 Bacteria 65894
239 Ga0209130_1000580 3300025284 Bacteria 35617
240 Ga0209130_1001148 3300025284 Bacteria 19288
241 Ga0209675_1000080 3300025291 Bacteria 154613
242 Ga0209675_1000092 3300025291 Bacteria 144839
243 Ga0209675_1000186 3300025291 Bacteria 68471
244 Ga0209675_1000361 3300025291 Bacteria 38739
245 Ga0209675_1001704 3300025291 Bacteria 12152
246 Ga0209675_1002302 3300025291 Bacteria 9905
247 Ga0209675_1003136 3300025291 Bacteria 8046
248 Ga0209675_1017016 3300025291 Bacteria 2093
249 Ga0209676_1000004 3300025292 Bacteria 1138360
250 Ga0209676_1000165 3300025292 Bacteria 156709
251 Ga0209676_1000172 3300025292 Bacteria 153664
252 Ga0209676_1000480 3300025292 Bacteria 65842
253 Ga0209676_1008977 3300025292 Bacteria 4381
254 Ga0209676_1011313 3300025292 Bacteria 3612
255 Ga0209025_1000039 3300025294 Bacteria 377396
256 Ga0209025_1000114 3300025294 Bacteria 218921
257 Ga0209025_1000125 3300025294 Bacteria 201444
258 Ga0209025_1000222 3300025294 Bacteria 135688
259 Ga0209025_1000230 3300025294 Bacteria 131131
260 Ga0209025_1000278 3300025294 Bacteria 117718
261 Ga0209025_1000628 3300025294 Bacteria 62542
262 Ga0209025_1005386 3300025294 Bacteria 10474
263 Ga0209025_1011879 3300025294 Bacteria 5669
264 Ga0209564_1000165 3300025295 Bacteria 160244
265 Ga0209564_1000200 3300025295 Bacteria 137503
266 Ga0209564_1000318 3300025295 Bacteria 93851
267 Ga0209564_1000489 3300025295 Bacteria 65860
268 Ga0209564_1000582 3300025295 Bacteria 57908
269 Ga0209564_1002074 3300025295 Bacteria 17227
270 Ga0209564_1012912 3300025295 Bacteria 3597
271 Ga0209758_1000025 3300025297 Bacteria 586687
272 Ga0209758_1002670 3300025297 Bacteria 17613
273 Ga0209758_1012494 3300025297 Bacteria 4747
274 Ga0209758_1042251 3300025297 Bacteria 1693
275 Ga0209050_1000002 3300025298 Bacteria 1792849
276 Ga0209050_1000084 3300025298 Bacteria 263245
277 Ga0209050_1000565 3300025298 Bacteria 60237
278 Ga0209256_1000067 3300025299 Bacteria 246812
279 Ga0209256_1000110 3300025299 Bacteria 182312
280 Ga0209256_1000198 3300025299 Bacteria 113429
281 Ga0209256_1000335 3300025299 Bacteria 78765
282 Ga0209256_1000362 3300025299 Bacteria 73517
283 Ga0209256_1032242 3300025299 Bacteria 1423
284 Ga0207426_1000001 3300025302 Bacteria 1341301
285 Ga0207426_1000178 3300025302 Bacteria 159291
286 Ga0207426_1000264 3300025302 Bacteria 110747
287 Ga0207426_1000436 3300025302 Bacteria 67619
288 Ga0207426_1002104 3300025302 Bacteria 13705
289 Ga0209051_1000002 3300025303 Bacteria 1631846
290 Ga0209051_1000058 3300025303 Bacteria 263137
291 Ga0209051_1000096 3300025303 Bacteria 167399
292 Ga0209051_1000278 3300025303 Bacteria 83769
293 Ga0209051_1000673 3300025303 Bacteria 38238
294 Ga0209051_1001488 3300025303 Bacteria 19623
295 Ga0209051_1010611 3300025303 Bacteria 4626
296 Ga0209051_1015557 3300025303 Bacteria 3492
297 Ga0209051_1022601 3300025303 Bacteria 2643
298 Ga0209257_1000002 3300025304 Bacteria 1767052
299 Ga0209257_1000022 3300025304 Bacteria 765258
300 Ga0209257_1000072 3300025304 Bacteria 332791
301 Ga0209257_1000092 3300025304 Bacteria 263137
302 Ga0209257_1011137 3300025304 Bacteria 4387
303 Ga0207713_1056345 3300025735 Bacteria 1528
304 Ga0207705_10124608 3300025909 Bacteria 1914
305 Ga0207695_10001071 3300025913 Bacteria 47830
306 Ga0207695_10015134 3300025913 Bacteria 9100
307 Ga0207695_10181958 3300025913 Bacteria 2023
308 Ga0207671_10159153 3300025914 Bacteria 1748
309 Ga0207657_10051639 3300025919 Bacteria 3573
310 Ga0207649_10000030 3300025920 Bacteria 154458
311 Ga0207652_10105578 3300025921 Bacteria 2492
312 Ga0207681_10110578 3300025923 Bacteria 1998
313 Ga0207690_10001459 3300025932 Bacteria 14792
314 Ga0207709_10004910 3300025935 Bacteria 7655
315 Ga0207691_10304944 3300025940 Bacteria 1367
316 Ga0207679_10000004 3300025945 Bacteria 589021
317 Ga0207667_10166753 3300025949 Bacteria 2264
318 Ga0207667_10527763 3300025949 Bacteria 1195
319 Ga0207640_10000155 3300025981 Bacteria 49469
320 Ga0207639_10180756 3300026041 Bacteria 1794
321 Ga0207678_10000005 3300026067 Bacteria 193984
322 Ga0207702_10000342 3300026078 Bacteria 53546
323 Ga0207702_10573670 3300026078 Bacteria 1105
324 Ga0207675_100214544 3300026118 Unclassified 1852
325 Ga0207698_10154674 3300026142 Bacteria 1996
326 Ga0209282_1000057 3300027666 Bacteria 99758
327 Ga0209282_1005596 3300027666 Bacteria 7730
328 Ga0207428_10087053 3300027907 Bacteria 2431
329 Ga0268266_10167691 3300028379 Bacteria 1991
330 Ga0316176_1085576 3300030732 Bacteria 6139
331 Ga0314311_1207443 3300030733 Bacteria 5190
332 Ga0316179_1087651 3300030734 Bacteria 4112
333 Ga0316178_1008722 3300030735 Bacteria 6969
334 Ga0316180_1108197 3300030736 Bacteria 3425
335 Ga0316183_1023144 3300030742 Bacteria 13762
336 Ga0316181_1207329 3300030744 Bacteria 3325
337 Ga0316182_1238298 3300030745 Bacteria 2783
338 Ga0265327_10003596 3300031251 Bacteria 14624
339 Ga0307513_10000066 3300031456 Bacteria 141617
340 Ga0307408_100011351 3300031548 Bacteria 5885
341 Ga0307408_100019360 3300031548 Bacteria 4582
342 Ga0307408_100319387 3300031548 Bacteria 1307
343 Ga0307405_10039858 3300031731 Bacteria 2842
344 Ga0307405_10053765 3300031731 Bacteria 2510
345 Ga0307410_10294198 3300031852 Bacteria 1279
346 Ga0307406_10000129 3300031901 Bacteria 44483
347 Ga0307406_10007196 3300031901 Bacteria 6164
348 Ga0307406_10146839 3300031901 Bacteria 1677
349 Ga0307407_10270863 3300031903 Bacteria 1172
350 Ga0307412_10009245 3300031911 Bacteria 5649
351 Ga0307412_10030907 3300031911 Bacteria 3377
352 Ga0307412_10044875 3300031911 Bacteria 2886
353 Ga0307412_10082604 3300031911 Bacteria 2225
354 Ga0307412_10271310 3300031911 Bacteria 1327
355 Ga0307412_10359337 3300031911 Bacteria 1172
356 Ga0307414_10022669 3300032004 Bacteria 3966
357 Ga0307414_10036835 3300032004 Bacteria 3270
358 Ga0307411_10011599 3300032005 Bacteria 4767
359 Ga0307411_10157031 3300032005 Bacteria 1698
360 Ga0307411_10198056 3300032005 Bacteria 1540
361 Ga0307411_10198191 3300032005 Bacteria 1539
362 Ga0395900_0089947 3300037418 Bacteria 3155
363 Ga0395905_0001326 3300037471 Bacteria 30204
364 Ga0395905_0213441 3300037471 Bacteria 1808
365 Ga0395901_0438761 3300038443 Bacteria 1337
366 Ga0439436_0006267 3300041404 Bacteria 3652
367 Ga0439436_0015800 3300041404 Bacteria 2268
368 Ga0439438_040191 3300041405 Bacteria 1216
369 Ga0439447_012885 3300041407 Bacteria 2389
370 Ga0439466_0001839 3300041411 Bacteria 8332
371 Ga0439466_0003263 3300041411 Bacteria 6316
372 Ga0439466_0022118 3300041411 Bacteria 2247
373 Ga0439465_0002729 3300041413 Bacteria 5771
374 Ga0439465_0008377 3300041413 Bacteria 3264
375 Ga0451853_2505844 3300041512 Bacteria 1623
376 Ga0439431_0000602 3300041997 Bacteria 7602
377 Ga0439431_0002506 3300041997 Bacteria 4062
378 Ga0439431_0021968 3300041997 Bacteria 1535
379 Ga0439442_000356 3300042002 Bacteria 10906
380 Ga0439442_007780 3300042002 Bacteria 2162
381 Ga0439432_002354 3300042006 Bacteria 7133
382 Ga0439432_036936 3300042006 Bacteria 1561
383 Ga0439449_0001161 3300042007 Bacteria 10323
384 Ga0439449_0040381 3300042007 Bacteria 1734
385 Ga0439452_001694 3300042010 Bacteria 8661
386 Ga0439452_015968 3300042010 Bacteria 2048
387 Ga0439462_0005665 3300042015 Bacteria 3083
388 Ga0439462_0008376 3300042015 Bacteria 2605
389 Ga0450911_004615 3300042115 Bacteria 2237
390 Ga0450911_009592 3300042115 Bacteria 1354
391 Ga0450921_000059 3300042123 Bacteria 3054
392 Ga0450922_003756 3300042124 Bacteria 1397
393 Ga0450923_000356 3300042125 Bacteria 4755
394 Ga0450898_006207 3300042134 Bacteria 1828
395 Ga0450906_000114 3300042145 Bacteria 14010
396 Ga0450910_001770 3300042147 Bacteria 2777
397 Ga0439446_0001003 3300042156 Bacteria 6164
398 Ga0439446_0003242 3300042156 Bacteria 4014
399 Ga0450908_000411 3300042184 Bacteria 8254
400 Ga0450909_003251 3300042185 Bacteria 2313
401 Ga0439434_0002977 3300042435 Bacteria 4954
402 Ga0439434_0006263 3300042435 Bacteria 3472
403 Ga0450918_001238 3300042531 Bacteria 5188
404 Ga0466986_0022780 3300044650 Bacteria 4163
405 Ga0466972_0005748 3300044658 Bacteria 6210
406 Ga0466982_0004071 3300044672 Bacteria 6527
407 Ga0466965_0007706 3300044683 Bacteria 4954
408 Ga0466966_0117721 3300044684 Bacteria 1634
409 Ga0466961_0000194 3300044693 Bacteria 40839
410 Ga0466971_0012336 3300044719 Bacteria 3744
411 Ga0466970_0002743 3300044765 Bacteria 8504
412 Ga0466970_0106289 3300044765 Bacteria 1531
413 Ga0466957_0018736 3300044842 Bacteria 4066
414 Ga0466957_0176994 3300044842 Bacteria 1392
415 Ga0466960_0028531 3300044901 Bacteria 2554
416 Ga0466959_0000928 3300045049 Bacteria 17381
417 Ga0466967_0026078 3300045976 Bacteria 4834
418 Ga0495627_002599 3300046453 Bacteria 8520
419 Ga0495627_009896 3300046453 Bacteria 3491
420 Ga0495592_0025069 3300046454 Bacteria 4529
421 Ga0495638_0025738 3300046460 Bacteria 3820
422 Ga0495638_0038579 3300046460 Bacteria 3034
423 Ga0495653_0013213 3300046463 Bacteria 6730
424 Ga0495650_0000015 3300046471 Bacteria 557595
425 Ga0495605_0000624 3300046474 Bacteria 27289
426 Ga0495596_0000038 3300046500 Bacteria 95273
427 Ga0495607_0000048 3300046501 Bacteria 121640
428 Ga0495607_0001888 3300046501 Bacteria 17773
429 Ga0495607_0015724 3300046501 Bacteria 4897
430 Ga0495583_0002011 3300046506 Bacteria 18547
431 Ga0495606_0000208 3300046507 Bacteria 103578
432 Ga0495606_0002379 3300046507 Bacteria 22053
433 Ga0495608_0015415 3300046511 Bacteria 5300
434 Ga0495610_0000141 3300046512 Bacteria 79877
435 Ga0495610_0051727 3300046512 Bacteria 1997
436 Ga0495616_0001178 3300046513 Bacteria 18447
437 Ga0495616_0001459 3300046513 Bacteria 16445
438 Ga0495616_0004666 3300046513 Bacteria 8595
439 Ga0495618_0045013 3300046514 Bacteria 2783
440 Ga0495620_0013152 3300046515 Bacteria 4247
441 Ga0495620_0070522 3300046515 Bacteria 1431
442 Ga0495628_0000827 3300046516 Bacteria 28693
443 Ga0495631_0000021 3300046518 Bacteria 92765
444 Ga0495632_0001125 3300046519 Bacteria 22872
445 Ga0495637_0002203 3300046520 Bacteria 10890
446 Ga0495637_0021191 3300046520 Bacteria 2982
447 Ga0495643_0000328 3300046522 Bacteria 65181
448 Ga0495644_0062315 3300046523 Bacteria 1401
449 Ga0495642_0050011 3300046528 Bacteria 1717
450 Ga0495642_0065219 3300046528 Bacteria 1516
451 Ga0495652_0034890 3300046529 Bacteria 4381
452 Ga0495652_0119845 3300046529 Bacteria 2100
453 Ga0495654_0021664 3300046530 Bacteria 3342
454 Ga0495609_0001032 3300046538 Bacteria 19570
455 Ga0495621_0036435 3300046539 Bacteria 1707
456 Ga0495597_0016789 3300046542 Bacteria 3454
457 Ga0495597_0048561 3300046542 Bacteria 1877
458 Ga0495645_0054893 3300046543 Bacteria 2893
459 Ga0495622_0066605 3300046557 Bacteria 1665
460 Ga0495633_0015227 3300046558 Bacteria 3995
461 Ga0495656_0000141 3300046615 Bacteria 26743
462 Ga0495668_0015172 3300046616 Bacteria 4504
463 Ga0495625_0000437 3300046660 Bacteria 62719
464 Ga0495625_0043430 3300046660 Bacteria 3259
465 Ga0495635_0117097 3300046663 Bacteria 1818
466 Ga0495661_0002776 3300046665 Bacteria 13270
467 Ga0495661_0010954 3300046665 Bacteria 6163
468 Ga0495661_0017305 3300046665 Bacteria 4762
469 Ga0495661_0205662 3300046665 Bacteria 1028
470 Ga0495588_0077793 3300046674 Bacteria 1730
471 Ga0495599_0007322 3300046678 Bacteria 6689
472 Ga0495646_0001482 3300046680 Bacteria 13955
473 Ga0495646_0003380 3300046680 Bacteria 9918
474 Ga0495658_0002746 3300046683 Bacteria 8849
475 Ga0495624_0014709 3300046690 Bacteria 5299
476 Ga0495670_0010557 3300046691 Bacteria 4540
477 Ga0495670_0156453 3300046691 Bacteria 1196
478 Ga0495671_0000462 3300046692 Bacteria 31814
479 Ga0495671_0016868 3300046692 Bacteria 3893
480 Ga0495649_0025594 3300046694 Bacteria 3287
481 Ga0495600_0018956 3300046809 Bacteria 4391
482 Ga0495660_0088014 3300046810 Bacteria 1619
483 Ga0495660_0140419 3300046810 Bacteria 1203
484 Ga0495604_0012483 3300047317 Bacteria 6756
485 Ga0495604_0037846 3300047317 Bacteria 3797
486 Ga0495636_0004786 3300047318 Bacteria 5305
487 Ga0495672_0027483 3300047320 Bacteria 3615
488 Ga0495672_0108818 3300047320 Bacteria 1490
489 Ga0495676_0010916 3300047321 Bacteria 8211
490 Ga0495687_014410 3300047443 Bacteria 4073
491 Ga0495687_043789 3300047443 Bacteria 1948
492 Ga0495673_0000113 3300047469 Bacteria 163495
493 Ga0495593_0002373 3300047673 Bacteria 11312
494 Ga0495602_0046578 3300048088 Bacteria 3915
495 Ga0495614_0004046 3300048089 Bacteria 6589
496 Ga0495626_0001224 3300048091 Bacteria 21136
497 Ga0496101_0005734 3300048904 Bacteria 7933
498 Ga0496103_0016925 3300048906 Bacteria 4355
499 Ga0496104_0271876 3300048907 Bacteria 1607
500 Ga0496111_0091360 3300048914 Bacteria 2231
501 Ga0496117_0007805 3300048920 Bacteria 10311
502 Ga0496118_0002845 3300048921 Bacteria 22594
503 Ga0496121_0004379 3300048924 Bacteria 19076
504 Ga0496121_0030981 3300048924 Bacteria 4899
505 Ga0496121_0053672 3300048924 Bacteria 3375
506 Ga0496121_0234345 3300048924 Bacteria 1283
507 Ga0496122_0000238 3300048925 Bacteria 123588
508 Ga0496122_0000676 3300048925 Bacteria 68538
509 Ga0496122_0041484 3300048925 Bacteria 3638
510 Ga0496122_0059464 3300048925 Bacteria 2821
511 Ga0496123_0000262 3300048926 Bacteria 106366
512 Ga0496123_0008328 3300048926 Bacteria 9544
513 Ga0496123_0023727 3300048926 Bacteria 4687
514 Ga0496124_0141563 3300048927 Bacteria 1897
515 Ga0496125_0007020 3300048928 Bacteria 12051
516 Ga0496125_0012129 3300048928 Bacteria 8573
517 Ga0496125_0109544 3300048928 Bacteria 2005
518 Ga0495682_0017433 3300049460 Bacteria 2710
519 Ga0501033_0223522 3300049570 Bacteria 1339
520 Ga0501034_0000022 3300049571 Bacteria 264441
521 Ga0501036_0520420 3300049572 Bacteria 989
522 Ga0501038_0320827 3300049574 Bacteria 1212
523 Ga0501039_0135826 3300049575 Bacteria 1931
524 Ga0501047_0009582 3300049581 Bacteria 9154
525 Ga0501262_000044 3300049759 Bacteria 16463
526 Ga0501035_0023999 3300049822 Bacteria 5596
527 Ga0501044_0013376 3300049823 Bacteria 8874
528 Ga0501044_0027489 3300049823 Bacteria 6011
529 nmdc:mga03683_1355_c1 3300050489 Bacteria 7262
530 nmdc:mga03n38_17203_c1 3300050490 Bacteria 2827
531 nmdc:mga03n38_5412_c1 3300050490 Bacteria 4346
532 nmdc:mga00v17_131904_c1 3300050491 Bacteria 1597
533 nmdc:mga0yw44_473_c1 3300050492 Bacteria 14285
534 nmdc:mga0k408_250629_c1 3300050493 Unclassified 1057
535 nmdc:mga0k408_2986_c1 3300050493 Bacteria 8966
536 nmdc:mga0k408_54798_c1 3300050493 Bacteria 2311
537 nmdc:mga0k408_79253_c1 3300050493 Bacteria 1922
538 nmdc:mga07m45_41256_c1 3300050496 Bacteria 2584
539 Ga0500610_0000115 3300053079 Bacteria 24228
540 Ga0500610_0000411 3300053079 Bacteria 13125
541 Ga0500644_0073158 3300053088 Bacteria 1240
542 Ga0500651_0000360 3300053093 Bacteria 25226
543 Ga0500566_0003903 3300053094 Bacteria 8896
544 Ga0500571_000052 3300053110 Bacteria 35666
545 Ga0500593_000089 3300053117 Bacteria 33327
546 Ga0500594_0008611 3300053118 Bacteria 2329
547 Ga0500594_0014392 3300053118 Bacteria 1894
548 Ga0500595_020459 3300053119 Bacteria 2381
549 Ga0500597_016713 3300053120 Bacteria 2806
550 Ga0500607_000146 3300053121 Bacteria 59939
551 Ga0500608_002675 3300053122 Bacteria 6534
552 Ga0500618_001381 3300053125 Bacteria 10986
553 Ga0500618_019575 3300053125 Bacteria 1664
554 Ga0500626_004619 3300053128 Bacteria 5261
555 Ga0500655_008403 3300053133 Bacteria 1858
556 Ga0500658_0000052 3300053134 Bacteria 61874
557 Ga0500658_0000503 3300053134 Bacteria 16677
558 Ga0500559_0148289 3300053136 Bacteria 1100
559 Ga0500564_019948 3300053138 Bacteria 3067
560 Ga0500568_0001382 3300053139 Bacteria 15727
561 Ga0500573_0047021 3300053140 Bacteria 2486
562 Ga0500574_000444 3300053141 Bacteria 5239
563 Ga0500574_010160 3300053141 Bacteria 2076
564 Ga0500586_000131 3300053145 Bacteria 13729
565 Ga0500616_0013412 3300053153 Bacteria 4759
566 Ga0500619_022509 3300053154 Bacteria 1830
567 Ga0500627_0002112 3300053158 Bacteria 5765
568 Ga0500634_0019577 3300053161 Bacteria 3648
569 Ga0500636_0052460 3300053177 Bacteria 2395
570 Ga0466962_0009891 3300061719 Bacteria 4574
571 2511242475 2511231002 Bacteria 5042903
572 2511248642 2511231003 Bacteria 5606035
573 2511386981 2511231026 Bacteria 5225445
574 2513231952 2513020051 Bacteria 6053213
575 2513957138 2513237150 Bacteria 6553639
576 2514043300 2513237165 Bacteria 6771773
577 2597028175 2596583598 Bacteria 5251611
578 2599444906 2599185178 Bacteria 5365746
579 2599624898 2599185214 Bacteria 8209958
580 2599672910 2599185226 Bacteria 8233575
581 2599682640 2599185227 Bacteria 8246414
582 2599694519 2599185229 Bacteria 8216126
583 2644031592 2643221603 Bacteria 6147767
584 2644161173 2643221628 Bacteria 5745828
585 2644329210 2643221658 Bacteria 6064537
586 2644401692 2643221672 Bacteria 6322190
587 2644465181 2643221683 Bacteria 5749203
588 2738717363 2738541277 Bacteria 7458140
589 2738878956 2738541307 Bacteria 8606193
590 2739250101 2738543013 Bacteria 5618633
591 2739278049 2738543019 Bacteria 7459457
592 2808984599 2808606386 Bacteria 4471946
593 2809130856 2808606415 Bacteria 4576710
594 2809143063 2808606418 Bacteria 6724496
595 2809150809 2808606419 Bacteria 4576925
596 2819543300 2818991436 Bacteria 5376622
597 2819593093 2818991445 Bacteria 4955017
598 2819596827 2818991446 Bacteria 7757362
599 2831265949 2831265667 Bacteria 7184833
600 2834643728 2834641062 Bacteria 5559922
601 2838060858 2838054893 Bacteria 7451788
602 2842681411 2842677519 Bacteria 5615038
603 2842734948 2842733646 Bacteria 5716726
604 2842748027 2842747753 Bacteria 5578255
605 2844538386 2844533157 Bacteria 7517899
606 2852622328 2852618963 Bacteria 4577824
607 2854603607 2854601825 Bacteria 4797592
608 2855735384 2855730933 Bacteria 7047938
609 2855771167 2855767633 Bacteria 7049357
610 2857579825 2857576091 Bacteria 5465855
611 2881416961 2881412998 Bacteria 6492157
612 2885197401 2885192300 Bacteria 5882526
613 2885203596 2885198086 Bacteria 7212419
614 2885217054 2885211737 Bacteria 7212420
615 2885269775 2885266251 Bacteria 4796748
616 2899930387 2899924645 Bacteria 7487985
617 2900581491 2900577576 Bacteria 5438534
618 2904441049 2904439833 Bacteria 5931679
619 2904454202 2904449895 Bacteria 6927402
620 2904461941 2904456579 Bacteria 6819253
621 2919465204 2919462493 Bacteria 5817112
622 2928039500 2928037797 Bacteria 7273642
623 2928044895 2928044640 Bacteria 7271509
624 2928052696 2928051484 Bacteria 7773759
625 2928060048 2928058823 Bacteria 5520022
626 2928064643 2928064002 Bacteria 7419480
627 2928074940 2928070936 Bacteria 8062541
628 2928089077 2928084124 Bacteria 7159212
629 2929521937 2929520902 Bacteria 6765052
630 2945911182 2945909444 Bacteria 7065066
631 2945949992 2945945610 Bacteria 5951079
632 2945973999 2945972063 Bacteria 6086495
633 2945986524 2945984333 Bacteria 7358892
634 2954770419 2954767861 Bacteria 5535784
635 644750121 644736347 Bacteria 6476522
636 8003405110 8003400568 Bacteria 5535898
637 Ga0065714_10074345
638 JGI24741J21665_1000174
639 JGI24740J21852_10000852
640 JGI24740J21852_10001192
641 JGI24740J21852_10004237
642 JGI24740J21852_10043788
643 JGI25155J39150_1000357
644 JGI25156J39149_1000398
645 JGI25162J39368_1000026
646 JGI25162J39368_1000027
647 JGI25154J39366_1000241
648 JGI25154J39366_1000349
649 JGI25154J39366_1000405
650 JGI25154J39366_1001245
651 JGI25158J39367_1001439
652 JGI25157J39369_1000105
653 JGI25152J39213_1014378
654 JGI25150J39212_1000679
655 JGI25150J39212_1003302
656 JGI25159J45721_1005058
657 JGI25159J45721_1006953
658 JGI25159J45721_1017845
659 JGI25151J46595_10000045
660 JGI25151J46595_10000285
661 JGI25151J46595_10000412
662 JGI25151J46595_10001901
663 JGI25165J46597_1000031
664 JGI25153J46596_10010430
665 JGI25153J46596_10021547
666 rootL2_10070966
667 rootL2_10112703
668 JGI25160J50197_1007660
669 JGI25160J50197_1009350
670 JGI25160J50197_1014814
671 Ga0006562J51391_1047816
672 Ga0006562J51391_1047817
673 Ga0006562J51391_1126290
674 Ga0006562J51391_1126291
675 Ga0006562J51391_1128109
676 Ga0006562J51391_1128110
677 Ga0055538_1000018
678 Ga0055538_1003595
679 Ga0055539_1000023
680 Ga0055539_1000053
681 Ga0055533_1000031
682 Ga0055533_1002112
683 Ga0055532_1000033
684 Ga0055532_1000051
685 Ga0055525_1000039
686 Ga0055525_1000440
687 Ga0055525_1000621
688 Ga0055535_1000024
689 Ga0055535_1000274
690 Ga0055542_1000027
691 Ga0055529_1000044
692 Ga0055526_1002868
693 Ga0055526_1007438
694 Ga0055526_1009818
695 Ga0055526_1010720
696 Ga0055526_1010795
697 Ga0055537_1000006
698 Ga0055537_1000162
699 Ga0055537_1000445
700 Ga0055537_1002317
701 Ga0055537_1003980
702 Ga0055537_1004001
703 Ga0055537_1004177
704 Ga0055524_1000032
705 Ga0055524_1000690
706 Ga0055524_1008604
707 Ga0055524_1008676
708 Ga0055524_1038591
709 Ga0055536_1000163
710 Ga0055536_1003187
711 Ga0055536_1016958
712 Ga0055534_1000128
713 Ga0055534_1001699
714 Ga0055534_1003814
715 Ga0055534_1004269
716 Ga0055534_1005845
717 Ga0055528_1000504
718 Ga0055528_1006119
719 Ga0055528_1009033
720 Ga0055528_1012244
721 Ga0055530_10000328
722 Ga0055530_10000866
723 Ga0055530_10003406
724 Ga0055530_10014544
725 Ga0055540_1000046
726 Ga0055540_1000813
727 Ga0055540_1004807
728 Ga0055540_1007252
729 Ga0055531_10000428
730 Ga0055531_10002570
731 Ga0055531_10011137
732 Ga0055531_10014498
733 Ga0055531_10034955
734 Ga0055541_1000016
735 Ga0055541_1000303
736 Ga0055543_1003838
737 Ga0055543_1003866
738 Ga0065165_1007662
739 Ga0065165_1009778
740 Ga0070658_10134468
741 Ga0070660_100007159
742 Ga0070661_100000021
743 Ga0070669_100087562
744 Ga0070673_100445481
745 Ga0070659_100000839
746 Ga0070663_100000004
747 Ga0070679_100094032
748 Ga0068853_100005678
749 Ga0068853_100341405
750 Ga0068855_100120233
751 Ga0068855_100504858
752 Ga0068855_100510097
753 Ga0070664_100000007
754 Ga0068857_100016420
755 Ga0068854_100000045
756 Ga0068856_100000004
757 Ga0068856_100236266
758 Ga0075365_10001542
759 Ga0075363_100004545
760 Ga0075364_10003241
761 Ga0075364_10029645
762 Ga0075364_10082317
763 Ga0075432_10002170
764 Ga0075432_10017820
765 Ga0075362_10002812
766 Ga0075362_10095521
767 Ga0075366_10002392
768 Ga0075366_10016252
769 Ga0075366_10069943
770 Ga0075370_10000759
771 Ga0075370_10047873
772 Ga0079104_1007154
773 Ga0079104_1016174
774 Ga0079104_1020222
775 Ga0099826_10000065
776 Ga0099826_10000122
777 Ga0105251_10078738
778 Ga0105240_10014225
779 Ga0105240_10113980
780 Ga0105240_10264636
781 Ga0105240_10281036
782 Ga0105243_10017120
783 Ga0105239_10402938
784 Ga0157347_1000228
785 Ga0157373_10003146
786 Ga0157373_10037094
787 Ga0157371_10000001
788 Ga0157371_10000028
789 Ga0157370_10000002
790 Ga0157370_10001308
791 Ga0157370_10224212
792 Ga0157369_10002517
793 Ga0157369_10007328
794 Ga0157372_10000619
795 Ga0182008_10001266
796 Ga0182008_10026396
797 Ga0182008_10113687
798 Ga0182006_1008186
799 Ga0182007_10004904
800 Ga0182005_1000252
801 Ga0183362_10001
802 Ga0163161_10000079
803 Ga0163161_10001508
804 Ga0163161_10020413
805 Ga0163161_10087750
806 Ga0163161_10176756
807 Ga0206351_10260248
808 Ga0209435_100028
809 Ga0209435_100037
810 Ga0209760_101921
811 Ga0209436_102723
812 Ga0209784_100024
813 Ga0209784_100027
814 Ga0209784_100525
815 Ga0209784_101405
816 Ga0209566_100018
817 Ga0209566_100027
818 Ga0209566_100129
819 Ga0209674_100044
820 Ga0209674_100225
821 Ga0209674_100305
822 Ga0209674_100775
823 Ga0209672_100068
824 Ga0209672_104679
825 Ga0209147_100004
826 Ga0209147_100008
827 Ga0209147_100940
828 Ga0209563_100039
829 Ga0209563_100048
830 Ga0209563_102266
831 Ga0207427_100616
832 Ga0209437_100053
833 Ga0209437_100055
834 Ga0209258_100013
835 Ga0209258_100048
836 Ga0209258_100398
837 Ga0207425_1000107
838 Ga0209646_1000021
839 Ga0209646_1000063
840 Ga0209646_1000095
841 Ga0209026_1000110
842 Ga0209026_1007165
843 Ga0209677_100024
844 Ga0209677_100028
845 Ga0209148_1000019
846 Ga0209148_1000040
847 Ga0209148_1004104
848 Ga0209759_1000080
849 Ga0209759_1000115
850 Ga0209759_1000155
851 Ga0209759_1001910
852 Ga0209759_1007204
853 Ga0209129_1000007
854 Ga0209129_1001384
855 Ga0209129_1007676
856 Ga0209233_1000070
857 Ga0209565_1000016
858 Ga0209565_1000178
859 Ga0209565_1000196
860 Ga0209565_1000229
861 Ga0209565_1000336
862 Ga0209565_1001871
863 Ga0209565_1014648
864 Ga0209565_1021622
865 Ga0209455_1000042
866 Ga0209455_1007520
867 Ga0209673_1000073
868 Ga0209673_1000463
869 Ga0209673_1000764
870 Ga0209673_1000884
871 Ga0209673_1009344
872 Ga0209673_1041756
873 Ga0209130_1000210
874 Ga0209130_1000263
875 Ga0209130_1000580
876 Ga0209130_1001148
877 Ga0209675_1000080
878 Ga0209675_1000092
879 Ga0209675_1000186
880 Ga0209675_1000361
881 Ga0209675_1001704
882 Ga0209675_1002302
883 Ga0209675_1003136
884 Ga0209675_1017016
885 Ga0209676_1000004
886 Ga0209676_1000165
887 Ga0209676_1000172
888 Ga0209676_1000480
889 Ga0209676_1008977
890 Ga0209676_1011313
891 Ga0209025_1000039
892 Ga0209025_1000114
893 Ga0209025_1000125
894 Ga0209025_1000222
895 Ga0209025_1000230
896 Ga0209025_1000278
897 Ga0209025_1000628
898 Ga0209025_1005386
899 Ga0209025_1011879
900 Ga0209564_1000165
901 Ga0209564_1000200
902 Ga0209564_1000318
903 Ga0209564_1000489
904 Ga0209564_1000582
905 Ga0209564_1002074
906 Ga0209564_1012912
907 Ga0209758_1000025
908 Ga0209758_1002670
909 Ga0209758_1012494
910 Ga0209758_1042251
911 Ga0209050_1000002
912 Ga0209050_1000084
913 Ga0209050_1000565
914 Ga0209256_1000067
915 Ga0209256_1000110
916 Ga0209256_1000198
917 Ga0209256_1000335
918 Ga0209256_1000362
919 Ga0209256_1032242
920 Ga0207426_1000001
921 Ga0207426_1000178
922 Ga0207426_1000264
923 Ga0207426_1000436
924 Ga0207426_1002104
925 Ga0209051_1000002
926 Ga0209051_1000058
927 Ga0209051_1000096
928 Ga0209051_1000278
929 Ga0209051_1000673
930 Ga0209051_1001488
931 Ga0209051_1010611
932 Ga0209051_1015557
933 Ga0209051_1022601
934 Ga0209257_1000002
935 Ga0209257_1000022
936 Ga0209257_1000072
937 Ga0209257_1000092
938 Ga0209257_1011137
939 Ga0207713_1056345
940 Ga0207705_10124608
941 Ga0207695_10001071
942 Ga0207695_10015134
943 Ga0207695_10181958
944 Ga0207671_10159153
945 Ga0207657_10051639
946 Ga0207649_10000030
947 Ga0207652_10105578
948 Ga0207681_10110578
949 Ga0207690_10001459
950 Ga0207709_10004910
951 Ga0207691_10304944
952 Ga0207679_10000004
953 Ga0207667_10166753
954 Ga0207667_10527763
955 Ga0207640_10000155
956 Ga0207639_10180756
957 Ga0207678_10000005
958 Ga0207702_10000342
959 Ga0207702_10573670
960 Ga0207675_100214544
961 Ga0207698_10154674
962 Ga0209282_1000057
963 Ga0209282_1005596
964 Ga0207428_10087053
965 Ga0268266_10167691
966 Ga0316176_1085576
967 Ga0314311_1207443
968 Ga0316179_1087651
969 Ga0316178_1008722
970 Ga0316180_1108197
971 Ga0316183_1023144
972 Ga0316181_1207329
973 Ga0316182_1238298
974 Ga0265327_10003596
975 Ga0307513_10000066
976 Ga0307408_100011351
977 Ga0307408_100019360
978 Ga0307408_100319387
979 Ga0307405_10039858
980 Ga0307405_10053765
981 Ga0307410_10294198
982 Ga0307406_10000129
983 Ga0307406_10007196
984 Ga0307406_10146839
985 Ga0307407_10270863
986 Ga0307412_10009245
987 Ga0307412_10030907
988 Ga0307412_10044875
989 Ga0307412_10082604
990 Ga0307412_10271310
991 Ga0307412_10359337
992 Ga0307414_10022669
993 Ga0307414_10036835
994 Ga0307411_10011599
995 Ga0307411_10157031
996 Ga0307411_10198056
997 Ga0307411_10198191
998 Ga0395900_0089947
999 Ga0395905_0001326
1000 Ga0395905_0213441
1001 Ga0395901_0438761
1002 Ga0439436_0006267
1003 Ga0439436_0015800
1004 Ga0439438_040191
1005 Ga0439447_012885
1006 Ga0439466_0001839
1007 Ga0439466_0003263
1008 Ga0439466_0022118
1009 Ga0439465_0002729
1010 Ga0439465_0008377
1011 Ga0451853_2505844
1012 Ga0439431_0000602
1013 Ga0439431_0002506
1014 Ga0439431_0021968
1015 Ga0439442_000356
1016 Ga0439442_007780
1017 Ga0439432_002354
1018 Ga0439432_036936
1019 Ga0439449_0001161
1020 Ga0439449_0040381
1021 Ga0439452_001694
1022 Ga0439452_015968
1023 Ga0439462_0005665
1024 Ga0439462_0008376
1025 Ga0450911_004615
1026 Ga0450911_009592
1027 Ga0450921_000059
1028 Ga0450922_003756
1029 Ga0450923_000356
1030 Ga0450898_006207
1031 Ga0450906_000114
1032 Ga0450910_001770
1033 Ga0439446_0001003
1034 Ga0439446_0003242
1035 Ga0450908_000411
1036 Ga0450909_003251
1037 Ga0439434_0002977
1038 Ga0439434_0006263
1039 Ga0450918_001238
1040 Ga0466986_0022780
1041 Ga0466972_0005748
1042 Ga0466982_0004071
1043 Ga0466965_0007706
1044 Ga0466966_0117721
1045 Ga0466961_0000194
1046 Ga0466971_0012336
1047 Ga0466970_0002743
1048 Ga0466970_0106289
1049 Ga0466957_0018736
1050 Ga0466957_0176994
1051 Ga0466960_0028531
1052 Ga0466959_0000928
1053 Ga0466967_0026078
1054 Ga0495627_002599
1055 Ga0495627_009896
1056 Ga0495592_0025069
1057 Ga0495638_0025738
1058 Ga0495638_0038579
1059 Ga0495653_0013213
1060 Ga0495650_0000015
1061 Ga0495605_0000624
1062 Ga0495596_0000038
1063 Ga0495607_0000048
1064 Ga0495607_0001888
1065 Ga0495607_0015724
1066 Ga0495583_0002011
1067 Ga0495606_0000208
1068 Ga0495606_0002379
1069 Ga0495608_0015415
1070 Ga0495610_0000141
1071 Ga0495610_0051727
1072 Ga0495616_0001178
1073 Ga0495616_0001459
1074 Ga0495616_0004666
1075 Ga0495618_0045013
1076 Ga0495620_0013152
1077 Ga0495620_0070522
1078 Ga0495628_0000827
1079 Ga0495631_0000021
1080 Ga0495632_0001125
1081 Ga0495637_0002203
1082 Ga0495637_0021191
1083 Ga0495643_0000328
1084 Ga0495644_0062315
1085 Ga0495642_0050011
1086 Ga0495642_0065219
1087 Ga0495652_0034890
1088 Ga0495652_0119845
1089 Ga0495654_0021664
1090 Ga0495609_0001032
1091 Ga0495621_0036435
1092 Ga0495597_0016789
1093 Ga0495597_0048561
1094 Ga0495645_0054893
1095 Ga0495622_0066605
1096 Ga0495633_0015227
1097 Ga0495656_0000141
1098 Ga0495668_0015172
1099 Ga0495625_0000437
1100 Ga0495625_0043430
1101 Ga0495635_0117097
1102 Ga0495661_0002776
1103 Ga0495661_0010954
1104 Ga0495661_0017305
1105 Ga0495661_0205662
1106 Ga0495588_0077793
1107 Ga0495599_0007322
1108 Ga0495646_0001482
1109 Ga0495646_0003380
1110 Ga0495658_0002746
1111 Ga0495624_0014709
1112 Ga0495670_0010557
1113 Ga0495670_0156453
1114 Ga0495671_0000462
1115 Ga0495671_0016868
1116 Ga0495649_0025594
1117 Ga0495600_0018956
1118 Ga0495660_0088014
1119 Ga0495660_0140419
1120 Ga0495604_0012483
1121 Ga0495604_0037846
1122 Ga0495636_0004786
1123 Ga0495672_0027483
1124 Ga0495672_0108818
1125 Ga0495676_0010916
1126 Ga0495687_014410
1127 Ga0495687_043789
1128 Ga0495673_0000113
1129 Ga0495593_0002373
1130 Ga0495602_0046578
1131 Ga0495614_0004046
1132 Ga0495626_0001224
1133 Ga0496101_0005734
1134 Ga0496103_0016925
1135 Ga0496104_0271876
1136 Ga0496111_0091360
1137 Ga0496117_0007805
1138 Ga0496118_0002845
1139 Ga0496121_0004379
1140 Ga0496121_0030981
1141 Ga0496121_0053672
1142 Ga0496121_0234345
1143 Ga0496122_0000238
1144 Ga0496122_0000676
1145 Ga0496122_0041484
1146 Ga0496122_0059464
1147 Ga0496123_0000262
1148 Ga0496123_0008328
1149 Ga0496123_0023727
1150 Ga0496124_0141563
1151 Ga0496125_0007020
1152 Ga0496125_0012129
1153 Ga0496125_0109544
1154 Ga0495682_0017433
1155 Ga0501033_0223522
1156 Ga0501034_0000022
1157 Ga0501036_0520420
1158 Ga0501038_0320827
1159 Ga0501039_0135826
1160 Ga0501047_0009582
1161 Ga0501262_000044
1162 Ga0501035_0023999
1163 Ga0501044_0013376
1164 Ga0501044_0027489
1165 nmdc:mga03683_1355_c1
1166 nmdc:mga03n38_17203_c1
1167 nmdc:mga03n38_5412_c1
1168 nmdc:mga00v17_131904_c1
1169 nmdc:mga0yw44_473_c1
1170 nmdc:mga0k408_250629_c1
1171 nmdc:mga0k408_2986_c1
1172 nmdc:mga0k408_54798_c1
1173 nmdc:mga0k408_79253_c1
1174 nmdc:mga07m45_41256_c1
1175 Ga0500610_0000115
1176 Ga0500610_0000411
1177 Ga0500644_0073158
1178 Ga0500651_0000360
1179 Ga0500566_0003903
1180 Ga0500571_000052
1181 Ga0500593_000089
1182 Ga0500594_0008611
1183 Ga0500594_0014392
1184 Ga0500595_020459
1185 Ga0500597_016713
1186 Ga0500607_000146
1187 Ga0500608_002675
1188 Ga0500618_001381
1189 Ga0500618_019575
1190 Ga0500626_004619
1191 Ga0500655_008403
1192 Ga0500658_0000052
1193 Ga0500658_0000503
1194 Ga0500559_0148289
1195 Ga0500564_019948
1196 Ga0500568_0001382
1197 Ga0500573_0047021
1198 Ga0500574_000444
1199 Ga0500574_010160
1200 Ga0500586_000131
1201 Ga0500616_0013412
1202 Ga0500619_022509
1203 Ga0500627_0002112
1204 Ga0500634_0019577
1205 Ga0500636_0052460
1206 Ga0466962_0009891
1207 2511242475
1208 2511248642
1209 2511386981
1210 2513231952
1211 2513957138
1212 2514043300
1213 2597028175
1214 2599444906
1215 2599624898
1216 2599672910
1217 2599682640
1218 2599694519
1219 2644031592
1220 2644161173
1221 2644329210
1222 2644401692
1223 2644465181
1224 2738717363
1225 2738878956
1226 2739250101
1227 2739278049
1228 2808984599
1229 2809130856
1230 2809143063
1231 2809150809
1232 2819543300
1233 2819593093
1234 2819596827
1235 2831265949
1236 2834643728
1237 2838060858
1238 2842681411
1239 2842734948
1240 2842748027
1241 2844538386
1242 2852622328
1243 2854603607
1244 2855735384
1245 2855771167
1246 2857579825
1247 2881416961
1248 2885197401
1249 2885203596
1250 2885217054
1251 2885269775
1252 2899930387
1253 2900581491
1254 2904441049
1255 2904454202
1256 2904461941
1257 2919465204
1258 2928039500
1259 2928044895
1260 2928052696
1261 2928060048
1262 2928064643
1263 2928074940
1264 2928089077
1265 2929521937
1266 2945911182
1267 2945949992
1268 2945973999
1269 2945986524
1270 2954770419
1271 644750121
1272 8003405110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

65

124

0.98

PF03466

LysR_substrate

LysR substrate binding domain

148

356

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9163 3 47
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9156 2 47
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9148 3 88
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9143 3 88
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9119 3 47
ID Description Score Start End Superfamily
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9843 4 87 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 2 82 1.10.10.10
af_P37641_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 4 80 1.10.10.10
af_P37682_6_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9623 3 87 1.10.10.10
af_Q2FVT4_1_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 3 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A658JMP9-F1-model_v4 deleted 0.9495 3 80
AF-A0A1Q5IPR2-F1-model_v4 Transcriptional regulator 0.9469 3 88 GO:0000976
GO:0003700
AF-A0A3C1Y027-F1-model_v4 LysR family transcriptional regulator 0.9464 3 87 GO:0003700
GO:0005829
AF-E8UYI9-F1-model_v4 Regulatory protein LysR 0.9457 1 73 GO:0003700
AF-A0A7X6IIS4-F1-model_v4 deleted 0.9448 3 80

Map