F471646

General Info

Members Datasets Scaffolds Average Seq Length
639 280 639 171

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_866322_c1|nmdc:mga09592_866322_c1_122_724
Length 200
Sequence LLNSECCIGGAADQSAFSNQHSEISASNMDVLAFYAFAGIAVIASLLVIGQGNPMHSVMLLIVSFGALAGLYVVLDAPFTAVTQIIVYAGAIMVLFLFVVMLLNVPREEPAPGGAATLLGSTGMRIGAVLSLLLAGELLWALLRIGFGWASRAETAASVSSVALIGSGIFTRHAFAFEATSVLILVAMIGAVVLARREHS

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
160 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
165 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
211 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
212 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
239 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
240 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
241 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
242 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
243 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
250 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
251 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
274 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.48
Nodule 0
Rhizoplane 3.44
Rhizosphere 90.61
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1016045 3300002073 Bacteria 868
2 JGI24035J26624_1009355 3300002126 Bacteria 965
3 JGI25406J46586_10000551 3300003203 Bacteria 17619
4 JGI25406J46586_10001262 3300003203 Bacteria 11872
5 JGI25406J46586_10120242 3300003203 Bacteria 773
6 Ga0065714_10072204 3300005288 Bacteria 3412
7 Ga0065704_10005852 3300005289 Bacteria 3146
8 Ga0065712_10009881 3300005290 Bacteria 2256
9 Ga0065712_10018740 3300005290 Bacteria 2386
10 Ga0065712_10084760 3300005290 Bacteria 2743
11 Ga0065712_10087888 3300005290 Bacteria 2549
12 Ga0065712_10310482 3300005290 Bacteria 840
13 Ga0065712_10406397 3300005290 Bacteria 726
14 Ga0065715_10009247 3300005293 Bacteria 4293
15 Ga0065715_10009346 3300005293 Bacteria 2344
16 Ga0065715_10105744 3300005293 Bacteria 2874
17 Ga0065715_10462750 3300005293 Bacteria 814
18 Ga0065707_10103611 3300005295 Bacteria 2739
19 Ga0065707_10167221 3300005295 Bacteria 1513
20 Ga0065707_10318638 3300005295 Bacteria 970
21 Ga0070683_100000094 3300005329 Bacteria 58242
22 Ga0070683_100103115 3300005329 Bacteria 2688
23 Ga0070670_100029410 3300005331 Bacteria 4730
24 Ga0070670_100047811 3300005331 Bacteria 3682
25 Ga0070670_100186698 3300005331 Bacteria 1800
26 Ga0070670_100674048 3300005331 Bacteria 929
27 Ga0070677_10128962 3300005333 Bacteria 1152
28 Ga0070677_10320386 3300005333 Bacteria 794
29 Ga0068869_100239485 3300005334 Bacteria 1445
30 Ga0070666_10528333 3300005335 Bacteria 857
31 Ga0070680_100259809 3300005336 Bacteria 1469
32 Ga0070680_100336784 3300005336 Bacteria 1282
33 Ga0070682_100213800 3300005337 Bacteria 1368
34 Ga0068868_100049345 3300005338 Bacteria 3303
35 Ga0070660_100265946 3300005339 Bacteria 1401
36 Ga0070687_100060313 3300005343 Bacteria 2001
37 Ga0070661_100016313 3300005344 Bacteria 5251
38 Ga0070661_100169844 3300005344 Bacteria 1656
39 Ga0070661_100697914 3300005344 Bacteria 827
40 Ga0070661_100934584 3300005344 Bacteria 717
41 Ga0070668_100367769 3300005347 Bacteria 1221
42 Ga0070668_101386338 3300005347 Bacteria 641
43 Ga0070669_100005170 3300005353 Bacteria 9439
44 Ga0070669_100040998 3300005353 Bacteria 3366
45 Ga0070669_100351989 3300005353 Bacteria 1196
46 Ga0070669_101048725 3300005353 Bacteria 701
47 Ga0070675_100041683 3300005354 Bacteria 3750
48 Ga0070675_100235798 3300005354 Bacteria 1597
49 Ga0070675_100386547 3300005354 Bacteria 1246
50 Ga0070675_100397586 3300005354 Bacteria 1229
51 Ga0070675_100398057 3300005354 Bacteria 1228
52 Ga0070671_100050359 3300005355 Bacteria 3464
53 Ga0070671_100437696 3300005355 Bacteria 1121
54 Ga0070674_100356010 3300005356 Bacteria 1184
55 Ga0070673_100581237 3300005364 Bacteria 1020
56 Ga0070688_100050003 3300005365 Bacteria 2603
57 Ga0070688_100868461 3300005365 Bacteria 710
58 Ga0070688_101017771 3300005365 Bacteria 659
59 Ga0070659_100639026 3300005366 Bacteria 917
60 Ga0070667_100939165 3300005367 Bacteria 806
61 Ga0070667_100943757 3300005367 Bacteria 804
62 Ga0070713_100018924 3300005436 Bacteria 5244
63 Ga0070700_100020842 3300005441 Bacteria 3804
64 Ga0070700_100038200 3300005441 Bacteria 2925
65 Ga0070694_100608024 3300005444 Bacteria 881
66 Ga0070694_100738971 3300005444 Bacteria 803
67 Ga0070663_100098572 3300005455 Bacteria 2178
68 Ga0070663_100590807 3300005455 Bacteria 933
69 Ga0070678_100132984 3300005456 Bacteria 1979
70 Ga0070678_100363343 3300005456 Bacteria 1248
71 Ga0070678_100685909 3300005456 Bacteria 922
72 Ga0070681_10259734 3300005458 Bacteria 1649
73 Ga0070698_100034849 3300005471 Bacteria 5207
74 Ga0070699_100001266 3300005518 Bacteria 23295
75 Ga0070699_100972890 3300005518 Bacteria 778
76 Ga0070684_100000166 3300005535 Bacteria 45212
77 Ga0070684_100506079 3300005535 Bacteria 1119
78 Ga0070672_100197870 3300005543 Bacteria 1680
79 Ga0070672_100304866 3300005543 Bacteria 1351
80 Ga0070672_100382132 3300005543 Bacteria 1205
81 Ga0070672_100557131 3300005543 Bacteria 996
82 Ga0070672_100693113 3300005543 Bacteria 892
83 Ga0070686_100386376 3300005544 Bacteria 1061
84 Ga0070695_100072900 3300005545 Bacteria 2252
85 Ga0070695_100828934 3300005545 Bacteria 743
86 Ga0070696_100215415 3300005546 Bacteria 1439
87 Ga0070696_100540765 3300005546 Bacteria 932
88 Ga0070693_100026270 3300005547 Bacteria 3142
89 Ga0070665_101281379 3300005548 Bacteria 743
90 Ga0070704_100030216 3300005549 Bacteria 3628
91 Ga0070664_100009365 3300005564 Bacteria 7941
92 Ga0070664_100128339 3300005564 Bacteria 2226
93 Ga0070664_100415934 3300005564 Bacteria 1231
94 Ga0070664_100716256 3300005564 Bacteria 933
95 Ga0068856_100265569 3300005614 Bacteria 1732
96 Ga0070702_100005168 3300005615 Bacteria 6043
97 Ga0068859_100784460 3300005617 Bacteria 1041
98 Ga0068864_101170761 3300005618 Bacteria 767
99 Ga0068861_100019101 3300005719 Bacteria 4894
100 Ga0068861_100170030 3300005719 Bacteria 1806
101 Ga0068861_100599356 3300005719 Bacteria 1011
102 Ga0068861_101830081 3300005719 Bacteria 603
103 Ga0068851_10270367 3300005834 Bacteria 969
104 Ga0068863_100865763 3300005841 Bacteria 903
105 Ga0068863_101485358 3300005841 Bacteria 686
106 Ga0068862_100035412 3300005844 Bacteria 4228
107 Ga0068862_100200782 3300005844 Bacteria 1798
108 Ga0068862_100331869 3300005844 Bacteria 1406
109 Ga0068862_100557333 3300005844 Bacteria 1095
110 Ga0081539_10000074 3300005985 Bacteria 231435
111 Ga0081539_10001558 3300005985 Bacteria 38098
112 Ga0081539_10001853 3300005985 Bacteria 33320
113 Ga0081539_10040561 3300005985 Bacteria 2731
114 Ga0081539_10179139 3300005985 Bacteria 996
115 Ga0070717_10415409 3300006028 Bacteria 1210
116 Ga0075368_10052983 3300006042 Bacteria 1614
117 Ga0075363_100323192 3300006048 Bacteria 898
118 Ga0075364_10001357 3300006051 Bacteria 13208
119 Ga0075364_10180189 3300006051 Bacteria 1429
120 Ga0075364_10272761 3300006051 Bacteria 1151
121 Ga0075362_10000746 3300006177 Bacteria 9684
122 Ga0075362_10130114 3300006177 Bacteria 1196
123 Ga0075367_10030679 3300006178 Bacteria 3084
124 Ga0075367_10076777 3300006178 Bacteria 2016
125 Ga0075367_10100255 3300006178 Bacteria 1769
126 Ga0075367_10173273 3300006178 Bacteria 1344
127 Ga0075366_10122669 3300006195 Bacteria 1566
128 Ga0075366_10159559 3300006195 Bacteria 1366
129 Ga0097621_100146702 3300006237 Bacteria 2021
130 Ga0097621_100435440 3300006237 Bacteria 1179
131 Ga0097621_100894088 3300006237 Bacteria 827
132 Ga0075370_10100482 3300006353 Bacteria 1674
133 Ga0075370_10215271 3300006353 Bacteria 1135
134 Ga0075428_100000017 3300006844 Bacteria 147833
135 Ga0075428_100000295 3300006844 Bacteria 48665
136 Ga0075428_100069014 3300006844 Bacteria 3867
137 Ga0075428_100073237 3300006844 Bacteria 3741
138 Ga0075430_100003248 3300006846 Bacteria 13620
139 Ga0075430_100017811 3300006846 Bacteria 6047
140 Ga0075430_100020871 3300006846 Bacteria 5569
141 Ga0075430_100033466 3300006846 Bacteria 4362
142 Ga0075430_100315830 3300006846 Bacteria 1292
143 Ga0075430_100822014 3300006846 Bacteria 766
144 Ga0075430_101013247 3300006846 Bacteria 684
145 Ga0075431_100004098 3300006847 Bacteria 14230
146 Ga0075431_100047382 3300006847 Bacteria 4431
147 Ga0075431_100120157 3300006847 Bacteria 2711
148 Ga0075431_100139379 3300006847 Bacteria 2500
149 Ga0075431_100238020 3300006847 Bacteria 1853
150 Ga0075431_100781717 3300006847 Bacteria 929
151 Ga0075433_10090367 3300006852 Bacteria 2707
152 Ga0075433_10125663 3300006852 Bacteria 2278
153 Ga0075433_10149209 3300006852 Bacteria 2079
154 Ga0075433_10260473 3300006852 Bacteria 1537
155 Ga0075433_10553867 3300006852 Bacteria 1011
156 Ga0075434_100504270 3300006871 Bacteria 1231
157 Ga0075434_101262632 3300006871 Bacteria 750
158 Ga0075434_101469276 3300006871 Bacteria 691
159 Ga0075429_100043580 3300006880 Bacteria 3905
160 Ga0075429_100399298 3300006880 Bacteria 1204
161 Ga0075429_100517201 3300006880 Bacteria 1046
162 Ga0075429_100810836 3300006880 Bacteria 820
163 Ga0068865_100695936 3300006881 Bacteria 868
164 Ga0097620_100784377 3300006931 Bacteria 1041
165 Ga0075435_100902238 3300007076 Bacteria 771
166 Ga0105240_10103506 3300009093 Bacteria 3459
167 Ga0105240_10151938 3300009093 Bacteria 2757
168 Ga0111539_10000002 3300009094 Bacteria 983359
169 Ga0111539_10000037 3300009094 Bacteria 143023
170 Ga0111539_10008348 3300009094 Bacteria 13180
171 Ga0111539_10024995 3300009094 Bacteria 7320
172 Ga0111539_10132671 3300009094 Bacteria 2917
173 Ga0111539_10366981 3300009094 Bacteria 1676
174 Ga0111539_10568136 3300009094 Bacteria 1321
175 Ga0111539_10724381 3300009094 Bacteria 1158
176 Ga0111539_11339402 3300009094 Bacteria 831
177 Ga0111539_11574096 3300009094 Bacteria 762
178 Ga0105247_11185299 3300009101 Bacteria 607
179 Ga0114129_10004316 3300009147 Bacteria 20102
180 Ga0114129_10008636 3300009147 Bacteria 14525
181 Ga0114129_10009195 3300009147 Bacteria 14088
182 Ga0114129_10015583 3300009147 Bacteria 10808
183 Ga0114129_10055131 3300009147 Bacteria 5572
184 Ga0114129_11368661 3300009147 Bacteria 874
185 Ga0105243_11554325 3300009148 Bacteria 687
186 Ga0105241_10036009 3300009174 Bacteria 3724
187 Ga0105242_10862317 3300009176 Bacteria 902
188 Ga0105242_12162645 3300009176 Bacteria 601
189 Ga0105248_10221608 3300009177 Bacteria 2129
190 Ga0105248_10222454 3300009177 Bacteria 2125
191 Ga0105248_10777388 3300009177 Bacteria 1081
192 Ga0105248_13044020 3300009177 Bacteria 534
193 Ga0105237_10148692 3300009545 Bacteria 2338
194 Ga0105238_10298326 3300009551 Bacteria 1595
195 Ga0105249_10116358 3300009553 Bacteria 2534
196 Ga0105249_10339804 3300009553 Bacteria 1518
197 Ga0105249_10656757 3300009553 Bacteria 1106
198 Ga0105239_10340380 3300010375 Bacteria 1693
199 Ga0105246_10531502 3300011119 Bacteria 1004
200 Ga0157378_10479074 3300013297 Bacteria 1240
201 Ga0163162_10008950 3300013306 Bacteria 9733
202 Ga0163162_10256904 3300013306 Bacteria 1879
203 Ga0163162_10841242 3300013306 Bacteria 1033
204 Ga0157375_10439164 3300013308 Bacteria 1471
205 Ga0157375_10780624 3300013308 Bacteria 1105
206 Ga0157375_12076562 3300013308 Bacteria 676
207 Ga0163163_10003825 3300014325 Bacteria 12818
208 Ga0163163_10030417 3300014325 Bacteria 5204
209 Ga0163163_10304756 3300014325 Bacteria 1645
210 Ga0157380_10108216 3300014326 Bacteria 2330
211 Ga0157380_10396133 3300014326 Bacteria 1308
212 Ga0157380_10545858 3300014326 Bacteria 1136
213 Ga0157380_10984312 3300014326 Bacteria 876
214 Ga0157380_11152707 3300014326 Bacteria 817
215 Ga0157380_11297186 3300014326 Unclassified 775
216 Ga0157380_11587689 3300014326 Bacteria 709
217 Ga0157377_10041220 3300014745 Bacteria 2561
218 Ga0157379_11452105 3300014968 Bacteria 666
219 Ga0157376_10357727 3300014969 Bacteria 1399
220 Ga0157376_10382089 3300014969 Bacteria 1357
221 Ga0157376_10904952 3300014969 Bacteria 901
222 Ga0207666_1040252 3300025271 Bacteria 730
223 Ga0207697_10000717 3300025315 Bacteria 18881
224 Ga0207682_10082501 3300025893 Bacteria 1380
225 Ga0207688_10001322 3300025901 Bacteria 12879
226 Ga0207680_10093459 3300025903 Bacteria 1918
227 Ga0207680_10192550 3300025903 Bacteria 1385
228 Ga0207680_10330409 3300025903 Bacteria 1068
229 Ga0207643_10106690 3300025908 Bacteria 1646
230 Ga0207643_10664206 3300025908 Bacteria 673
231 Ga0207705_10779332 3300025909 Bacteria 742
232 Ga0207707_10125793 3300025912 Bacteria 2242
233 Ga0207671_10082575 3300025914 Bacteria 2411
234 Ga0207657_10649472 3300025919 Bacteria 821
235 Ga0207649_10021247 3300025920 Bacteria 3733
236 Ga0207649_10862147 3300025920 Bacteria 709
237 Ga0207681_10003863 3300025923 Bacteria 9307
238 Ga0207681_11352844 3300025923 Bacteria 598
239 Ga0207650_10016257 3300025925 Bacteria 5198
240 Ga0207650_10077153 3300025925 Bacteria 2518
241 Ga0207650_10260187 3300025925 Bacteria 1407
242 Ga0207659_10028324 3300025926 Bacteria 3806
243 Ga0207659_10055057 3300025926 Bacteria 2843
244 Ga0207659_10095935 3300025926 Bacteria 2225
245 Ga0207659_10200018 3300025926 Bacteria 1595
246 Ga0207659_10261151 3300025926 Bacteria 1409
247 Ga0207659_10622685 3300025926 Bacteria 921
248 Ga0207644_10052792 3300025931 Bacteria 2923
249 Ga0207644_10455445 3300025931 Bacteria 1051
250 Ga0207690_10077857 3300025932 Bacteria 2306
251 Ga0207706_10345068 3300025933 Bacteria 1295
252 Ga0207709_11071088 3300025935 Bacteria 661
253 Ga0207669_10041536 3300025937 Bacteria 2678
254 Ga0207669_10076108 3300025937 Bacteria 2129
255 Ga0207669_10079190 3300025937 Bacteria 2097
256 Ga0207669_10112204 3300025937 Bacteria 1830
257 Ga0207669_10121789 3300025937 Bacteria 1773
258 Ga0207669_10763035 3300025937 Bacteria 800
259 Ga0207691_10149718 3300025940 Bacteria 2052
260 Ga0207691_10211982 3300025940 Bacteria 1682
261 Ga0207691_10523878 3300025940 Bacteria 1006
262 Ga0207691_10547518 3300025940 Bacteria 981
263 Ga0207711_10120457 3300025941 Bacteria 2342
264 Ga0207711_10907801 3300025941 Bacteria 819
265 Ga0207661_10020111 3300025944 Bacteria 4985
266 Ga0207661_10108572 3300025944 Bacteria 2343
267 Ga0207679_10005801 3300025945 Bacteria 7751
268 Ga0207679_10641560 3300025945 Bacteria 960
269 Ga0207651_10187694 3300025960 Bacteria 1646
270 Ga0207651_11392180 3300025960 Bacteria 631
271 Ga0207712_10004344 3300025961 Bacteria 8955
272 Ga0207712_10372625 3300025961 Bacteria 1193
273 Ga0207712_10669844 3300025961 Bacteria 903
274 Ga0207668_10270489 3300025972 Bacteria 1389
275 Ga0207668_11098358 3300025972 Bacteria 713
276 Ga0207640_10267345 3300025981 Bacteria 1336
277 Ga0207640_10837246 3300025981 Bacteria 799
278 Ga0207640_11707054 3300025981 Bacteria 568
279 Ga0207658_10857419 3300025986 Bacteria 826
280 Ga0207658_10978303 3300025986 Bacteria 772
281 Ga0207678_10132479 3300026067 Bacteria 2127
282 Ga0207708_10067174 3300026075 Bacteria 2742
283 Ga0207708_10070516 3300026075 Bacteria 2676
284 Ga0207708_10744203 3300026075 Bacteria 841
285 Ga0207702_10135324 3300026078 Bacteria 2223
286 Ga0207641_10291226 3300026088 Bacteria 1539
287 Ga0207641_10812847 3300026088 Bacteria 925
288 Ga0207641_11385543 3300026088 Bacteria 704
289 Ga0207676_10140197 3300026095 Bacteria 2069
290 Ga0207676_10159926 3300026095 Bacteria 1950
291 Ga0207674_10603316 3300026116 Bacteria 1060
292 Ga0207674_10975228 3300026116 Bacteria 816
293 Ga0207675_100011213 3300026118 Bacteria 8393
294 Ga0207675_100339487 3300026118 Bacteria 1470
295 Ga0207675_101233964 3300026118 Bacteria 768
296 Ga0207683_10055481 3300026121 Bacteria 3474
297 Ga0207683_10118218 3300026121 Bacteria 2378
298 Ga0207683_10413841 3300026121 Bacteria 1241
299 Ga0207683_10731172 3300026121 Bacteria 918
300 Ga0209968_1018725 3300027526 Bacteria 1111
301 Ga0209998_10046096 3300027717 Bacteria 1000
302 Ga0209813_10107085 3300027866 Bacteria 958
303 Ga0209974_10176669 3300027876 Bacteria 780
304 Ga0207428_10000004 3300027907 Bacteria 727800
305 Ga0207428_10001068 3300027907 Bacteria 30064
306 Ga0207428_10012687 3300027907 Bacteria 7389
307 Ga0207428_10243210 3300027907 Bacteria 1344
308 Ga0207428_10535986 3300027907 Bacteria 848
309 Ga0268265_10018118 3300028380 Bacteria 4875
310 Ga0268265_10159237 3300028380 Bacteria 1915
311 Ga0268265_10355028 3300028380 Bacteria 1340
312 Ga0268265_10378813 3300028380 Bacteria 1301
313 Ga0268265_10545157 3300028380 Bacteria 1100
314 Ga0268265_11780363 3300028380 Bacteria 622
315 Ga0268264_10129238 3300028381 Bacteria 2237
316 Ga0268264_11064473 3300028381 Bacteria 817
317 Ga0307408_100030568 3300031548 Bacteria 3741
318 Ga0307408_100201185 3300031548 Bacteria 1612
319 Ga0307408_100396225 3300031548 Bacteria 1184
320 Ga0307408_101103814 3300031548 Bacteria 736
321 Ga0307408_101617492 3300031548 Bacteria 615
322 Ga0307405_10030293 3300031731 Bacteria 3172
323 Ga0307405_10973968 3300031731 Bacteria 722
324 Ga0307413_10081301 3300031824 Bacteria 2077
325 Ga0307413_10690389 3300031824 Bacteria 847
326 Ga0307413_10794136 3300031824 Bacteria 795
327 Ga0307410_10031322 3300031852 Bacteria 3412
328 Ga0307410_10187188 3300031852 Bacteria 1572
329 Ga0307410_10357881 3300031852 Bacteria 1168
330 Ga0307406_10078753 3300031901 Bacteria 2184
331 Ga0307406_10534429 3300031901 Bacteria 956
332 Ga0307407_10013207 3300031903 Bacteria 3999
333 Ga0307407_10473829 3300031903 Bacteria 913
334 Ga0307407_10488159 3300031903 Bacteria 901
335 Ga0307407_10559304 3300031903 Bacteria 847
336 Ga0307412_10004341 3300031911 Bacteria 7907
337 Ga0307412_10057260 3300031911 Bacteria 2601
338 Ga0307409_100016611 3300031995 Bacteria 4876
339 Ga0307409_100198041 3300031995 Bacteria 1794
340 Ga0307409_100440710 3300031995 Bacteria 1255
341 Ga0307416_100019683 3300032002 Bacteria 4793
342 Ga0307416_100032671 3300032002 Bacteria 3936
343 Ga0307416_100077431 3300032002 Bacteria 2793
344 Ga0307416_100107948 3300032002 Bacteria 2444
345 Ga0307416_100108892 3300032002 Bacteria 2435
346 Ga0307416_100111565 3300032002 Bacteria 2411
347 Ga0307416_100131191 3300032002 Bacteria 2256
348 Ga0307416_100294305 3300032002 Bacteria 1609
349 Ga0307416_100939416 3300032002 Bacteria 966
350 Ga0307416_101195397 3300032002 Bacteria 866
351 Ga0307414_10065988 3300032004 Bacteria 2585
352 Ga0307414_10499577 3300032004 Bacteria 1076
353 Ga0307411_10022399 3300032005 Bacteria 3719
354 Ga0307411_10074438 3300032005 Bacteria 2314
355 Ga0307411_10249991 3300032005 Bacteria 1393
356 Ga0307411_10336041 3300032005 Bacteria 1226
357 Ga0307411_10573462 3300032005 Bacteria 966
358 Ga0307411_10584277 3300032005 Bacteria 958
359 Ga0307411_10670192 3300032005 Bacteria 900
360 Ga0307415_100067318 3300032126 Bacteria 2502
361 Ga0307415_100233055 3300032126 Bacteria 1484
362 Ga0307415_100416548 3300032126 Bacteria 1151
363 Ga0307415_100679630 3300032126 Bacteria 926
364 Ga0373929_0082191 3300035085 Bacteria 787
365 Ga0373945_0079918 3300035116 Bacteria 1251
366 Ga0373946_0159597 3300035171 Bacteria 1058
367 Ga0373931_0909359 3300035691 Bacteria 592
368 Ga0373935_0188915 3300035692 Bacteria 1418
369 Ga0373935_0251565 3300035692 Bacteria 1237
370 Ga0373933_0172169 3300035724 Bacteria 1378
371 Ga0373933_0517343 3300035724 Bacteria 782
372 Ga0373937_0025518 3300036401 Bacteria 5335
373 Ga0373925_1050376 3300037068 Bacteria 670
374 Ga0451800_1266025 3300041459 Bacteria 908
375 Ga0451807_1318327 3300041486 Bacteria 769
376 Ga0451841_0375391 3300041498 Bacteria 691
377 Ga0451843_0700692 3300041509 Bacteria 694
378 Ga0451853_1554116 3300041512 Bacteria 1049
379 Ga0439431_0045483 3300041997 Bacteria 1127
380 Ga0439433_0040321 3300041999 Bacteria 1086
381 Ga0439433_0114530 3300041999 Bacteria 676
382 Ga0439437_017052 3300042000 Bacteria 861
383 Ga0439445_0022985 3300042004 Bacteria 1576
384 Ga0439450_010750 3300042008 Bacteria 1773
385 Ga0439462_0058283 3300042015 Bacteria 1044
386 Ga0450920_039900 3300042122 Bacteria 935
387 Ga0450896_026488 3300042133 Bacteria 865
388 Ga0439446_0017402 3300042156 Bacteria 2009
389 Ga0439446_0018579 3300042156 Bacteria 1949
390 Ga0439446_0072768 3300042156 Bacteria 1054
391 Ga0439435_0012867 3300042436 Bacteria 2037
392 Ga0439435_0044165 3300042436 Bacteria 1256
393 Ga0439435_0138662 3300042436 Bacteria 773
394 Ga0439444_0067247 3300042437 Bacteria 760
395 Ga0439444_0074934 3300042437 Bacteria 731
396 Ga0439464_0039402 3300042439 Bacteria 1343
397 Ga0439464_0090786 3300042439 Bacteria 921
398 Ga0439460_0026127 3300042461 Bacteria 1631
399 Ga0439460_0033799 3300042461 Bacteria 1471
400 Ga0439460_0080817 3300042461 Bacteria 1020
401 Ga0451577_0125270 3300042876 Bacteria 2302
402 Ga0439440_0046765 3300042993 Bacteria 1070
403 Ga0453684_0335310 3300044712 Bacteria 1709
404 Ga0451576_0043533 3300045051 Bacteria 4736
405 Ga0451576_0094215 3300045051 Bacteria 3114
406 Ga0495592_0135150 3300046454 Bacteria 1721
407 Ga0495638_0008491 3300046460 Bacteria 7279
408 Ga0495582_0281907 3300046473 Bacteria 954
409 Ga0495639_0574761 3300046475 Bacteria 578
410 Ga0495608_0197436 3300046511 Bacteria 1269
411 Ga0495587_0475331 3300046536 Bacteria 692
412 Ga0495598_0040628 3300046537 Bacteria 1357
413 Ga0495656_0039211 3300046615 Bacteria 1967
414 Ga0495635_0049123 3300046663 Bacteria 2908
415 Ga0495659_0021490 3300046664 Bacteria 2175
416 Ga0495659_0307617 3300046664 Bacteria 671
417 Ga0495647_0152101 3300046681 Bacteria 993
418 Ga0495658_0061320 3300046683 Bacteria 2159
419 Ga0495600_0117828 3300046809 Bacteria 1728
420 Ga0495636_0120564 3300047318 Bacteria 1160
421 Ga0495674_0107881 3300047319 Bacteria 2363
422 Ga0495674_0249426 3300047319 Bacteria 1461
423 Ga0495674_1065018 3300047319 Bacteria 617
424 Ga0495672_0120022 3300047320 Bacteria 1399
425 Ga0495684_0261197 3300047471 Bacteria 1256
426 Ga0495684_0273969 3300047471 Bacteria 1220
427 Ga0496101_0601485 3300048904 Bacteria 869
428 Ga0496102_0028152 3300048905 Bacteria 5020
429 Ga0496102_0339962 3300048905 Bacteria 1414
430 Ga0496103_0529891 3300048906 Bacteria 753
431 Ga0496104_0265287 3300048907 Bacteria 1630
432 Ga0496104_0282814 3300048907 Bacteria 1572
433 Ga0496105_0339869 3300048908 Bacteria 1201
434 Ga0496106_0631757 3300048909 Bacteria 856
435 Ga0496108_0050479 3300048911 Bacteria 3482
436 Ga0496109_0018373 3300048912 Bacteria 6143
437 Ga0496109_1558771 3300048912 Bacteria 595
438 Ga0496110_0011815 3300048913 Bacteria 7168
439 Ga0496111_0012097 3300048914 Bacteria 5836
440 Ga0496111_0088437 3300048914 Bacteria 2269
441 Ga0496112_0003634 3300048915 Bacteria 12846
442 Ga0496113_0212734 3300048916 Bacteria 1539
443 Ga0496114_0100789 3300048917 Bacteria 2465
444 Ga0496114_0438191 3300048917 Bacteria 1157
445 Ga0496114_0710662 3300048917 Bacteria 881
446 Ga0496115_0520649 3300048918 Bacteria 954
447 Ga0501292_001564 3300049515 Bacteria 2833
448 Ga0501299_022960 3300049522 Bacteria 1154
449 Ga0501299_097809 3300049522 Bacteria 677
450 Ga0501300_032088 3300049523 Bacteria 777
451 Ga0501031_0028667 3300049568 Bacteria 3630
452 Ga0501031_0077005 3300049568 Bacteria 2172
453 Ga0501031_0100742 3300049568 Bacteria 1885
454 Ga0501031_0202990 3300049568 Bacteria 1293
455 Ga0501032_0316046 3300049569 Bacteria 1008
456 Ga0501033_0137386 3300049570 Bacteria 1768
457 Ga0501033_0532023 3300049570 Bacteria 811
458 Ga0501034_0020238 3300049571 Bacteria 6795
459 Ga0501034_0106719 3300049571 Bacteria 2793
460 Ga0501034_0115821 3300049571 Bacteria 2668
461 Ga0501034_0861575 3300049571 Bacteria 795
462 Ga0501036_0018205 3300049572 Bacteria 5882
463 Ga0501036_0323016 3300049572 Bacteria 1289
464 Ga0501036_1097418 3300049572 Bacteria 650
465 Ga0501036_1696559 3300049572 Bacteria 509
466 Ga0501037_0104826 3300049573 Bacteria 2038
467 Ga0501037_0291201 3300049573 Bacteria 1136
468 Ga0501038_0173861 3300049574 Bacteria 1741
469 Ga0501038_0361112 3300049574 Bacteria 1129
470 Ga0501038_0433622 3300049574 Bacteria 1012
471 Ga0501039_0006784 3300049575 Bacteria 8707
472 Ga0501039_0146214 3300049575 Bacteria 1857
473 Ga0501039_0293359 3300049575 Bacteria 1278
474 Ga0501040_0067255 3300049576 Bacteria 2469
475 Ga0501040_0238818 3300049576 Bacteria 1295
476 Ga0501040_0568752 3300049576 Bacteria 818
477 Ga0501040_0698474 3300049576 Bacteria 734
478 Ga0501040_0960159 3300049576 Bacteria 619
479 Ga0501041_0012600 3300049577 Bacteria 5009
480 Ga0501041_0449975 3300049577 Bacteria 818
481 Ga0501042_0175687 3300049578 Bacteria 1545
482 Ga0501042_0198924 3300049578 Bacteria 1445
483 Ga0501043_0001515 3300049579 Bacteria 20276
484 Ga0501046_0056943 3300049580 Bacteria 3067
485 Ga0501047_0000655 3300049581 Bacteria 36211
486 Ga0501047_0020226 3300049581 Bacteria 6392
487 Ga0501047_0997622 3300049581 Bacteria 650
488 Ga0501048_0322227 3300049582 Bacteria 1101
489 Ga0501048_0395491 3300049582 Bacteria 987
490 Ga0501067_0086419 3300049583 Bacteria 1740
491 Ga0501067_0102782 3300049583 Bacteria 1588
492 Ga0501067_0104188 3300049583 Bacteria 1576
493 Ga0501068_0023032 3300049584 Bacteria 3649
494 Ga0501068_0144844 3300049584 Bacteria 1491
495 Ga0501068_0374429 3300049584 Bacteria 916
496 Ga0501068_0582052 3300049584 Bacteria 729
497 Ga0501070_0289836 3300049586 Bacteria 1334
498 Ga0501071_0040967 3300049587 Bacteria 3316
499 Ga0501071_0198355 3300049587 Bacteria 1507
500 Ga0501071_0386114 3300049587 Bacteria 1068
501 Ga0501072_0096244 3300049588 Bacteria 2353
502 Ga0501072_0121998 3300049588 Bacteria 2076
503 Ga0501072_0188081 3300049588 Bacteria 1647
504 Ga0501072_0205294 3300049588 Bacteria 1571
505 Ga0501072_0235429 3300049588 Bacteria 1458
506 Ga0501072_0620448 3300049588 Bacteria 852
507 Ga0501073_0069110 3300049589 Bacteria 2461
508 Ga0501073_0179319 3300049589 Bacteria 1466
509 Ga0501073_0745195 3300049589 Bacteria 675
510 Ga0501073_0909887 3300049589 Bacteria 606
511 Ga0501074_0057226 3300049590 Bacteria 2809
512 Ga0501074_0226228 3300049590 Bacteria 1332
513 Ga0501074_0836872 3300049590 Bacteria 648
514 Ga0501075_0016140 3300049591 Bacteria 5375
515 Ga0501075_0025261 3300049591 Bacteria 4365
516 Ga0501075_0137163 3300049591 Bacteria 1864
517 Ga0501075_0304239 3300049591 Bacteria 1215
518 Ga0501075_0655270 3300049591 Bacteria 800
519 Ga0501075_1304262 3300049591 Bacteria 550
520 Ga0501076_0002349 3300049592 Bacteria 12942
521 Ga0501076_0017306 3300049592 Bacteria 5476
522 Ga0501076_0052814 3300049592 Bacteria 3220
523 Ga0501076_0325057 3300049592 Bacteria 1262
524 Ga0501076_0718808 3300049592 Bacteria 824
525 Ga0501076_1054189 3300049592 Bacteria 670
526 Ga0501077_0033000 3300049593 Bacteria 3296
527 Ga0501077_0163910 3300049593 Bacteria 1412
528 Ga0501077_0241339 3300049593 Bacteria 1149
529 Ga0501077_0657962 3300049593 Bacteria 673
530 Ga0501208_130984 3300049655 Bacteria 560
531 Ga0501211_004634 3300049658 Bacteria 1394
532 Ga0501217_080814 3300049661 Bacteria 899
533 Ga0501233_080764 3300049668 Bacteria 837
534 Ga0501246_006699 3300049676 Bacteria 992
535 Ga0501261_008614 3300049690 Bacteria 1320
536 Ga0501225_0205906 3300049705 Bacteria 627
537 Ga0501079_0121992 3300049741 Bacteria 2027
538 Ga0501079_0862700 3300049741 Bacteria 713
539 Ga0501080_0004681 3300049742 Bacteria 12201
540 Ga0501080_0046088 3300049742 Bacteria 4061
541 Ga0501080_0059920 3300049742 Bacteria 3542
542 Ga0501080_0711364 3300049742 Bacteria 885
543 Ga0501081_0047734 3300049743 Bacteria 2946
544 Ga0501081_0160062 3300049743 Bacteria 1622
545 Ga0501083_0011535 3300049744 Bacteria 6198
546 Ga0501083_0035680 3300049744 Bacteria 3396
547 Ga0501083_0044372 3300049744 Bacteria 3009
548 Ga0501083_0621858 3300049744 Bacteria 702
549 Ga0501266_053971 3300049763 Bacteria 627
550 Ga0501270_017764 3300049767 Bacteria 1045
551 Ga0501283_037067 3300049779 Bacteria 834
552 Ga0501035_0087739 3300049822 Bacteria 2741
553 Ga0501035_0621703 3300049822 Bacteria 878
554 Ga0501035_0799212 3300049822 Bacteria 754
555 Ga0501044_0399364 3300049823 Bacteria 1287
556 Ga0501044_0790490 3300049823 Bacteria 829
557 Ga0501045_0003977 3300049824 Bacteria 10174
558 Ga0501045_0203817 3300049824 Bacteria 1474
559 Ga0501045_0252051 3300049824 Bacteria 1314
560 nmdc:mga03683_130170_c1 3300050489 Bacteria 1125
561 nmdc:mga03683_18662_c1 3300050489 Bacteria 2639
562 nmdc:mga00v17_209911_c1 3300050491 Bacteria 1260
563 nmdc:mga00v17_258565_c1 3300050491 Bacteria 1129
564 nmdc:mga00v17_3790_c1 3300050491 Bacteria 5428
565 nmdc:mga0yw44_314216_c1 3300050492 Bacteria 1051
566 nmdc:mga0k408_369372_c1 3300050493 Bacteria 855
567 nmdc:mga0k408_8033_c1 3300050493 Bacteria 5656
568 nmdc:mga0k408_8489_c1 3300050493 Bacteria 5517
569 nmdc:mga06z11_167416_c1 3300050494 Bacteria 1260
570 nmdc:mga06z11_50336_c1 3300050494 Bacteria 2129
571 nmdc:mga06z11_60949_c1 3300050494 Bacteria 1966
572 nmdc:mga04h51_15505_c1 3300050495 Bacteria 2196
573 nmdc:mga04h51_18673_c1 3300050495 Bacteria 1702
574 nmdc:mga05p37_1981_c1 3300050507 Bacteria 23880
575 nmdc:mga05p37_2447_c1 3300050507 Bacteria 21583
576 nmdc:mga05p37_36837_c2 3300050507 Bacteria 5679
577 nmdc:mga05p37_59395_c1 3300050507 Bacteria 4709
578 nmdc:mga05p37_8178_c1 3300050507 Bacteria 12363
579 nmdc:mga09592_316841_c1 3300050508 Bacteria 1351
580 nmdc:mga09592_472546_c1 3300050508 Bacteria 1081
581 nmdc:mga09592_55588_c1 3300050508 Bacteria 3345
582 nmdc:mga09592_866322_c1 3300050508 Bacteria 761
583 nmdc:mga0qj67_19983_c1 3300050509 Bacteria 5126
584 nmdc:mga0qj67_24872_c1 3300050509 Bacteria 4621
585 nmdc:mga0qj67_5153_c1 3300050509 Bacteria 9527
586 nmdc:mga0qj67_726744_c1 3300050509 Bacteria 789
587 nmdc:mga0qj67_76380_c1 3300050509 Bacteria 2679
588 nmdc:mga06r32_1282030_c1 3300050510 Bacteria 677
589 nmdc:mga06r32_13185_c1 3300050510 Bacteria 7488
590 nmdc:mga06r32_156746_c1 3300050510 Bacteria 2258
591 nmdc:mga06r32_1592340_c1 3300050510 Bacteria 592
592 nmdc:mga06r32_324008_c1 3300050510 Bacteria 1526
593 nmdc:mga06r32_38067_c1 3300050510 Bacteria 4554
594 nmdc:mga06r32_9552_c1 3300050510 Bacteria 8758
595 nmdc:mga08y16_109057_c1 3300050511 Bacteria 2882
596 nmdc:mga08y16_1150799_c1 3300050511 Bacteria 749
597 nmdc:mga08y16_17529_c1 3300050511 Bacteria 7542
598 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
599 nmdc:mga08y16_3529_c1 3300050511 Bacteria 16237
600 nmdc:mga08y16_408326_c1 3300050511 Bacteria 1389
601 nmdc:mga08y16_52143_c1 3300050511 Bacteria 4280
602 nmdc:mga08y16_666541_c1 3300050511 Bacteria 1043
603 nmdc:mga0n895_195581_c2 3300050512 Bacteria 1040
604 nmdc:mga0n895_376660_c1 3300050512 Bacteria 1436
605 nmdc:mga0n895_5943_c1 3300050512 Bacteria 10266
606 nmdc:mga0a205_18430_c1 3300050515 Bacteria 6563
607 nmdc:mga0a205_18629_c1 3300050515 Bacteria 6531
608 nmdc:mga0a205_389558_c1 3300050515 Bacteria 1258
609 nmdc:mga0a205_42207_c1 3300050515 Bacteria 4394
610 nmdc:mga0a205_48168_c1 3300050515 Bacteria 4113
611 nmdc:mga0a205_74704_c1 3300050515 Bacteria 3275
612 nmdc:mga0a205_82233_c1 3300050515 Bacteria 3110
613 Ga0495601_0312208 3300053077 Bacteria 1024
614 Ga0495601_0469590 3300053077 Bacteria 813
615 Ga0495612_0342904 3300053078 Bacteria 674
616 Ga0500641_0006072 3300053096 Bacteria 4280
617 Ga0500556_0007078 3300053104 Bacteria 3203
618 Ga0500568_0013092 3300053139 Bacteria 3793
619 Ga0500616_0003513 3300053153 Bacteria 11902
620 Ga0500611_043423 3300053727 Bacteria 998
621 Ga0501084_0006193 3300054114 Bacteria 9838
622 Ga0501084_0012966 3300054114 Bacteria 6902
623 Ga0501084_0228904 3300054114 Bacteria 1569
624 Ga0501084_0710714 3300054114 Bacteria 847
625 Ga0501084_0895238 3300054114 Bacteria 746
626 Ga0590071_040230 3300059421 Bacteria 1124
627 Ga0590071_052993 3300059421 Bacteria 985
628 Ga0590071_057838 3300059421 Bacteria 945
629 Ga0590075_050668 3300059424 Bacteria 1065
630 Ga0590075_066463 3300059424 Bacteria 930
631 Ga0590077_000256 3300059426 Bacteria 15185
632 Ga0501082_0074604 3300060353 Bacteria 2922
633 Ga0501082_0084295 3300060353 Bacteria 2741
634 Ga0501082_0269235 3300060353 Bacteria 1482
635 Ga0501082_0763864 3300060353 Bacteria 846
636 Ga0501082_0884055 3300060353 Bacteria 782
637 Ga0501082_1077570 3300060353 Bacteria 702
638 Ga0530510_0004651 3300061734 Bacteria 9494
639 Ga0530510_0487647 3300061734 Bacteria 934

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10664206 Ga0207643_106642061 134
2 3300049572 Ga0501036_1696559 Ga0501036_1696559_52_480 140
3 3300049574 Ga0501038_0173861 Ga0501038_0173861_1298_1729 141
4 3300050515 nmdc:mga0a205_389558_c1 nmdc:mga0a205_389558_c1_690_1196 141
5 3300035085 Ga0373929_0082191 Ga0373929_0082191_333_776 142
6 3300049591 Ga0501075_1304262 Ga0501075_1304262_34_468 143
7 3300049763 Ga0501266_053971 Ga0501266_053971_25_465 144
8 3300014326 Ga0157380_11587689 Ga0157380_115876892 147
9 3300025937 Ga0207669_10121789 Ga0207669_101217892 147
10 3300006237 Ga0097621_100894088 Ga0097621_1008940882 152
11 3300003203 JGI25406J46586_10000551 JGI25406J46586_1000055112 153
12 3300005985 Ga0081539_10000074 Ga0081539_1000007418 153
13 3300006042 Ga0075368_10052983 Ga0075368_100529833 153
14 3300006048 Ga0075363_100323192 Ga0075363_1003231922 153
15 3300006178 Ga0075367_10173273 Ga0075367_101732732 153
16 3300027866 Ga0209813_10107085 Ga0209813_101070852 153
17 3300050495 nmdc:mga04h51_18673_c1 nmdc:mga04h51_18673_c1_348_875 153
18 3300005331 Ga0070670_100186698 Ga0070670_1001866982 154
19 3300005344 Ga0070661_100934584 Ga0070661_1009345841 154
20 3300005564 Ga0070664_100415934 Ga0070664_1004159342 154
21 3300041486 Ga0451807_1318327 Ga0451807_1318327_178_714 154
22 3300046475 Ga0495639_0574761 Ga0495639_0574761_18_497 154
23 3300025937 Ga0207669_10763035 Ga0207669_107630352 155
24 3300027526 Ga0209968_1018725 Ga0209968_10187251 155
25 3300047320 Ga0495672_0120022 Ga0495672_0120022_702_1229 155
26 3300053139 Ga0500568_0013092 Ga0500568_0013092_2803_3330 155
27 3300007076 Ga0075435_100902238 Ga0075435_1009022382 157
28 3300005344 Ga0070661_100697914 Ga0070661_1006979142 158
29 3300006051 Ga0075364_10180189 Ga0075364_101801891 158
30 3300006177 Ga0075362_10130114 Ga0075362_101301142 158
31 3300006195 Ga0075366_10122669 Ga0075366_101226692 158
32 3300009093 Ga0105240_10151938 Ga0105240_101519382 158
33 3300050489 nmdc:mga03683_130170_c1 nmdc:mga03683_130170_c1_263_790 158
34 3300050491 nmdc:mga00v17_258565_c1 nmdc:mga00v17_258565_c1_564_1091 158
35 3300050494 nmdc:mga06z11_50336_c1 nmdc:mga06z11_50336_c1_782_1309 158
36 3300005347 Ga0070668_101386338 Ga0070668_1013863381 159
37 3300005441 Ga0070700_100038200 Ga0070700_1000382002 159
38 3300005719 Ga0068861_100019101 Ga0068861_1000191014 159
39 3300005844 Ga0068862_100331869 Ga0068862_1003318692 159
40 3300013308 Ga0157375_10780624 Ga0157375_107806242 159
41 3300014326 Ga0157380_10108216 Ga0157380_101082163 159
42 3300025935 Ga0207709_11071088 Ga0207709_110710881 159
43 3300025972 Ga0207668_11098358 Ga0207668_110983581 159
44 3300025981 Ga0207640_10837246 Ga0207640_108372461 159
45 3300026075 Ga0207708_10070516 Ga0207708_100705162 159
46 3300026118 Ga0207675_100011213 Ga0207675_1000112132 159
47 3300028380 Ga0268265_10355028 Ga0268265_103550282 159
48 3300035116 Ga0373945_0079918 Ga0373945_0079918_695_1213 159
49 3300035171 Ga0373946_0159597 Ga0373946_0159597_449_967 159
50 3300035692 Ga0373935_0188915 Ga0373935_0188915_200_718 159
51 3300037068 Ga0373925_1050376 Ga0373925_1050376_22_618 159
52 3300042004 Ga0439445_0022985 Ga0439445_0022985_640_1167 159
53 3300060353 Ga0501082_0884055 Ga0501082_0884055_194_697 159
54 3300005543 Ga0070672_100693113 Ga0070672_1006931131 160
55 3300009177 Ga0105248_13044020 Ga0105248_130440201 160
56 3300025923 Ga0207681_11352844 Ga0207681_113528441 160
57 3300005295 Ga0065707_10318638 Ga0065707_103186381 161
58 3300005985 Ga0081539_10001853 Ga0081539_1000185330 161
59 3300006852 Ga0075433_10149209 Ga0075433_101492093 161
60 3300009094 Ga0111539_10024995 Ga0111539_100249957 161
61 3300027907 Ga0207428_10243210 Ga0207428_102432102 161
62 3300050515 nmdc:mga0a205_48168_c1 nmdc:mga0a205_48168_c1_86_622 161
63 3300003203 JGI25406J46586_10001262 JGI25406J46586_100012623 163
64 3300005290 Ga0065712_10084760 Ga0065712_100847602 163
65 3300005985 Ga0081539_10001558 Ga0081539_100015583 163
66 3300006844 Ga0075428_100000017 Ga0075428_10000001756 163
67 3300006846 Ga0075430_101013247 Ga0075430_1010132472 163
68 3300006847 Ga0075431_100120157 Ga0075431_1001201573 163
69 3300006880 Ga0075429_100399298 Ga0075429_1003992982 163
70 3300009094 Ga0111539_10000002 Ga0111539_10000002382 163
71 3300025937 Ga0207669_10041536 Ga0207669_100415362 163
72 3300025941 Ga0207711_10907801 Ga0207711_109078012 163
73 3300025960 Ga0207651_11392180 Ga0207651_113921802 163
74 3300027907 Ga0207428_10000004 Ga0207428_10000004274 163
75 3300031548 Ga0307408_100201185 Ga0307408_1002011851 163
76 3300032002 Ga0307416_100077431 Ga0307416_1000774312 163
77 3300042436 Ga0439435_0138662 Ga0439435_0138662_86_616 163
78 3300042876 Ga0451577_0125270 Ga0451577_0125270_1478_1996 163
79 3300044712 Ga0453684_0335310 Ga0453684_0335310_1151_1669 163
80 3300050508 nmdc:mga09592_472546_c1 nmdc:mga09592_472546_c1_227_766 163
81 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_529207_529746 163
82 3300005436 Ga0070713_100018924 Ga0070713_1000189241 164
83 3300005455 Ga0070663_100098572 Ga0070663_1000985722 164
84 3300006028 Ga0070717_10415409 Ga0070717_104154092 164
85 3300006051 Ga0075364_10272761 Ga0075364_102727612 164
86 3300009545 Ga0105237_10148692 Ga0105237_101486923 164
87 3300010375 Ga0105239_10340380 Ga0105239_103403802 164
88 3300025914 Ga0207671_10082575 Ga0207671_100825753 164
89 3300026067 Ga0207678_10132479 Ga0207678_101324793 164
90 3300028381 Ga0268264_11064473 Ga0268264_110644732 164
91 3300035724 Ga0373933_0172169 Ga0373933_0172169_80_604 164
92 3300046511 Ga0495608_0197436 Ga0495608_0197436_637_1161 164
93 3300047319 Ga0495674_0249426 Ga0495674_0249426_924_1448 164
94 3300047471 Ga0495684_0261197 Ga0495684_0261197_135_659 164
95 3300053077 Ga0495601_0312208 Ga0495601_0312208_76_600 164
96 3300005295 Ga0065707_10167221 Ga0065707_101672213 165
97 3300025961 Ga0207712_10372625 Ga0207712_103726253 165
98 3300041509 Ga0451843_0700692 Ga0451843_0700692_119_652 165
99 3300041512 Ga0451853_1554116 Ga0451853_1554116_297_806 165
100 3300042156 Ga0439446_0072768 Ga0439446_0072768_333_842 165
101 3300049583 Ga0501067_0102782 Ga0501067_0102782_179_721 165
102 3300053153 Ga0500616_0003513 Ga0500616_0003513_9429_9956 165
103 3300005518 Ga0070699_100972890 Ga0070699_1009728901 166
104 3300006871 Ga0075434_101469276 Ga0075434_1014692761 166
105 3300026095 Ga0207676_10140197 Ga0207676_101401972 166
106 3300046460 Ga0495638_0008491 Ga0495638_0008491_3642_4172 166
107 3300048905 Ga0496102_0339962 Ga0496102_0339962_533_1033 166
108 3300049592 Ga0501076_0718808 Ga0501076_0718808_82_642 166
109 3300050512 nmdc:mga0n895_195581_c2 nmdc:mga0n895_195581_c2_94_612 166
110 3300053096 Ga0500641_0006072 Ga0500641_0006072_1498_2028 166
111 3300053727 Ga0500611_043423 Ga0500611_043423_261_791 166
112 3300005366 Ga0070659_100639026 Ga0070659_1006390262 167
113 3300005458 Ga0070681_10259734 Ga0070681_102597342 167
114 3300005614 Ga0068856_100265569 Ga0068856_1002655692 167
115 3300005841 Ga0068863_101485358 Ga0068863_1014853582 167
116 3300009093 Ga0105240_10103506 Ga0105240_101035063 167
117 3300014326 Ga0157380_11297186 Ga0157380_112971862 167
118 3300014968 Ga0157379_11452105 Ga0157379_114521051 167
119 3300025912 Ga0207707_10125793 Ga0207707_101257932 167
120 3300025932 Ga0207690_10077857 Ga0207690_100778573 167
121 3300026078 Ga0207702_10135324 Ga0207702_101353243 167
122 3300026116 Ga0207674_10603316 Ga0207674_106033161 167
123 3300036401 Ga0373937_0025518 Ga0373937_0025518_50_559 167
124 3300048917 Ga0496114_0438191 Ga0496114_0438191_76_585 167
125 3300049568 Ga0501031_0077005 Ga0501031_0077005_1541_2050 167
126 3300049568 Ga0501031_0202990 Ga0501031_0202990_90_599 167
127 3300049569 Ga0501032_0316046 Ga0501032_0316046_176_685 167
128 3300049570 Ga0501033_0137386 Ga0501033_0137386_361_870 167
129 3300049571 Ga0501034_0106719 Ga0501034_0106719_98_607 167
130 3300049571 Ga0501034_0115821 Ga0501034_0115821_2042_2551 167
131 3300049571 Ga0501034_0861575 Ga0501034_0861575_189_698 167
132 3300049572 Ga0501036_0018205 Ga0501036_0018205_4243_4752 167
133 3300049573 Ga0501037_0104826 Ga0501037_0104826_913_1422 167
134 3300049574 Ga0501038_0433622 Ga0501038_0433622_104_613 167
135 3300049575 Ga0501039_0006784 Ga0501039_0006784_714_1223 167
136 3300049575 Ga0501039_0146214 Ga0501039_0146214_346_855 167
137 3300049578 Ga0501042_0175687 Ga0501042_0175687_788_1297 167
138 3300049579 Ga0501043_0001515 Ga0501043_0001515_18321_18830 167
139 3300049581 Ga0501047_0000655 Ga0501047_0000655_4021_4530 167
140 3300049581 Ga0501047_0020226 Ga0501047_0020226_98_607 167
141 3300049581 Ga0501047_0997622 Ga0501047_0997622_98_607 167
142 3300049582 Ga0501048_0395491 Ga0501048_0395491_258_767 167
143 3300049583 Ga0501067_0104188 Ga0501067_0104188_563_1072 167
144 3300049584 Ga0501068_0023032 Ga0501068_0023032_3036_3545 167
145 3300049584 Ga0501068_0374429 Ga0501068_0374429_98_607 167
146 3300049586 Ga0501070_0289836 Ga0501070_0289836_804_1313 167
147 3300049588 Ga0501072_0121998 Ga0501072_0121998_1428_1937 167
148 3300049588 Ga0501072_0235429 Ga0501072_0235429_208_717 167
149 3300049589 Ga0501073_0069110 Ga0501073_0069110_601_1110 167
150 3300049589 Ga0501073_0745195 Ga0501073_0745195_48_557 167
151 3300049593 Ga0501077_0241339 Ga0501077_0241339_20_529 167
152 3300049742 Ga0501080_0004681 Ga0501080_0004681_342_851 167
153 3300049742 Ga0501080_0059920 Ga0501080_0059920_1167_1676 167
154 3300049742 Ga0501080_0711364 Ga0501080_0711364_190_699 167
155 3300049744 Ga0501083_0011535 Ga0501083_0011535_4311_4820 167
156 3300049744 Ga0501083_0035680 Ga0501083_0035680_1025_1534 167
157 3300049744 Ga0501083_0044372 Ga0501083_0044372_1852_2361 167
158 3300049744 Ga0501083_0621858 Ga0501083_0621858_163_672 167
159 3300049822 Ga0501035_0087739 Ga0501035_0087739_2205_2714 167
160 3300049823 Ga0501044_0399364 Ga0501044_0399364_73_582 167
161 3300049824 Ga0501045_0252051 Ga0501045_0252051_782_1288 167
162 3300054114 Ga0501084_0006193 Ga0501084_0006193_4578_5087 167
163 3300054114 Ga0501084_0895238 Ga0501084_0895238_102_611 167
164 3300059424 Ga0590075_066463 Ga0590075_066463_89_598 167
165 3300060353 Ga0501082_0269235 Ga0501082_0269235_168_677 167
166 3300060353 Ga0501082_0763864 Ga0501082_0763864_127_633 167
167 3300060353 Ga0501082_1077570 Ga0501082_1077570_99_608 167
168 3300005336 Ga0070680_100336784 Ga0070680_1003367843 168
169 3300005338 Ga0068868_100049345 Ga0068868_1000493452 168
170 3300005343 Ga0070687_100060313 Ga0070687_1000603132 168
171 3300005441 Ga0070700_100020842 Ga0070700_1000208423 168
172 3300005545 Ga0070695_100828934 Ga0070695_1008289342 168
173 3300005547 Ga0070693_100026270 Ga0070693_1000262703 168
174 3300005615 Ga0070702_100005168 Ga0070702_1000051683 168
175 3300005834 Ga0068851_10270367 Ga0068851_102703671 168
176 3300005985 Ga0081539_10179139 Ga0081539_101791392 168
177 3300006871 Ga0075434_100504270 Ga0075434_1005042703 168
178 3300009094 Ga0111539_10568136 Ga0111539_105681362 168
179 3300009094 Ga0111539_11339402 Ga0111539_113394022 168
180 3300009174 Ga0105241_10036009 Ga0105241_100360093 168
181 3300009551 Ga0105238_10298326 Ga0105238_102983263 168
182 3300027876 Ga0209974_10176669 Ga0209974_101766692 168
183 3300028380 Ga0268265_11780363 Ga0268265_117803631 168
184 3300031824 Ga0307413_10690389 Ga0307413_106903891 168
185 3300032005 Ga0307411_10022399 Ga0307411_100223993 168
186 3300046454 Ga0495592_0135150 Ga0495592_0135150_275_787 168
187 3300049576 Ga0501040_0960159 Ga0501040_0960159_65_574 168
188 3300049578 Ga0501042_0198924 Ga0501042_0198924_50_559 168
189 3300049582 Ga0501048_0322227 Ga0501048_0322227_272_781 168
190 3300049587 Ga0501071_0198355 Ga0501071_0198355_566_1096 168
191 3300049587 Ga0501071_0386114 Ga0501071_0386114_15_545 168
192 3300049588 Ga0501072_0096244 Ga0501072_0096244_701_1210 168
193 3300049589 Ga0501073_0179319 Ga0501073_0179319_232_762 168
194 3300049590 Ga0501074_0226228 Ga0501074_0226228_322_852 168
195 3300049591 Ga0501075_0655270 Ga0501075_0655270_33_542 168
196 3300049592 Ga0501076_0325057 Ga0501076_0325057_24_533 168
197 3300049593 Ga0501077_0163910 Ga0501077_0163910_563_1093 168
198 3300049741 Ga0501079_0862700 Ga0501079_0862700_71_580 168
199 3300049743 Ga0501081_0160062 Ga0501081_0160062_190_717 168
200 3300050511 nmdc:mga08y16_666541_c1 nmdc:mga08y16_666541_c1_409_918 168
201 3300053078 Ga0495612_0342904 Ga0495612_0342904_39_551 168
202 3300005290 Ga0065712_10310482 Ga0065712_103104822 169
203 3300005333 Ga0070677_10128962 Ga0070677_101289622 169
204 3300005353 Ga0070669_101048725 Ga0070669_1010487252 169
205 3300005456 Ga0070678_100685909 Ga0070678_1006859091 169
206 3300005617 Ga0068859_100784460 Ga0068859_1007844602 169
207 3300005719 Ga0068861_100170030 Ga0068861_1001700302 169
208 3300006051 Ga0075364_10001357 Ga0075364_100013578 169
209 3300006177 Ga0075362_10000746 Ga0075362_100007465 169
210 3300006178 Ga0075367_10030679 Ga0075367_100306793 169
211 3300006178 Ga0075367_10076777 Ga0075367_100767771 169
212 3300006195 Ga0075366_10159559 Ga0075366_101595592 169
213 3300006237 Ga0097621_100435440 Ga0097621_1004354402 169
214 3300006353 Ga0075370_10215271 Ga0075370_102152712 169
215 3300006844 Ga0075428_100069014 Ga0075428_1000690142 169
216 3300006846 Ga0075430_100017811 Ga0075430_1000178114 169
217 3300006847 Ga0075431_100047382 Ga0075431_1000473824 169
218 3300006931 Ga0097620_100784377 Ga0097620_1007843772 169
219 3300009094 Ga0111539_10724381 Ga0111539_107243812 169
220 3300009094 Ga0111539_11574096 Ga0111539_115740961 169
221 3300009147 Ga0114129_10015583 Ga0114129_100155836 169
222 3300009176 Ga0105242_10862317 Ga0105242_108623172 169
223 3300009176 Ga0105242_12162645 Ga0105242_121626451 169
224 3300009177 Ga0105248_10222454 Ga0105248_102224543 169
225 3300009177 Ga0105248_10777388 Ga0105248_107773883 169
226 3300009553 Ga0105249_10339804 Ga0105249_103398042 169
227 3300011119 Ga0105246_10531502 Ga0105246_105315021 169
228 3300013306 Ga0163162_10256904 Ga0163162_102569043 169
229 3300025893 Ga0207682_10082501 Ga0207682_100825013 169
230 3300025926 Ga0207659_10622685 Ga0207659_106226852 169
231 3300025981 Ga0207640_11707054 Ga0207640_117070541 169
232 3300026116 Ga0207674_10975228 Ga0207674_109752282 169
233 3300031548 Ga0307408_100396225 Ga0307408_1003962252 169
234 3300031911 Ga0307412_10004341 Ga0307412_100043412 169
235 3300032002 Ga0307416_100032671 Ga0307416_1000326712 169
236 3300032002 Ga0307416_100111565 Ga0307416_1001115653 169
237 3300032002 Ga0307416_100939416 Ga0307416_1009394162 169
238 3300032005 Ga0307411_10336041 Ga0307411_103360412 169
239 3300032126 Ga0307415_100233055 Ga0307415_1002330552 169
240 3300035692 Ga0373935_0251565 Ga0373935_0251565_442_957 169
241 3300035724 Ga0373933_0517343 Ga0373933_0517343_169_684 169
242 3300041459 Ga0451800_1266025 Ga0451800_1266025_247_768 169
243 3300041997 Ga0439431_0045483 Ga0439431_0045483_551_1069 169
244 3300041999 Ga0439433_0040321 Ga0439433_0040321_528_1046 169
245 3300041999 Ga0439433_0114530 Ga0439433_0114530_106_633 169
246 3300042015 Ga0439462_0058283 Ga0439462_0058283_322_834 169
247 3300042156 Ga0439446_0017402 Ga0439446_0017402_21_539 169
248 3300042436 Ga0439435_0044165 Ga0439435_0044165_135_650 169
249 3300042461 Ga0439460_0033799 Ga0439460_0033799_632_1153 169
250 3300042461 Ga0439460_0080817 Ga0439460_0080817_487_999 169
251 3300046473 Ga0495582_0281907 Ga0495582_0281907_135_650 169
252 3300046663 Ga0495635_0049123 Ga0495635_0049123_2173_2688 169
253 3300046683 Ga0495658_0061320 Ga0495658_0061320_127_642 169
254 3300047319 Ga0495674_0107881 Ga0495674_0107881_1273_1788 169
255 3300047319 Ga0495674_1065018 Ga0495674_1065018_57_572 169
256 3300049568 Ga0501031_0100742 Ga0501031_0100742_432_944 169
257 3300049570 Ga0501033_0532023 Ga0501033_0532023_196_711 169
258 3300049571 Ga0501034_0020238 Ga0501034_0020238_1264_1779 169
259 3300049576 Ga0501040_0698474 Ga0501040_0698474_187_696 169
260 3300049589 Ga0501073_0909887 Ga0501073_0909887_68_589 169
261 3300049822 Ga0501035_0799212 Ga0501035_0799212_107_619 169
262 3300050489 nmdc:mga03683_18662_c1 nmdc:mga03683_18662_c1_1301_1816 169
263 3300050491 nmdc:mga00v17_209911_c1 nmdc:mga00v17_209911_c1_547_1062 169
264 3300050491 nmdc:mga00v17_3790_c1 nmdc:mga00v17_3790_c1_3113_3628 169
265 3300050492 nmdc:mga0yw44_314216_c1 nmdc:mga0yw44_314216_c1_40_555 169
266 3300050493 nmdc:mga0k408_8033_c1 nmdc:mga0k408_8033_c1_3059_3574 169
267 3300050493 nmdc:mga0k408_8489_c1 nmdc:mga0k408_8489_c1_4693_5208 169
268 3300050494 nmdc:mga06z11_60949_c1 nmdc:mga06z11_60949_c1_306_821 169
269 3300050507 nmdc:mga05p37_59395_c1 nmdc:mga05p37_59395_c1_415_930 169
270 3300050509 nmdc:mga0qj67_24872_c1 nmdc:mga0qj67_24872_c1_2848_3363 169
271 3300050510 nmdc:mga06r32_1282030_c1 nmdc:mga06r32_1282030_c1_122_652 169
272 3300050510 nmdc:mga06r32_38067_c1 nmdc:mga06r32_38067_c1_3248_3763 169
273 3300050515 nmdc:mga0a205_42207_c1 nmdc:mga0a205_42207_c1_1411_1926 169
274 3300053104 Ga0500556_0007078 Ga0500556_0007078_1786_2319 169
275 3300059421 Ga0590071_040230 Ga0590071_040230_227_745 169
276 3300059421 Ga0590071_052993 Ga0590071_052993_40_564 169
277 3300059424 Ga0590075_050668 Ga0590075_050668_174_701 169
278 3300005290 Ga0065712_10009881 Ga0065712_100098813 170
279 3300005293 Ga0065715_10009346 Ga0065715_100093461 170
280 3300005334 Ga0068869_100239485 Ga0068869_1002394852 170
281 3300005353 Ga0070669_100040998 Ga0070669_1000409983 170
282 3300005354 Ga0070675_100235798 Ga0070675_1002357983 170
283 3300005356 Ga0070674_100356010 Ga0070674_1003560102 170
284 3300005365 Ga0070688_100868461 Ga0070688_1008684611 170
285 3300005365 Ga0070688_101017771 Ga0070688_1010177711 170
286 3300005367 Ga0070667_100939165 Ga0070667_1009391651 170
287 3300005444 Ga0070694_100608024 Ga0070694_1006080242 170
288 3300005455 Ga0070663_100590807 Ga0070663_1005908071 170
289 3300005456 Ga0070678_100363343 Ga0070678_1003633432 170
290 3300005548 Ga0070665_101281379 Ga0070665_1012813792 170
291 3300005719 Ga0068861_100599356 Ga0068861_1005993562 170
292 3300005719 Ga0068861_101830081 Ga0068861_1018300811 170
293 3300005841 Ga0068863_100865763 Ga0068863_1008657631 170
294 3300005844 Ga0068862_100200782 Ga0068862_1002007822 170
295 3300006237 Ga0097621_100146702 Ga0097621_1001467023 170
296 3300006844 Ga0075428_100000295 Ga0075428_10000029539 170
297 3300006846 Ga0075430_100003248 Ga0075430_10000324813 170
298 3300006846 Ga0075430_100033466 Ga0075430_1000334665 170
299 3300006846 Ga0075430_100315830 Ga0075430_1003158302 170
300 3300006846 Ga0075430_100822014 Ga0075430_1008220142 170
301 3300006847 Ga0075431_100004098 Ga0075431_1000040986 170
302 3300006847 Ga0075431_100139379 Ga0075431_1001393793 170
303 3300006847 Ga0075431_100238020 Ga0075431_1002380203 170
304 3300006847 Ga0075431_100781717 Ga0075431_1007817172 170
305 3300006852 Ga0075433_10260473 Ga0075433_102604733 170
306 3300006871 Ga0075434_101262632 Ga0075434_1012626322 170
307 3300006880 Ga0075429_100043580 Ga0075429_1000435803 170
308 3300006880 Ga0075429_100517201 Ga0075429_1005172012 170
309 3300006880 Ga0075429_100810836 Ga0075429_1008108362 170
310 3300006881 Ga0068865_100695936 Ga0068865_1006959362 170
311 3300009094 Ga0111539_10000037 Ga0111539_100000379 170
312 3300009094 Ga0111539_10132671 Ga0111539_101326712 170
313 3300009094 Ga0111539_10366981 Ga0111539_103669812 170
314 3300009101 Ga0105247_11185299 Ga0105247_111852991 170
315 3300009147 Ga0114129_10004316 Ga0114129_1000431613 170
316 3300009147 Ga0114129_10008636 Ga0114129_100086367 170
317 3300009147 Ga0114129_10009195 Ga0114129_1000919511 170
318 3300009147 Ga0114129_11368661 Ga0114129_113686612 170
319 3300009553 Ga0105249_10656757 Ga0105249_106567572 170
320 3300013297 Ga0157378_10479074 Ga0157378_104790743 170
321 3300013308 Ga0157375_10439164 Ga0157375_104391642 170
322 3300013308 Ga0157375_12076562 Ga0157375_120765621 170
323 3300014325 Ga0163163_10003825 Ga0163163_100038259 170
324 3300014326 Ga0157380_10396133 Ga0157380_103961332 170
325 3300014326 Ga0157380_10545858 Ga0157380_105458582 170
326 3300014326 Ga0157380_10984312 Ga0157380_109843122 170
327 3300014969 Ga0157376_10357727 Ga0157376_103577272 170
328 3300014969 Ga0157376_10382089 Ga0157376_103820891 170
329 3300025903 Ga0207680_10192550 Ga0207680_101925502 170
330 3300025926 Ga0207659_10200018 Ga0207659_102000183 170
331 3300025926 Ga0207659_10261151 Ga0207659_102611512 170
332 3300025933 Ga0207706_10345068 Ga0207706_103450682 170
333 3300025937 Ga0207669_10076108 Ga0207669_100761082 170
334 3300025937 Ga0207669_10079190 Ga0207669_100791903 170
335 3300025937 Ga0207669_10112204 Ga0207669_101122043 170
336 3300025940 Ga0207691_10523878 Ga0207691_105238782 170
337 3300025961 Ga0207712_10669844 Ga0207712_106698442 170
338 3300025986 Ga0207658_10978303 Ga0207658_109783032 170
339 3300026088 Ga0207641_10291226 Ga0207641_102912262 170
340 3300026088 Ga0207641_10812847 Ga0207641_108128472 170
341 3300026118 Ga0207675_100339487 Ga0207675_1003394872 170
342 3300026121 Ga0207683_10118218 Ga0207683_101182183 170
343 3300026121 Ga0207683_10413841 Ga0207683_104138412 170
344 3300026121 Ga0207683_10731172 Ga0207683_107311722 170
345 3300027907 Ga0207428_10001068 Ga0207428_100010686 170
346 3300027907 Ga0207428_10535986 Ga0207428_105359862 170
347 3300028380 Ga0268265_10159237 Ga0268265_101592373 170
348 3300028380 Ga0268265_10378813 Ga0268265_103788133 170
349 3300028381 Ga0268264_10129238 Ga0268264_101292383 170
350 3300031548 Ga0307408_101617492 Ga0307408_1016174921 170
351 3300031731 Ga0307405_10030293 Ga0307405_100302933 170
352 3300031731 Ga0307405_10973968 Ga0307405_109739682 170
353 3300031824 Ga0307413_10081301 Ga0307413_100813011 170
354 3300031824 Ga0307413_10794136 Ga0307413_107941362 170
355 3300031852 Ga0307410_10031322 Ga0307410_100313223 170
356 3300031852 Ga0307410_10357881 Ga0307410_103578812 170
357 3300031901 Ga0307406_10078753 Ga0307406_100787532 170
358 3300031903 Ga0307407_10013207 Ga0307407_100132073 170
359 3300031903 Ga0307407_10473829 Ga0307407_104738292 170
360 3300031903 Ga0307407_10559304 Ga0307407_105593041 170
361 3300031911 Ga0307412_10057260 Ga0307412_100572602 170
362 3300031995 Ga0307409_100198041 Ga0307409_1001980413 170
363 3300031995 Ga0307409_100440710 Ga0307409_1004407102 170
364 3300032002 Ga0307416_100019683 Ga0307416_1000196833 170
365 3300032002 Ga0307416_100108892 Ga0307416_1001088922 170
366 3300032002 Ga0307416_100131191 Ga0307416_1001311913 170
367 3300032002 Ga0307416_100294305 Ga0307416_1002943052 170
368 3300032002 Ga0307416_101195397 Ga0307416_1011953972 170
369 3300032005 Ga0307411_10074438 Ga0307411_100744383 170
370 3300032005 Ga0307411_10249991 Ga0307411_102499913 170
371 3300032005 Ga0307411_10584277 Ga0307411_105842772 170
372 3300032005 Ga0307411_10670192 Ga0307411_106701922 170
373 3300032126 Ga0307415_100067318 Ga0307415_1000673183 170
374 3300032126 Ga0307415_100416548 Ga0307415_1004165482 170
375 3300041498 Ga0451841_0375391 Ga0451841_0375391_33_554 170
376 3300042000 Ga0439437_017052 Ga0439437_017052_288_803 170
377 3300042008 Ga0439450_010750 Ga0439450_010750_1211_1726 170
378 3300042436 Ga0439435_0012867 Ga0439435_0012867_443_958 170
379 3300042437 Ga0439444_0074934 Ga0439444_0074934_123_638 170
380 3300042439 Ga0439464_0039402 Ga0439464_0039402_670_1185 170
381 3300042993 Ga0439440_0046765 Ga0439440_0046765_418_933 170
382 3300045051 Ga0451576_0043533 Ga0451576_0043533_2319_2840 170
383 3300045051 Ga0451576_0094215 Ga0451576_0094215_636_1148 170
384 3300046615 Ga0495656_0039211 Ga0495656_0039211_961_1473 170
385 3300046664 Ga0495659_0307617 Ga0495659_0307617_138_650 170
386 3300046681 Ga0495647_0152101 Ga0495647_0152101_304_816 170
387 3300047318 Ga0495636_0120564 Ga0495636_0120564_300_833 170
388 3300048905 Ga0496102_0028152 Ga0496102_0028152_517_1029 170
389 3300048906 Ga0496103_0529891 Ga0496103_0529891_103_624 170
390 3300048907 Ga0496104_0282814 Ga0496104_0282814_953_1474 170
391 3300048909 Ga0496106_0631757 Ga0496106_0631757_299_811 170
392 3300048912 Ga0496109_1558771 Ga0496109_1558771_53_574 170
393 3300048917 Ga0496114_0100789 Ga0496114_0100789_351_872 170
394 3300049515 Ga0501292_001564 Ga0501292_001564_1335_1850 170
395 3300049522 Ga0501299_022960 Ga0501299_022960_571_1125 170
396 3300049522 Ga0501299_097809 Ga0501299_097809_89_604 170
397 3300049523 Ga0501300_032088 Ga0501300_032088_201_755 170
398 3300049568 Ga0501031_0028667 Ga0501031_0028667_2543_3055 170
399 3300049572 Ga0501036_0323016 Ga0501036_0323016_321_833 170
400 3300049572 Ga0501036_1097418 Ga0501036_1097418_73_585 170
401 3300049573 Ga0501037_0291201 Ga0501037_0291201_242_754 170
402 3300049574 Ga0501038_0361112 Ga0501038_0361112_77_589 170
403 3300049575 Ga0501039_0293359 Ga0501039_0293359_194_706 170
404 3300049576 Ga0501040_0067255 Ga0501040_0067255_1285_1797 170
405 3300049576 Ga0501040_0238818 Ga0501040_0238818_70_585 170
406 3300049577 Ga0501041_0012600 Ga0501041_0012600_2818_3330 170
407 3300049577 Ga0501041_0449975 Ga0501041_0449975_176_688 170
408 3300049580 Ga0501046_0056943 Ga0501046_0056943_1824_2336 170
409 3300049584 Ga0501068_0144844 Ga0501068_0144844_419_931 170
410 3300049587 Ga0501071_0040967 Ga0501071_0040967_2224_2736 170
411 3300049588 Ga0501072_0188081 Ga0501072_0188081_706_1218 170
412 3300049588 Ga0501072_0205294 Ga0501072_0205294_293_805 170
413 3300049588 Ga0501072_0620448 Ga0501072_0620448_54_569 170
414 3300049590 Ga0501074_0057226 Ga0501074_0057226_19_534 170
415 3300049590 Ga0501074_0836872 Ga0501074_0836872_40_552 170
416 3300049591 Ga0501075_0016140 Ga0501075_0016140_954_1466 170
417 3300049591 Ga0501075_0025261 Ga0501075_0025261_3058_3573 170
418 3300049591 Ga0501075_0304239 Ga0501075_0304239_612_1127 170
419 3300049592 Ga0501076_0002349 Ga0501076_0002349_3959_4471 170
420 3300049592 Ga0501076_0017306 Ga0501076_0017306_1977_2489 170
421 3300049592 Ga0501076_0052814 Ga0501076_0052814_2366_2881 170
422 3300049593 Ga0501077_0033000 Ga0501077_0033000_300_815 170
423 3300049593 Ga0501077_0657962 Ga0501077_0657962_53_568 170
424 3300049655 Ga0501208_130984 Ga0501208_130984_23_538 170
425 3300049658 Ga0501211_004634 Ga0501211_004634_678_1232 170
426 3300049661 Ga0501217_080814 Ga0501217_080814_323_838 170
427 3300049668 Ga0501233_080764 Ga0501233_080764_86_640 170
428 3300049676 Ga0501246_006699 Ga0501246_006699_316_831 170
429 3300049690 Ga0501261_008614 Ga0501261_008614_486_1001 170
430 3300049741 Ga0501079_0121992 Ga0501079_0121992_476_988 170
431 3300049742 Ga0501080_0046088 Ga0501080_0046088_569_1084 170
432 3300049743 Ga0501081_0047734 Ga0501081_0047734_601_1113 170
433 3300049767 Ga0501270_017764 Ga0501270_017764_348_872 170
434 3300049779 Ga0501283_037067 Ga0501283_037067_175_690 170
435 3300049822 Ga0501035_0621703 Ga0501035_0621703_328_840 170
436 3300049823 Ga0501044_0790490 Ga0501044_0790490_141_653 170
437 3300049824 Ga0501045_0003977 Ga0501045_0003977_2798_3310 170
438 3300049824 Ga0501045_0203817 Ga0501045_0203817_674_1189 170
439 3300050507 nmdc:mga05p37_1981_c1 nmdc:mga05p37_1981_c1_6193_6708 170
440 3300050507 nmdc:mga05p37_2447_c1 nmdc:mga05p37_2447_c1_11032_11547 170
441 3300050507 nmdc:mga05p37_8178_c1 nmdc:mga05p37_8178_c1_1817_2332 170
442 3300050508 nmdc:mga09592_316841_c1 nmdc:mga09592_316841_c1_738_1250 170
443 3300050508 nmdc:mga09592_55588_c1 nmdc:mga09592_55588_c1_2648_3163 170
444 3300050509 nmdc:mga0qj67_5153_c1 nmdc:mga0qj67_5153_c1_5584_6099 170
445 3300050509 nmdc:mga0qj67_726744_c1 nmdc:mga0qj67_726744_c1_246_761 170
446 3300050509 nmdc:mga0qj67_76380_c1 nmdc:mga0qj67_76380_c1_1188_1703 170
447 3300050510 nmdc:mga06r32_156746_c1 nmdc:mga06r32_156746_c1_997_1509 170
448 3300050510 nmdc:mga06r32_1592340_c1 nmdc:mga06r32_1592340_c1_53_565 170
449 3300050510 nmdc:mga06r32_9552_c1 nmdc:mga06r32_9552_c1_6088_6603 170
450 3300050511 nmdc:mga08y16_1150799_c1 nmdc:mga08y16_1150799_c1_175_690 170
451 3300050511 nmdc:mga08y16_3529_c1 nmdc:mga08y16_3529_c1_4297_4812 170
452 3300050511 nmdc:mga08y16_408326_c1 nmdc:mga08y16_408326_c1_585_1100 170
453 3300050511 nmdc:mga08y16_52143_c1 nmdc:mga08y16_52143_c1_539_1057 170
454 3300050512 nmdc:mga0n895_376660_c1 nmdc:mga0n895_376660_c1_424_945 170
455 3300050515 nmdc:mga0a205_18629_c1 nmdc:mga0a205_18629_c1_5734_6249 170
456 3300054114 Ga0501084_0012966 Ga0501084_0012966_2610_3122 170
457 3300054114 Ga0501084_0228904 Ga0501084_0228904_1017_1532 170
458 3300054114 Ga0501084_0710714 Ga0501084_0710714_256_768 170
459 3300059421 Ga0590071_057838 Ga0590071_057838_392_913 170
460 3300059426 Ga0590077_000256 Ga0590077_000256_14345_14863 170
461 3300060353 Ga0501082_0074604 Ga0501082_0074604_1728_2243 170
462 3300060353 Ga0501082_0084295 Ga0501082_0084295_75_587 170
463 3300061734 Ga0530510_0004651 Ga0530510_0004651_8409_8921 170
464 3300061734 Ga0530510_0487647 Ga0530510_0487647_241_756 170
465 3300002073 JGI24745J21846_1016045 JGI24745J21846_10160451 171
466 3300002126 JGI24035J26624_1009355 JGI24035J26624_10093551 171
467 3300003203 JGI25406J46586_10120242 JGI25406J46586_101202422 171
468 3300005288 Ga0065714_10072204 Ga0065714_100722043 171
469 3300005289 Ga0065704_10005852 Ga0065704_100058522 171
470 3300005290 Ga0065712_10018740 Ga0065712_100187403 171
471 3300005290 Ga0065712_10087888 Ga0065712_100878881 171
472 3300005290 Ga0065712_10406397 Ga0065712_104063972 171
473 3300005293 Ga0065715_10009247 Ga0065715_100092473 171
474 3300005293 Ga0065715_10105744 Ga0065715_101057443 171
475 3300005293 Ga0065715_10462750 Ga0065715_104627502 171
476 3300005295 Ga0065707_10103611 Ga0065707_101036113 171
477 3300005329 Ga0070683_100000094 Ga0070683_1000000949 171
478 3300005329 Ga0070683_100103115 Ga0070683_1001031153 171
479 3300005331 Ga0070670_100029410 Ga0070670_1000294103 171
480 3300005331 Ga0070670_100047811 Ga0070670_1000478113 171
481 3300005331 Ga0070670_100674048 Ga0070670_1006740482 171
482 3300005333 Ga0070677_10320386 Ga0070677_103203861 171
483 3300005335 Ga0070666_10528333 Ga0070666_105283331 171
484 3300005336 Ga0070680_100259809 Ga0070680_1002598092 171
485 3300005337 Ga0070682_100213800 Ga0070682_1002138001 171
486 3300005339 Ga0070660_100265946 Ga0070660_1002659461 171
487 3300005344 Ga0070661_100016313 Ga0070661_1000163133 171
488 3300005344 Ga0070661_100169844 Ga0070661_1001698443 171
489 3300005347 Ga0070668_100367769 Ga0070668_1003677692 171
490 3300005353 Ga0070669_100005170 Ga0070669_1000051706 171
491 3300005353 Ga0070669_100351989 Ga0070669_1003519892 171
492 3300005354 Ga0070675_100041683 Ga0070675_1000416834 171
493 3300005354 Ga0070675_100386547 Ga0070675_1003865471 171
494 3300005354 Ga0070675_100397586 Ga0070675_1003975862 171
495 3300005354 Ga0070675_100398057 Ga0070675_1003980573 171
496 3300005355 Ga0070671_100050359 Ga0070671_1000503593 171
497 3300005355 Ga0070671_100437696 Ga0070671_1004376962 171
498 3300005364 Ga0070673_100581237 Ga0070673_1005812372 171
499 3300005365 Ga0070688_100050003 Ga0070688_1000500033 171
500 3300005367 Ga0070667_100943757 Ga0070667_1009437571 171
501 3300005444 Ga0070694_100738971 Ga0070694_1007389712 171
502 3300005456 Ga0070678_100132984 Ga0070678_1001329842 171
503 3300005471 Ga0070698_100034849 Ga0070698_1000348492 171
504 3300005518 Ga0070699_100001266 Ga0070699_10000126610 171
505 3300005535 Ga0070684_100000166 Ga0070684_10000016634 171
506 3300005535 Ga0070684_100506079 Ga0070684_1005060792 171
507 3300005543 Ga0070672_100197870 Ga0070672_1001978702 171
508 3300005543 Ga0070672_100304866 Ga0070672_1003048662 171
509 3300005543 Ga0070672_100382132 Ga0070672_1003821322 171
510 3300005543 Ga0070672_100557131 Ga0070672_1005571312 171
511 3300005544 Ga0070686_100386376 Ga0070686_1003863763 171
512 3300005545 Ga0070695_100072900 Ga0070695_1000729003 171
513 3300005546 Ga0070696_100215415 Ga0070696_1002154152 171
514 3300005546 Ga0070696_100540765 Ga0070696_1005407652 171
515 3300005549 Ga0070704_100030216 Ga0070704_1000302162 171
516 3300005564 Ga0070664_100009365 Ga0070664_1000093656 171
517 3300005564 Ga0070664_100128339 Ga0070664_1001283392 171
518 3300005564 Ga0070664_100716256 Ga0070664_1007162562 171
519 3300005618 Ga0068864_101170761 Ga0068864_1011707612 171
520 3300005844 Ga0068862_100035412 Ga0068862_1000354124 171
521 3300005844 Ga0068862_100557333 Ga0068862_1005573332 171
522 3300005985 Ga0081539_10040561 Ga0081539_100405613 171
523 3300006178 Ga0075367_10100255 Ga0075367_101002552 171
524 3300006353 Ga0075370_10100482 Ga0075370_101004823 171
525 3300006844 Ga0075428_100073237 Ga0075428_1000732374 171
526 3300006846 Ga0075430_100020871 Ga0075430_1000208714 171
527 3300006852 Ga0075433_10090367 Ga0075433_100903672 171
528 3300006852 Ga0075433_10125663 Ga0075433_101256633 171
529 3300006852 Ga0075433_10553867 Ga0075433_105538672 171
530 3300009094 Ga0111539_10008348 Ga0111539_100083489 171
531 3300009147 Ga0114129_10055131 Ga0114129_100551313 171
532 3300009148 Ga0105243_11554325 Ga0105243_115543251 171
533 3300009177 Ga0105248_10221608 Ga0105248_102216084 171
534 3300009553 Ga0105249_10116358 Ga0105249_101163582 171
535 3300013306 Ga0163162_10008950 Ga0163162_100089509 171
536 3300013306 Ga0163162_10841242 Ga0163162_108412422 171
537 3300014325 Ga0163163_10030417 Ga0163163_100304174 171
538 3300014325 Ga0163163_10304756 Ga0163163_103047563 171
539 3300014326 Ga0157380_11152707 Ga0157380_111527072 171
540 3300014745 Ga0157377_10041220 Ga0157377_100412202 171
541 3300014969 Ga0157376_10904952 Ga0157376_109049521 171
542 3300025271 Ga0207666_1040252 Ga0207666_10402521 171
543 3300025315 Ga0207697_10000717 Ga0207697_100007176 171
544 3300025901 Ga0207688_10001322 Ga0207688_1000132213 171
545 3300025903 Ga0207680_10093459 Ga0207680_100934591 171
546 3300025903 Ga0207680_10330409 Ga0207680_103304092 171
547 3300025908 Ga0207643_10106690 Ga0207643_101066902 171
548 3300025909 Ga0207705_10779332 Ga0207705_107793322 171
549 3300025919 Ga0207657_10649472 Ga0207657_106494722 171
550 3300025920 Ga0207649_10021247 Ga0207649_100212473 171
551 3300025920 Ga0207649_10862147 Ga0207649_108621471 171
552 3300025923 Ga0207681_10003863 Ga0207681_100038634 171
553 3300025925 Ga0207650_10016257 Ga0207650_100162573 171
554 3300025925 Ga0207650_10077153 Ga0207650_100771532 171
555 3300025925 Ga0207650_10260187 Ga0207650_102601872 171
556 3300025926 Ga0207659_10028324 Ga0207659_100283242 171
557 3300025926 Ga0207659_10055057 Ga0207659_100550573 171
558 3300025926 Ga0207659_10095935 Ga0207659_100959353 171
559 3300025931 Ga0207644_10052792 Ga0207644_100527923 171
560 3300025931 Ga0207644_10455445 Ga0207644_104554452 171
561 3300025940 Ga0207691_10149718 Ga0207691_101497182 171
562 3300025940 Ga0207691_10211982 Ga0207691_102119822 171
563 3300025940 Ga0207691_10547518 Ga0207691_105475181 171
564 3300025941 Ga0207711_10120457 Ga0207711_101204573 171
565 3300025944 Ga0207661_10020111 Ga0207661_100201111 171
566 3300025944 Ga0207661_10108572 Ga0207661_101085722 171
567 3300025945 Ga0207679_10005801 Ga0207679_100058015 171
568 3300025945 Ga0207679_10641560 Ga0207679_106415602 171
569 3300025960 Ga0207651_10187694 Ga0207651_101876942 171
570 3300025961 Ga0207712_10004344 Ga0207712_100043446 171
571 3300025972 Ga0207668_10270489 Ga0207668_102704892 171
572 3300025981 Ga0207640_10267345 Ga0207640_102673451 171
573 3300025986 Ga0207658_10857419 Ga0207658_108574192 171
574 3300026075 Ga0207708_10067174 Ga0207708_100671743 171
575 3300026075 Ga0207708_10744203 Ga0207708_107442032 171
576 3300026088 Ga0207641_11385543 Ga0207641_113855432 171
577 3300026095 Ga0207676_10159926 Ga0207676_101599262 171
578 3300026118 Ga0207675_101233964 Ga0207675_1012339641 171
579 3300026121 Ga0207683_10055481 Ga0207683_100554813 171
580 3300027717 Ga0209998_10046096 Ga0209998_100460962 171
581 3300027907 Ga0207428_10012687 Ga0207428_100126873 171
582 3300028380 Ga0268265_10018118 Ga0268265_100181182 171
583 3300028380 Ga0268265_10545157 Ga0268265_105451573 171
584 3300031548 Ga0307408_100030568 Ga0307408_1000305684 171
585 3300031548 Ga0307408_101103814 Ga0307408_1011038142 171
586 3300031852 Ga0307410_10187188 Ga0307410_101871882 171
587 3300031901 Ga0307406_10534429 Ga0307406_105344292 171
588 3300031903 Ga0307407_10488159 Ga0307407_104881592 171
589 3300031995 Ga0307409_100016611 Ga0307409_1000166113 171
590 3300032002 Ga0307416_100107948 Ga0307416_1001079483 171
591 3300032004 Ga0307414_10065988 Ga0307414_100659883 171
592 3300032004 Ga0307414_10499577 Ga0307414_104995773 171
593 3300032005 Ga0307411_10573462 Ga0307411_105734622 171
594 3300032126 Ga0307415_100679630 Ga0307415_1006796302 171
595 3300035691 Ga0373931_0909359 Ga0373931_0909359_15_533 171
596 3300042122 Ga0450920_039900 Ga0450920_039900_85_603 171
597 3300042133 Ga0450896_026488 Ga0450896_026488_118_645 171
598 3300042156 Ga0439446_0018579 Ga0439446_0018579_1331_1849 171
599 3300042437 Ga0439444_0067247 Ga0439444_0067247_137_655 171
600 3300042439 Ga0439464_0090786 Ga0439464_0090786_311_844 171
601 3300042461 Ga0439460_0026127 Ga0439460_0026127_417_950 171
602 3300046536 Ga0495587_0475331 Ga0495587_0475331_106_636 171
603 3300046537 Ga0495598_0040628 Ga0495598_0040628_33_569 171
604 3300046664 Ga0495659_0021490 Ga0495659_0021490_645_1181 171
605 3300046809 Ga0495600_0117828 Ga0495600_0117828_201_731 171
606 3300047471 Ga0495684_0273969 Ga0495684_0273969_145_675 171
607 3300048904 Ga0496101_0601485 Ga0496101_0601485_95_613 171
608 3300048907 Ga0496104_0265287 Ga0496104_0265287_643_1158 171
609 3300048908 Ga0496105_0339869 Ga0496105_0339869_586_1104 171
610 3300048911 Ga0496108_0050479 Ga0496108_0050479_1008_1526 171
611 3300048912 Ga0496109_0018373 Ga0496109_0018373_1869_2387 171
612 3300048913 Ga0496110_0011815 Ga0496110_0011815_2665_3183 171
613 3300048914 Ga0496111_0012097 Ga0496111_0012097_239_757 171
614 3300048914 Ga0496111_0088437 Ga0496111_0088437_1204_1719 171
615 3300048915 Ga0496112_0003634 Ga0496112_0003634_5691_6209 171
616 3300048916 Ga0496113_0212734 Ga0496113_0212734_369_887 171
617 3300048917 Ga0496114_0710662 Ga0496114_0710662_235_768 171
618 3300048918 Ga0496115_0520649 Ga0496115_0520649_258_791 171
619 3300049576 Ga0501040_0568752 Ga0501040_0568752_97_630 171
620 3300049583 Ga0501067_0086419 Ga0501067_0086419_597_1130 171
621 3300049584 Ga0501068_0582052 Ga0501068_0582052_95_628 171
622 3300049591 Ga0501075_0137163 Ga0501075_0137163_140_673 171
623 3300049592 Ga0501076_1054189 Ga0501076_1054189_15_548 171
624 3300049705 Ga0501225_0205906 Ga0501225_0205906_84_602 171
625 3300050493 nmdc:mga0k408_369372_c1 nmdc:mga0k408_369372_c1_320_844 171
626 3300050494 nmdc:mga06z11_167416_c1 nmdc:mga06z11_167416_c1_222_746 171
627 3300050495 nmdc:mga04h51_15505_c1 nmdc:mga04h51_15505_c1_575_1099 171
628 3300050507 nmdc:mga05p37_36837_c2 nmdc:mga05p37_36837_c2_3048_3566 171
629 3300050508 nmdc:mga09592_866322_c1 nmdc:mga09592_866322_c1_122_724 171
630 3300050509 nmdc:mga0qj67_19983_c1 nmdc:mga0qj67_19983_c1_2168_2701 171
631 3300050510 nmdc:mga06r32_13185_c1 nmdc:mga06r32_13185_c1_5486_6019 171
632 3300050510 nmdc:mga06r32_324008_c1 nmdc:mga06r32_324008_c1_149_682 171
633 3300050511 nmdc:mga08y16_109057_c1 nmdc:mga08y16_109057_c1_412_930 171
634 3300050511 nmdc:mga08y16_17529_c1 nmdc:mga08y16_17529_c1_6572_7090 171
635 3300050512 nmdc:mga0n895_5943_c1 nmdc:mga0n895_5943_c1_9493_10011 171
636 3300050515 nmdc:mga0a205_18430_c1 nmdc:mga0a205_18430_c1_1055_1573 171
637 3300050515 nmdc:mga0a205_74704_c1 nmdc:mga0a205_74704_c1_2671_3192 171
638 3300050515 nmdc:mga0a205_82233_c1 nmdc:mga0a205_82233_c1_1817_2335 171
639 3300053077 Ga0495601_0469590 Ga0495601_0469590_56_586 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00499

Oxidored_q3

NADH-ubiquinone/plastoquinone oxidoreductase chain 6

44

194

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l8f-assembly1.cif.gz_C crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a, e62a, h65a. 0.9893 2 48
5l8b-assembly2.cif.gz_Q crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9892 2 48
5l8b-assembly1.cif.gz_E crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.988 2 48
5l8b-assembly4.cif.gz_a crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9868 2 48
5l8b-assembly1.cif.gz_J crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a 0.9863 2 48
ID Description Score Start End Superfamily
5l8bX00 Special;Helix non-globular;Helix Hairpins; 0.9877 2 48 6.10.140.1960
5l8bP00 Special;Helix non-globular;Helix Hairpins; 0.9872 2 48 6.10.140.1960
5l8fA00 Special;Helix non-globular;Helix Hairpins; 0.9869 2 48 6.10.140.1960
5l8ba00 Special;Helix non-globular;Helix Hairpins; 0.9868 2 48 6.10.140.1960
5l8gQ00 Special;Helix non-globular;Helix Hairpins; 0.9848 2 48 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A2G2JYV0-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9753 1 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A526ZEA5-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9629 2 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A2G2JYV0-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9598 1 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A355SYS2-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9585 2 60 GO:0005886
GO:0008137
GO:0048038
AF-A0A257VTF4-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9165 1 70 GO:0005886
GO:0008137
GO:0048038

Feature Viewer

pLDDT pTM Quality
84.24 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map