F471646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 639 | 280 | 639 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300050508|nmdc:mga09592_866322_c1|nmdc:mga09592_866322_c1_122_724 |
| Length | 200 |
| Sequence | LLNSECCIGGAADQSAFSNQHSEISASNMDVLAFYAFAGIAVIASLLVIGQGNPMHSVMLLIVSFGALAGLYVVLDAPFTAVTQIIVYAGAIMVLFLFVVMLLNVPREEPAPGGAATLLGSTGMRIGAVLSLLLAGELLWALLRIGFGWASRAETAASVSSVALIGSGIFTRHAFAFEATSVLILVAMIGAVVLARREHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 160 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 161 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 162 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 163 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 164 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 165 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 166 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 167 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 168 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 169 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 170 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 171 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 172 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 173 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 174 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 175 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 176 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 177 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 178 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 201 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 211 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 212 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 213 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 239 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 241 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 243 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 244 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 250 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 251 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 259 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 260 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 261 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 271 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 272 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 273 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 274 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 277 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 278 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.48 |
| Nodule | 0 |
| Rhizoplane | 3.44 |
| Rhizosphere | 90.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1016045 | 3300002073 | Bacteria | 868 |
| 2 | JGI24035J26624_1009355 | 3300002126 | Bacteria | 965 |
| 3 | JGI25406J46586_10000551 | 3300003203 | Bacteria | 17619 |
| 4 | JGI25406J46586_10001262 | 3300003203 | Bacteria | 11872 |
| 5 | JGI25406J46586_10120242 | 3300003203 | Bacteria | 773 |
| 6 | Ga0065714_10072204 | 3300005288 | Bacteria | 3412 |
| 7 | Ga0065704_10005852 | 3300005289 | Bacteria | 3146 |
| 8 | Ga0065712_10009881 | 3300005290 | Bacteria | 2256 |
| 9 | Ga0065712_10018740 | 3300005290 | Bacteria | 2386 |
| 10 | Ga0065712_10084760 | 3300005290 | Bacteria | 2743 |
| 11 | Ga0065712_10087888 | 3300005290 | Bacteria | 2549 |
| 12 | Ga0065712_10310482 | 3300005290 | Bacteria | 840 |
| 13 | Ga0065712_10406397 | 3300005290 | Bacteria | 726 |
| 14 | Ga0065715_10009247 | 3300005293 | Bacteria | 4293 |
| 15 | Ga0065715_10009346 | 3300005293 | Bacteria | 2344 |
| 16 | Ga0065715_10105744 | 3300005293 | Bacteria | 2874 |
| 17 | Ga0065715_10462750 | 3300005293 | Bacteria | 814 |
| 18 | Ga0065707_10103611 | 3300005295 | Bacteria | 2739 |
| 19 | Ga0065707_10167221 | 3300005295 | Bacteria | 1513 |
| 20 | Ga0065707_10318638 | 3300005295 | Bacteria | 970 |
| 21 | Ga0070683_100000094 | 3300005329 | Bacteria | 58242 |
| 22 | Ga0070683_100103115 | 3300005329 | Bacteria | 2688 |
| 23 | Ga0070670_100029410 | 3300005331 | Bacteria | 4730 |
| 24 | Ga0070670_100047811 | 3300005331 | Bacteria | 3682 |
| 25 | Ga0070670_100186698 | 3300005331 | Bacteria | 1800 |
| 26 | Ga0070670_100674048 | 3300005331 | Bacteria | 929 |
| 27 | Ga0070677_10128962 | 3300005333 | Bacteria | 1152 |
| 28 | Ga0070677_10320386 | 3300005333 | Bacteria | 794 |
| 29 | Ga0068869_100239485 | 3300005334 | Bacteria | 1445 |
| 30 | Ga0070666_10528333 | 3300005335 | Bacteria | 857 |
| 31 | Ga0070680_100259809 | 3300005336 | Bacteria | 1469 |
| 32 | Ga0070680_100336784 | 3300005336 | Bacteria | 1282 |
| 33 | Ga0070682_100213800 | 3300005337 | Bacteria | 1368 |
| 34 | Ga0068868_100049345 | 3300005338 | Bacteria | 3303 |
| 35 | Ga0070660_100265946 | 3300005339 | Bacteria | 1401 |
| 36 | Ga0070687_100060313 | 3300005343 | Bacteria | 2001 |
| 37 | Ga0070661_100016313 | 3300005344 | Bacteria | 5251 |
| 38 | Ga0070661_100169844 | 3300005344 | Bacteria | 1656 |
| 39 | Ga0070661_100697914 | 3300005344 | Bacteria | 827 |
| 40 | Ga0070661_100934584 | 3300005344 | Bacteria | 717 |
| 41 | Ga0070668_100367769 | 3300005347 | Bacteria | 1221 |
| 42 | Ga0070668_101386338 | 3300005347 | Bacteria | 641 |
| 43 | Ga0070669_100005170 | 3300005353 | Bacteria | 9439 |
| 44 | Ga0070669_100040998 | 3300005353 | Bacteria | 3366 |
| 45 | Ga0070669_100351989 | 3300005353 | Bacteria | 1196 |
| 46 | Ga0070669_101048725 | 3300005353 | Bacteria | 701 |
| 47 | Ga0070675_100041683 | 3300005354 | Bacteria | 3750 |
| 48 | Ga0070675_100235798 | 3300005354 | Bacteria | 1597 |
| 49 | Ga0070675_100386547 | 3300005354 | Bacteria | 1246 |
| 50 | Ga0070675_100397586 | 3300005354 | Bacteria | 1229 |
| 51 | Ga0070675_100398057 | 3300005354 | Bacteria | 1228 |
| 52 | Ga0070671_100050359 | 3300005355 | Bacteria | 3464 |
| 53 | Ga0070671_100437696 | 3300005355 | Bacteria | 1121 |
| 54 | Ga0070674_100356010 | 3300005356 | Bacteria | 1184 |
| 55 | Ga0070673_100581237 | 3300005364 | Bacteria | 1020 |
| 56 | Ga0070688_100050003 | 3300005365 | Bacteria | 2603 |
| 57 | Ga0070688_100868461 | 3300005365 | Bacteria | 710 |
| 58 | Ga0070688_101017771 | 3300005365 | Bacteria | 659 |
| 59 | Ga0070659_100639026 | 3300005366 | Bacteria | 917 |
| 60 | Ga0070667_100939165 | 3300005367 | Bacteria | 806 |
| 61 | Ga0070667_100943757 | 3300005367 | Bacteria | 804 |
| 62 | Ga0070713_100018924 | 3300005436 | Bacteria | 5244 |
| 63 | Ga0070700_100020842 | 3300005441 | Bacteria | 3804 |
| 64 | Ga0070700_100038200 | 3300005441 | Bacteria | 2925 |
| 65 | Ga0070694_100608024 | 3300005444 | Bacteria | 881 |
| 66 | Ga0070694_100738971 | 3300005444 | Bacteria | 803 |
| 67 | Ga0070663_100098572 | 3300005455 | Bacteria | 2178 |
| 68 | Ga0070663_100590807 | 3300005455 | Bacteria | 933 |
| 69 | Ga0070678_100132984 | 3300005456 | Bacteria | 1979 |
| 70 | Ga0070678_100363343 | 3300005456 | Bacteria | 1248 |
| 71 | Ga0070678_100685909 | 3300005456 | Bacteria | 922 |
| 72 | Ga0070681_10259734 | 3300005458 | Bacteria | 1649 |
| 73 | Ga0070698_100034849 | 3300005471 | Bacteria | 5207 |
| 74 | Ga0070699_100001266 | 3300005518 | Bacteria | 23295 |
| 75 | Ga0070699_100972890 | 3300005518 | Bacteria | 778 |
| 76 | Ga0070684_100000166 | 3300005535 | Bacteria | 45212 |
| 77 | Ga0070684_100506079 | 3300005535 | Bacteria | 1119 |
| 78 | Ga0070672_100197870 | 3300005543 | Bacteria | 1680 |
| 79 | Ga0070672_100304866 | 3300005543 | Bacteria | 1351 |
| 80 | Ga0070672_100382132 | 3300005543 | Bacteria | 1205 |
| 81 | Ga0070672_100557131 | 3300005543 | Bacteria | 996 |
| 82 | Ga0070672_100693113 | 3300005543 | Bacteria | 892 |
| 83 | Ga0070686_100386376 | 3300005544 | Bacteria | 1061 |
| 84 | Ga0070695_100072900 | 3300005545 | Bacteria | 2252 |
| 85 | Ga0070695_100828934 | 3300005545 | Bacteria | 743 |
| 86 | Ga0070696_100215415 | 3300005546 | Bacteria | 1439 |
| 87 | Ga0070696_100540765 | 3300005546 | Bacteria | 932 |
| 88 | Ga0070693_100026270 | 3300005547 | Bacteria | 3142 |
| 89 | Ga0070665_101281379 | 3300005548 | Bacteria | 743 |
| 90 | Ga0070704_100030216 | 3300005549 | Bacteria | 3628 |
| 91 | Ga0070664_100009365 | 3300005564 | Bacteria | 7941 |
| 92 | Ga0070664_100128339 | 3300005564 | Bacteria | 2226 |
| 93 | Ga0070664_100415934 | 3300005564 | Bacteria | 1231 |
| 94 | Ga0070664_100716256 | 3300005564 | Bacteria | 933 |
| 95 | Ga0068856_100265569 | 3300005614 | Bacteria | 1732 |
| 96 | Ga0070702_100005168 | 3300005615 | Bacteria | 6043 |
| 97 | Ga0068859_100784460 | 3300005617 | Bacteria | 1041 |
| 98 | Ga0068864_101170761 | 3300005618 | Bacteria | 767 |
| 99 | Ga0068861_100019101 | 3300005719 | Bacteria | 4894 |
| 100 | Ga0068861_100170030 | 3300005719 | Bacteria | 1806 |
| 101 | Ga0068861_100599356 | 3300005719 | Bacteria | 1011 |
| 102 | Ga0068861_101830081 | 3300005719 | Bacteria | 603 |
| 103 | Ga0068851_10270367 | 3300005834 | Bacteria | 969 |
| 104 | Ga0068863_100865763 | 3300005841 | Bacteria | 903 |
| 105 | Ga0068863_101485358 | 3300005841 | Bacteria | 686 |
| 106 | Ga0068862_100035412 | 3300005844 | Bacteria | 4228 |
| 107 | Ga0068862_100200782 | 3300005844 | Bacteria | 1798 |
| 108 | Ga0068862_100331869 | 3300005844 | Bacteria | 1406 |
| 109 | Ga0068862_100557333 | 3300005844 | Bacteria | 1095 |
| 110 | Ga0081539_10000074 | 3300005985 | Bacteria | 231435 |
| 111 | Ga0081539_10001558 | 3300005985 | Bacteria | 38098 |
| 112 | Ga0081539_10001853 | 3300005985 | Bacteria | 33320 |
| 113 | Ga0081539_10040561 | 3300005985 | Bacteria | 2731 |
| 114 | Ga0081539_10179139 | 3300005985 | Bacteria | 996 |
| 115 | Ga0070717_10415409 | 3300006028 | Bacteria | 1210 |
| 116 | Ga0075368_10052983 | 3300006042 | Bacteria | 1614 |
| 117 | Ga0075363_100323192 | 3300006048 | Bacteria | 898 |
| 118 | Ga0075364_10001357 | 3300006051 | Bacteria | 13208 |
| 119 | Ga0075364_10180189 | 3300006051 | Bacteria | 1429 |
| 120 | Ga0075364_10272761 | 3300006051 | Bacteria | 1151 |
| 121 | Ga0075362_10000746 | 3300006177 | Bacteria | 9684 |
| 122 | Ga0075362_10130114 | 3300006177 | Bacteria | 1196 |
| 123 | Ga0075367_10030679 | 3300006178 | Bacteria | 3084 |
| 124 | Ga0075367_10076777 | 3300006178 | Bacteria | 2016 |
| 125 | Ga0075367_10100255 | 3300006178 | Bacteria | 1769 |
| 126 | Ga0075367_10173273 | 3300006178 | Bacteria | 1344 |
| 127 | Ga0075366_10122669 | 3300006195 | Bacteria | 1566 |
| 128 | Ga0075366_10159559 | 3300006195 | Bacteria | 1366 |
| 129 | Ga0097621_100146702 | 3300006237 | Bacteria | 2021 |
| 130 | Ga0097621_100435440 | 3300006237 | Bacteria | 1179 |
| 131 | Ga0097621_100894088 | 3300006237 | Bacteria | 827 |
| 132 | Ga0075370_10100482 | 3300006353 | Bacteria | 1674 |
| 133 | Ga0075370_10215271 | 3300006353 | Bacteria | 1135 |
| 134 | Ga0075428_100000017 | 3300006844 | Bacteria | 147833 |
| 135 | Ga0075428_100000295 | 3300006844 | Bacteria | 48665 |
| 136 | Ga0075428_100069014 | 3300006844 | Bacteria | 3867 |
| 137 | Ga0075428_100073237 | 3300006844 | Bacteria | 3741 |
| 138 | Ga0075430_100003248 | 3300006846 | Bacteria | 13620 |
| 139 | Ga0075430_100017811 | 3300006846 | Bacteria | 6047 |
| 140 | Ga0075430_100020871 | 3300006846 | Bacteria | 5569 |
| 141 | Ga0075430_100033466 | 3300006846 | Bacteria | 4362 |
| 142 | Ga0075430_100315830 | 3300006846 | Bacteria | 1292 |
| 143 | Ga0075430_100822014 | 3300006846 | Bacteria | 766 |
| 144 | Ga0075430_101013247 | 3300006846 | Bacteria | 684 |
| 145 | Ga0075431_100004098 | 3300006847 | Bacteria | 14230 |
| 146 | Ga0075431_100047382 | 3300006847 | Bacteria | 4431 |
| 147 | Ga0075431_100120157 | 3300006847 | Bacteria | 2711 |
| 148 | Ga0075431_100139379 | 3300006847 | Bacteria | 2500 |
| 149 | Ga0075431_100238020 | 3300006847 | Bacteria | 1853 |
| 150 | Ga0075431_100781717 | 3300006847 | Bacteria | 929 |
| 151 | Ga0075433_10090367 | 3300006852 | Bacteria | 2707 |
| 152 | Ga0075433_10125663 | 3300006852 | Bacteria | 2278 |
| 153 | Ga0075433_10149209 | 3300006852 | Bacteria | 2079 |
| 154 | Ga0075433_10260473 | 3300006852 | Bacteria | 1537 |
| 155 | Ga0075433_10553867 | 3300006852 | Bacteria | 1011 |
| 156 | Ga0075434_100504270 | 3300006871 | Bacteria | 1231 |
| 157 | Ga0075434_101262632 | 3300006871 | Bacteria | 750 |
| 158 | Ga0075434_101469276 | 3300006871 | Bacteria | 691 |
| 159 | Ga0075429_100043580 | 3300006880 | Bacteria | 3905 |
| 160 | Ga0075429_100399298 | 3300006880 | Bacteria | 1204 |
| 161 | Ga0075429_100517201 | 3300006880 | Bacteria | 1046 |
| 162 | Ga0075429_100810836 | 3300006880 | Bacteria | 820 |
| 163 | Ga0068865_100695936 | 3300006881 | Bacteria | 868 |
| 164 | Ga0097620_100784377 | 3300006931 | Bacteria | 1041 |
| 165 | Ga0075435_100902238 | 3300007076 | Bacteria | 771 |
| 166 | Ga0105240_10103506 | 3300009093 | Bacteria | 3459 |
| 167 | Ga0105240_10151938 | 3300009093 | Bacteria | 2757 |
| 168 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 169 | Ga0111539_10000037 | 3300009094 | Bacteria | 143023 |
| 170 | Ga0111539_10008348 | 3300009094 | Bacteria | 13180 |
| 171 | Ga0111539_10024995 | 3300009094 | Bacteria | 7320 |
| 172 | Ga0111539_10132671 | 3300009094 | Bacteria | 2917 |
| 173 | Ga0111539_10366981 | 3300009094 | Bacteria | 1676 |
| 174 | Ga0111539_10568136 | 3300009094 | Bacteria | 1321 |
| 175 | Ga0111539_10724381 | 3300009094 | Bacteria | 1158 |
| 176 | Ga0111539_11339402 | 3300009094 | Bacteria | 831 |
| 177 | Ga0111539_11574096 | 3300009094 | Bacteria | 762 |
| 178 | Ga0105247_11185299 | 3300009101 | Bacteria | 607 |
| 179 | Ga0114129_10004316 | 3300009147 | Bacteria | 20102 |
| 180 | Ga0114129_10008636 | 3300009147 | Bacteria | 14525 |
| 181 | Ga0114129_10009195 | 3300009147 | Bacteria | 14088 |
| 182 | Ga0114129_10015583 | 3300009147 | Bacteria | 10808 |
| 183 | Ga0114129_10055131 | 3300009147 | Bacteria | 5572 |
| 184 | Ga0114129_11368661 | 3300009147 | Bacteria | 874 |
| 185 | Ga0105243_11554325 | 3300009148 | Bacteria | 687 |
| 186 | Ga0105241_10036009 | 3300009174 | Bacteria | 3724 |
| 187 | Ga0105242_10862317 | 3300009176 | Bacteria | 902 |
| 188 | Ga0105242_12162645 | 3300009176 | Bacteria | 601 |
| 189 | Ga0105248_10221608 | 3300009177 | Bacteria | 2129 |
| 190 | Ga0105248_10222454 | 3300009177 | Bacteria | 2125 |
| 191 | Ga0105248_10777388 | 3300009177 | Bacteria | 1081 |
| 192 | Ga0105248_13044020 | 3300009177 | Bacteria | 534 |
| 193 | Ga0105237_10148692 | 3300009545 | Bacteria | 2338 |
| 194 | Ga0105238_10298326 | 3300009551 | Bacteria | 1595 |
| 195 | Ga0105249_10116358 | 3300009553 | Bacteria | 2534 |
| 196 | Ga0105249_10339804 | 3300009553 | Bacteria | 1518 |
| 197 | Ga0105249_10656757 | 3300009553 | Bacteria | 1106 |
| 198 | Ga0105239_10340380 | 3300010375 | Bacteria | 1693 |
| 199 | Ga0105246_10531502 | 3300011119 | Bacteria | 1004 |
| 200 | Ga0157378_10479074 | 3300013297 | Bacteria | 1240 |
| 201 | Ga0163162_10008950 | 3300013306 | Bacteria | 9733 |
| 202 | Ga0163162_10256904 | 3300013306 | Bacteria | 1879 |
| 203 | Ga0163162_10841242 | 3300013306 | Bacteria | 1033 |
| 204 | Ga0157375_10439164 | 3300013308 | Bacteria | 1471 |
| 205 | Ga0157375_10780624 | 3300013308 | Bacteria | 1105 |
| 206 | Ga0157375_12076562 | 3300013308 | Bacteria | 676 |
| 207 | Ga0163163_10003825 | 3300014325 | Bacteria | 12818 |
| 208 | Ga0163163_10030417 | 3300014325 | Bacteria | 5204 |
| 209 | Ga0163163_10304756 | 3300014325 | Bacteria | 1645 |
| 210 | Ga0157380_10108216 | 3300014326 | Bacteria | 2330 |
| 211 | Ga0157380_10396133 | 3300014326 | Bacteria | 1308 |
| 212 | Ga0157380_10545858 | 3300014326 | Bacteria | 1136 |
| 213 | Ga0157380_10984312 | 3300014326 | Bacteria | 876 |
| 214 | Ga0157380_11152707 | 3300014326 | Bacteria | 817 |
| 215 | Ga0157380_11297186 | 3300014326 | Unclassified | 775 |
| 216 | Ga0157380_11587689 | 3300014326 | Bacteria | 709 |
| 217 | Ga0157377_10041220 | 3300014745 | Bacteria | 2561 |
| 218 | Ga0157379_11452105 | 3300014968 | Bacteria | 666 |
| 219 | Ga0157376_10357727 | 3300014969 | Bacteria | 1399 |
| 220 | Ga0157376_10382089 | 3300014969 | Bacteria | 1357 |
| 221 | Ga0157376_10904952 | 3300014969 | Bacteria | 901 |
| 222 | Ga0207666_1040252 | 3300025271 | Bacteria | 730 |
| 223 | Ga0207697_10000717 | 3300025315 | Bacteria | 18881 |
| 224 | Ga0207682_10082501 | 3300025893 | Bacteria | 1380 |
| 225 | Ga0207688_10001322 | 3300025901 | Bacteria | 12879 |
| 226 | Ga0207680_10093459 | 3300025903 | Bacteria | 1918 |
| 227 | Ga0207680_10192550 | 3300025903 | Bacteria | 1385 |
| 228 | Ga0207680_10330409 | 3300025903 | Bacteria | 1068 |
| 229 | Ga0207643_10106690 | 3300025908 | Bacteria | 1646 |
| 230 | Ga0207643_10664206 | 3300025908 | Bacteria | 673 |
| 231 | Ga0207705_10779332 | 3300025909 | Bacteria | 742 |
| 232 | Ga0207707_10125793 | 3300025912 | Bacteria | 2242 |
| 233 | Ga0207671_10082575 | 3300025914 | Bacteria | 2411 |
| 234 | Ga0207657_10649472 | 3300025919 | Bacteria | 821 |
| 235 | Ga0207649_10021247 | 3300025920 | Bacteria | 3733 |
| 236 | Ga0207649_10862147 | 3300025920 | Bacteria | 709 |
| 237 | Ga0207681_10003863 | 3300025923 | Bacteria | 9307 |
| 238 | Ga0207681_11352844 | 3300025923 | Bacteria | 598 |
| 239 | Ga0207650_10016257 | 3300025925 | Bacteria | 5198 |
| 240 | Ga0207650_10077153 | 3300025925 | Bacteria | 2518 |
| 241 | Ga0207650_10260187 | 3300025925 | Bacteria | 1407 |
| 242 | Ga0207659_10028324 | 3300025926 | Bacteria | 3806 |
| 243 | Ga0207659_10055057 | 3300025926 | Bacteria | 2843 |
| 244 | Ga0207659_10095935 | 3300025926 | Bacteria | 2225 |
| 245 | Ga0207659_10200018 | 3300025926 | Bacteria | 1595 |
| 246 | Ga0207659_10261151 | 3300025926 | Bacteria | 1409 |
| 247 | Ga0207659_10622685 | 3300025926 | Bacteria | 921 |
| 248 | Ga0207644_10052792 | 3300025931 | Bacteria | 2923 |
| 249 | Ga0207644_10455445 | 3300025931 | Bacteria | 1051 |
| 250 | Ga0207690_10077857 | 3300025932 | Bacteria | 2306 |
| 251 | Ga0207706_10345068 | 3300025933 | Bacteria | 1295 |
| 252 | Ga0207709_11071088 | 3300025935 | Bacteria | 661 |
| 253 | Ga0207669_10041536 | 3300025937 | Bacteria | 2678 |
| 254 | Ga0207669_10076108 | 3300025937 | Bacteria | 2129 |
| 255 | Ga0207669_10079190 | 3300025937 | Bacteria | 2097 |
| 256 | Ga0207669_10112204 | 3300025937 | Bacteria | 1830 |
| 257 | Ga0207669_10121789 | 3300025937 | Bacteria | 1773 |
| 258 | Ga0207669_10763035 | 3300025937 | Bacteria | 800 |
| 259 | Ga0207691_10149718 | 3300025940 | Bacteria | 2052 |
| 260 | Ga0207691_10211982 | 3300025940 | Bacteria | 1682 |
| 261 | Ga0207691_10523878 | 3300025940 | Bacteria | 1006 |
| 262 | Ga0207691_10547518 | 3300025940 | Bacteria | 981 |
| 263 | Ga0207711_10120457 | 3300025941 | Bacteria | 2342 |
| 264 | Ga0207711_10907801 | 3300025941 | Bacteria | 819 |
| 265 | Ga0207661_10020111 | 3300025944 | Bacteria | 4985 |
| 266 | Ga0207661_10108572 | 3300025944 | Bacteria | 2343 |
| 267 | Ga0207679_10005801 | 3300025945 | Bacteria | 7751 |
| 268 | Ga0207679_10641560 | 3300025945 | Bacteria | 960 |
| 269 | Ga0207651_10187694 | 3300025960 | Bacteria | 1646 |
| 270 | Ga0207651_11392180 | 3300025960 | Bacteria | 631 |
| 271 | Ga0207712_10004344 | 3300025961 | Bacteria | 8955 |
| 272 | Ga0207712_10372625 | 3300025961 | Bacteria | 1193 |
| 273 | Ga0207712_10669844 | 3300025961 | Bacteria | 903 |
| 274 | Ga0207668_10270489 | 3300025972 | Bacteria | 1389 |
| 275 | Ga0207668_11098358 | 3300025972 | Bacteria | 713 |
| 276 | Ga0207640_10267345 | 3300025981 | Bacteria | 1336 |
| 277 | Ga0207640_10837246 | 3300025981 | Bacteria | 799 |
| 278 | Ga0207640_11707054 | 3300025981 | Bacteria | 568 |
| 279 | Ga0207658_10857419 | 3300025986 | Bacteria | 826 |
| 280 | Ga0207658_10978303 | 3300025986 | Bacteria | 772 |
| 281 | Ga0207678_10132479 | 3300026067 | Bacteria | 2127 |
| 282 | Ga0207708_10067174 | 3300026075 | Bacteria | 2742 |
| 283 | Ga0207708_10070516 | 3300026075 | Bacteria | 2676 |
| 284 | Ga0207708_10744203 | 3300026075 | Bacteria | 841 |
| 285 | Ga0207702_10135324 | 3300026078 | Bacteria | 2223 |
| 286 | Ga0207641_10291226 | 3300026088 | Bacteria | 1539 |
| 287 | Ga0207641_10812847 | 3300026088 | Bacteria | 925 |
| 288 | Ga0207641_11385543 | 3300026088 | Bacteria | 704 |
| 289 | Ga0207676_10140197 | 3300026095 | Bacteria | 2069 |
| 290 | Ga0207676_10159926 | 3300026095 | Bacteria | 1950 |
| 291 | Ga0207674_10603316 | 3300026116 | Bacteria | 1060 |
| 292 | Ga0207674_10975228 | 3300026116 | Bacteria | 816 |
| 293 | Ga0207675_100011213 | 3300026118 | Bacteria | 8393 |
| 294 | Ga0207675_100339487 | 3300026118 | Bacteria | 1470 |
| 295 | Ga0207675_101233964 | 3300026118 | Bacteria | 768 |
| 296 | Ga0207683_10055481 | 3300026121 | Bacteria | 3474 |
| 297 | Ga0207683_10118218 | 3300026121 | Bacteria | 2378 |
| 298 | Ga0207683_10413841 | 3300026121 | Bacteria | 1241 |
| 299 | Ga0207683_10731172 | 3300026121 | Bacteria | 918 |
| 300 | Ga0209968_1018725 | 3300027526 | Bacteria | 1111 |
| 301 | Ga0209998_10046096 | 3300027717 | Bacteria | 1000 |
| 302 | Ga0209813_10107085 | 3300027866 | Bacteria | 958 |
| 303 | Ga0209974_10176669 | 3300027876 | Bacteria | 780 |
| 304 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 305 | Ga0207428_10001068 | 3300027907 | Bacteria | 30064 |
| 306 | Ga0207428_10012687 | 3300027907 | Bacteria | 7389 |
| 307 | Ga0207428_10243210 | 3300027907 | Bacteria | 1344 |
| 308 | Ga0207428_10535986 | 3300027907 | Bacteria | 848 |
| 309 | Ga0268265_10018118 | 3300028380 | Bacteria | 4875 |
| 310 | Ga0268265_10159237 | 3300028380 | Bacteria | 1915 |
| 311 | Ga0268265_10355028 | 3300028380 | Bacteria | 1340 |
| 312 | Ga0268265_10378813 | 3300028380 | Bacteria | 1301 |
| 313 | Ga0268265_10545157 | 3300028380 | Bacteria | 1100 |
| 314 | Ga0268265_11780363 | 3300028380 | Bacteria | 622 |
| 315 | Ga0268264_10129238 | 3300028381 | Bacteria | 2237 |
| 316 | Ga0268264_11064473 | 3300028381 | Bacteria | 817 |
| 317 | Ga0307408_100030568 | 3300031548 | Bacteria | 3741 |
| 318 | Ga0307408_100201185 | 3300031548 | Bacteria | 1612 |
| 319 | Ga0307408_100396225 | 3300031548 | Bacteria | 1184 |
| 320 | Ga0307408_101103814 | 3300031548 | Bacteria | 736 |
| 321 | Ga0307408_101617492 | 3300031548 | Bacteria | 615 |
| 322 | Ga0307405_10030293 | 3300031731 | Bacteria | 3172 |
| 323 | Ga0307405_10973968 | 3300031731 | Bacteria | 722 |
| 324 | Ga0307413_10081301 | 3300031824 | Bacteria | 2077 |
| 325 | Ga0307413_10690389 | 3300031824 | Bacteria | 847 |
| 326 | Ga0307413_10794136 | 3300031824 | Bacteria | 795 |
| 327 | Ga0307410_10031322 | 3300031852 | Bacteria | 3412 |
| 328 | Ga0307410_10187188 | 3300031852 | Bacteria | 1572 |
| 329 | Ga0307410_10357881 | 3300031852 | Bacteria | 1168 |
| 330 | Ga0307406_10078753 | 3300031901 | Bacteria | 2184 |
| 331 | Ga0307406_10534429 | 3300031901 | Bacteria | 956 |
| 332 | Ga0307407_10013207 | 3300031903 | Bacteria | 3999 |
| 333 | Ga0307407_10473829 | 3300031903 | Bacteria | 913 |
| 334 | Ga0307407_10488159 | 3300031903 | Bacteria | 901 |
| 335 | Ga0307407_10559304 | 3300031903 | Bacteria | 847 |
| 336 | Ga0307412_10004341 | 3300031911 | Bacteria | 7907 |
| 337 | Ga0307412_10057260 | 3300031911 | Bacteria | 2601 |
| 338 | Ga0307409_100016611 | 3300031995 | Bacteria | 4876 |
| 339 | Ga0307409_100198041 | 3300031995 | Bacteria | 1794 |
| 340 | Ga0307409_100440710 | 3300031995 | Bacteria | 1255 |
| 341 | Ga0307416_100019683 | 3300032002 | Bacteria | 4793 |
| 342 | Ga0307416_100032671 | 3300032002 | Bacteria | 3936 |
| 343 | Ga0307416_100077431 | 3300032002 | Bacteria | 2793 |
| 344 | Ga0307416_100107948 | 3300032002 | Bacteria | 2444 |
| 345 | Ga0307416_100108892 | 3300032002 | Bacteria | 2435 |
| 346 | Ga0307416_100111565 | 3300032002 | Bacteria | 2411 |
| 347 | Ga0307416_100131191 | 3300032002 | Bacteria | 2256 |
| 348 | Ga0307416_100294305 | 3300032002 | Bacteria | 1609 |
| 349 | Ga0307416_100939416 | 3300032002 | Bacteria | 966 |
| 350 | Ga0307416_101195397 | 3300032002 | Bacteria | 866 |
| 351 | Ga0307414_10065988 | 3300032004 | Bacteria | 2585 |
| 352 | Ga0307414_10499577 | 3300032004 | Bacteria | 1076 |
| 353 | Ga0307411_10022399 | 3300032005 | Bacteria | 3719 |
| 354 | Ga0307411_10074438 | 3300032005 | Bacteria | 2314 |
| 355 | Ga0307411_10249991 | 3300032005 | Bacteria | 1393 |
| 356 | Ga0307411_10336041 | 3300032005 | Bacteria | 1226 |
| 357 | Ga0307411_10573462 | 3300032005 | Bacteria | 966 |
| 358 | Ga0307411_10584277 | 3300032005 | Bacteria | 958 |
| 359 | Ga0307411_10670192 | 3300032005 | Bacteria | 900 |
| 360 | Ga0307415_100067318 | 3300032126 | Bacteria | 2502 |
| 361 | Ga0307415_100233055 | 3300032126 | Bacteria | 1484 |
| 362 | Ga0307415_100416548 | 3300032126 | Bacteria | 1151 |
| 363 | Ga0307415_100679630 | 3300032126 | Bacteria | 926 |
| 364 | Ga0373929_0082191 | 3300035085 | Bacteria | 787 |
| 365 | Ga0373945_0079918 | 3300035116 | Bacteria | 1251 |
| 366 | Ga0373946_0159597 | 3300035171 | Bacteria | 1058 |
| 367 | Ga0373931_0909359 | 3300035691 | Bacteria | 592 |
| 368 | Ga0373935_0188915 | 3300035692 | Bacteria | 1418 |
| 369 | Ga0373935_0251565 | 3300035692 | Bacteria | 1237 |
| 370 | Ga0373933_0172169 | 3300035724 | Bacteria | 1378 |
| 371 | Ga0373933_0517343 | 3300035724 | Bacteria | 782 |
| 372 | Ga0373937_0025518 | 3300036401 | Bacteria | 5335 |
| 373 | Ga0373925_1050376 | 3300037068 | Bacteria | 670 |
| 374 | Ga0451800_1266025 | 3300041459 | Bacteria | 908 |
| 375 | Ga0451807_1318327 | 3300041486 | Bacteria | 769 |
| 376 | Ga0451841_0375391 | 3300041498 | Bacteria | 691 |
| 377 | Ga0451843_0700692 | 3300041509 | Bacteria | 694 |
| 378 | Ga0451853_1554116 | 3300041512 | Bacteria | 1049 |
| 379 | Ga0439431_0045483 | 3300041997 | Bacteria | 1127 |
| 380 | Ga0439433_0040321 | 3300041999 | Bacteria | 1086 |
| 381 | Ga0439433_0114530 | 3300041999 | Bacteria | 676 |
| 382 | Ga0439437_017052 | 3300042000 | Bacteria | 861 |
| 383 | Ga0439445_0022985 | 3300042004 | Bacteria | 1576 |
| 384 | Ga0439450_010750 | 3300042008 | Bacteria | 1773 |
| 385 | Ga0439462_0058283 | 3300042015 | Bacteria | 1044 |
| 386 | Ga0450920_039900 | 3300042122 | Bacteria | 935 |
| 387 | Ga0450896_026488 | 3300042133 | Bacteria | 865 |
| 388 | Ga0439446_0017402 | 3300042156 | Bacteria | 2009 |
| 389 | Ga0439446_0018579 | 3300042156 | Bacteria | 1949 |
| 390 | Ga0439446_0072768 | 3300042156 | Bacteria | 1054 |
| 391 | Ga0439435_0012867 | 3300042436 | Bacteria | 2037 |
| 392 | Ga0439435_0044165 | 3300042436 | Bacteria | 1256 |
| 393 | Ga0439435_0138662 | 3300042436 | Bacteria | 773 |
| 394 | Ga0439444_0067247 | 3300042437 | Bacteria | 760 |
| 395 | Ga0439444_0074934 | 3300042437 | Bacteria | 731 |
| 396 | Ga0439464_0039402 | 3300042439 | Bacteria | 1343 |
| 397 | Ga0439464_0090786 | 3300042439 | Bacteria | 921 |
| 398 | Ga0439460_0026127 | 3300042461 | Bacteria | 1631 |
| 399 | Ga0439460_0033799 | 3300042461 | Bacteria | 1471 |
| 400 | Ga0439460_0080817 | 3300042461 | Bacteria | 1020 |
| 401 | Ga0451577_0125270 | 3300042876 | Bacteria | 2302 |
| 402 | Ga0439440_0046765 | 3300042993 | Bacteria | 1070 |
| 403 | Ga0453684_0335310 | 3300044712 | Bacteria | 1709 |
| 404 | Ga0451576_0043533 | 3300045051 | Bacteria | 4736 |
| 405 | Ga0451576_0094215 | 3300045051 | Bacteria | 3114 |
| 406 | Ga0495592_0135150 | 3300046454 | Bacteria | 1721 |
| 407 | Ga0495638_0008491 | 3300046460 | Bacteria | 7279 |
| 408 | Ga0495582_0281907 | 3300046473 | Bacteria | 954 |
| 409 | Ga0495639_0574761 | 3300046475 | Bacteria | 578 |
| 410 | Ga0495608_0197436 | 3300046511 | Bacteria | 1269 |
| 411 | Ga0495587_0475331 | 3300046536 | Bacteria | 692 |
| 412 | Ga0495598_0040628 | 3300046537 | Bacteria | 1357 |
| 413 | Ga0495656_0039211 | 3300046615 | Bacteria | 1967 |
| 414 | Ga0495635_0049123 | 3300046663 | Bacteria | 2908 |
| 415 | Ga0495659_0021490 | 3300046664 | Bacteria | 2175 |
| 416 | Ga0495659_0307617 | 3300046664 | Bacteria | 671 |
| 417 | Ga0495647_0152101 | 3300046681 | Bacteria | 993 |
| 418 | Ga0495658_0061320 | 3300046683 | Bacteria | 2159 |
| 419 | Ga0495600_0117828 | 3300046809 | Bacteria | 1728 |
| 420 | Ga0495636_0120564 | 3300047318 | Bacteria | 1160 |
| 421 | Ga0495674_0107881 | 3300047319 | Bacteria | 2363 |
| 422 | Ga0495674_0249426 | 3300047319 | Bacteria | 1461 |
| 423 | Ga0495674_1065018 | 3300047319 | Bacteria | 617 |
| 424 | Ga0495672_0120022 | 3300047320 | Bacteria | 1399 |
| 425 | Ga0495684_0261197 | 3300047471 | Bacteria | 1256 |
| 426 | Ga0495684_0273969 | 3300047471 | Bacteria | 1220 |
| 427 | Ga0496101_0601485 | 3300048904 | Bacteria | 869 |
| 428 | Ga0496102_0028152 | 3300048905 | Bacteria | 5020 |
| 429 | Ga0496102_0339962 | 3300048905 | Bacteria | 1414 |
| 430 | Ga0496103_0529891 | 3300048906 | Bacteria | 753 |
| 431 | Ga0496104_0265287 | 3300048907 | Bacteria | 1630 |
| 432 | Ga0496104_0282814 | 3300048907 | Bacteria | 1572 |
| 433 | Ga0496105_0339869 | 3300048908 | Bacteria | 1201 |
| 434 | Ga0496106_0631757 | 3300048909 | Bacteria | 856 |
| 435 | Ga0496108_0050479 | 3300048911 | Bacteria | 3482 |
| 436 | Ga0496109_0018373 | 3300048912 | Bacteria | 6143 |
| 437 | Ga0496109_1558771 | 3300048912 | Bacteria | 595 |
| 438 | Ga0496110_0011815 | 3300048913 | Bacteria | 7168 |
| 439 | Ga0496111_0012097 | 3300048914 | Bacteria | 5836 |
| 440 | Ga0496111_0088437 | 3300048914 | Bacteria | 2269 |
| 441 | Ga0496112_0003634 | 3300048915 | Bacteria | 12846 |
| 442 | Ga0496113_0212734 | 3300048916 | Bacteria | 1539 |
| 443 | Ga0496114_0100789 | 3300048917 | Bacteria | 2465 |
| 444 | Ga0496114_0438191 | 3300048917 | Bacteria | 1157 |
| 445 | Ga0496114_0710662 | 3300048917 | Bacteria | 881 |
| 446 | Ga0496115_0520649 | 3300048918 | Bacteria | 954 |
| 447 | Ga0501292_001564 | 3300049515 | Bacteria | 2833 |
| 448 | Ga0501299_022960 | 3300049522 | Bacteria | 1154 |
| 449 | Ga0501299_097809 | 3300049522 | Bacteria | 677 |
| 450 | Ga0501300_032088 | 3300049523 | Bacteria | 777 |
| 451 | Ga0501031_0028667 | 3300049568 | Bacteria | 3630 |
| 452 | Ga0501031_0077005 | 3300049568 | Bacteria | 2172 |
| 453 | Ga0501031_0100742 | 3300049568 | Bacteria | 1885 |
| 454 | Ga0501031_0202990 | 3300049568 | Bacteria | 1293 |
| 455 | Ga0501032_0316046 | 3300049569 | Bacteria | 1008 |
| 456 | Ga0501033_0137386 | 3300049570 | Bacteria | 1768 |
| 457 | Ga0501033_0532023 | 3300049570 | Bacteria | 811 |
| 458 | Ga0501034_0020238 | 3300049571 | Bacteria | 6795 |
| 459 | Ga0501034_0106719 | 3300049571 | Bacteria | 2793 |
| 460 | Ga0501034_0115821 | 3300049571 | Bacteria | 2668 |
| 461 | Ga0501034_0861575 | 3300049571 | Bacteria | 795 |
| 462 | Ga0501036_0018205 | 3300049572 | Bacteria | 5882 |
| 463 | Ga0501036_0323016 | 3300049572 | Bacteria | 1289 |
| 464 | Ga0501036_1097418 | 3300049572 | Bacteria | 650 |
| 465 | Ga0501036_1696559 | 3300049572 | Bacteria | 509 |
| 466 | Ga0501037_0104826 | 3300049573 | Bacteria | 2038 |
| 467 | Ga0501037_0291201 | 3300049573 | Bacteria | 1136 |
| 468 | Ga0501038_0173861 | 3300049574 | Bacteria | 1741 |
| 469 | Ga0501038_0361112 | 3300049574 | Bacteria | 1129 |
| 470 | Ga0501038_0433622 | 3300049574 | Bacteria | 1012 |
| 471 | Ga0501039_0006784 | 3300049575 | Bacteria | 8707 |
| 472 | Ga0501039_0146214 | 3300049575 | Bacteria | 1857 |
| 473 | Ga0501039_0293359 | 3300049575 | Bacteria | 1278 |
| 474 | Ga0501040_0067255 | 3300049576 | Bacteria | 2469 |
| 475 | Ga0501040_0238818 | 3300049576 | Bacteria | 1295 |
| 476 | Ga0501040_0568752 | 3300049576 | Bacteria | 818 |
| 477 | Ga0501040_0698474 | 3300049576 | Bacteria | 734 |
| 478 | Ga0501040_0960159 | 3300049576 | Bacteria | 619 |
| 479 | Ga0501041_0012600 | 3300049577 | Bacteria | 5009 |
| 480 | Ga0501041_0449975 | 3300049577 | Bacteria | 818 |
| 481 | Ga0501042_0175687 | 3300049578 | Bacteria | 1545 |
| 482 | Ga0501042_0198924 | 3300049578 | Bacteria | 1445 |
| 483 | Ga0501043_0001515 | 3300049579 | Bacteria | 20276 |
| 484 | Ga0501046_0056943 | 3300049580 | Bacteria | 3067 |
| 485 | Ga0501047_0000655 | 3300049581 | Bacteria | 36211 |
| 486 | Ga0501047_0020226 | 3300049581 | Bacteria | 6392 |
| 487 | Ga0501047_0997622 | 3300049581 | Bacteria | 650 |
| 488 | Ga0501048_0322227 | 3300049582 | Bacteria | 1101 |
| 489 | Ga0501048_0395491 | 3300049582 | Bacteria | 987 |
| 490 | Ga0501067_0086419 | 3300049583 | Bacteria | 1740 |
| 491 | Ga0501067_0102782 | 3300049583 | Bacteria | 1588 |
| 492 | Ga0501067_0104188 | 3300049583 | Bacteria | 1576 |
| 493 | Ga0501068_0023032 | 3300049584 | Bacteria | 3649 |
| 494 | Ga0501068_0144844 | 3300049584 | Bacteria | 1491 |
| 495 | Ga0501068_0374429 | 3300049584 | Bacteria | 916 |
| 496 | Ga0501068_0582052 | 3300049584 | Bacteria | 729 |
| 497 | Ga0501070_0289836 | 3300049586 | Bacteria | 1334 |
| 498 | Ga0501071_0040967 | 3300049587 | Bacteria | 3316 |
| 499 | Ga0501071_0198355 | 3300049587 | Bacteria | 1507 |
| 500 | Ga0501071_0386114 | 3300049587 | Bacteria | 1068 |
| 501 | Ga0501072_0096244 | 3300049588 | Bacteria | 2353 |
| 502 | Ga0501072_0121998 | 3300049588 | Bacteria | 2076 |
| 503 | Ga0501072_0188081 | 3300049588 | Bacteria | 1647 |
| 504 | Ga0501072_0205294 | 3300049588 | Bacteria | 1571 |
| 505 | Ga0501072_0235429 | 3300049588 | Bacteria | 1458 |
| 506 | Ga0501072_0620448 | 3300049588 | Bacteria | 852 |
| 507 | Ga0501073_0069110 | 3300049589 | Bacteria | 2461 |
| 508 | Ga0501073_0179319 | 3300049589 | Bacteria | 1466 |
| 509 | Ga0501073_0745195 | 3300049589 | Bacteria | 675 |
| 510 | Ga0501073_0909887 | 3300049589 | Bacteria | 606 |
| 511 | Ga0501074_0057226 | 3300049590 | Bacteria | 2809 |
| 512 | Ga0501074_0226228 | 3300049590 | Bacteria | 1332 |
| 513 | Ga0501074_0836872 | 3300049590 | Bacteria | 648 |
| 514 | Ga0501075_0016140 | 3300049591 | Bacteria | 5375 |
| 515 | Ga0501075_0025261 | 3300049591 | Bacteria | 4365 |
| 516 | Ga0501075_0137163 | 3300049591 | Bacteria | 1864 |
| 517 | Ga0501075_0304239 | 3300049591 | Bacteria | 1215 |
| 518 | Ga0501075_0655270 | 3300049591 | Bacteria | 800 |
| 519 | Ga0501075_1304262 | 3300049591 | Bacteria | 550 |
| 520 | Ga0501076_0002349 | 3300049592 | Bacteria | 12942 |
| 521 | Ga0501076_0017306 | 3300049592 | Bacteria | 5476 |
| 522 | Ga0501076_0052814 | 3300049592 | Bacteria | 3220 |
| 523 | Ga0501076_0325057 | 3300049592 | Bacteria | 1262 |
| 524 | Ga0501076_0718808 | 3300049592 | Bacteria | 824 |
| 525 | Ga0501076_1054189 | 3300049592 | Bacteria | 670 |
| 526 | Ga0501077_0033000 | 3300049593 | Bacteria | 3296 |
| 527 | Ga0501077_0163910 | 3300049593 | Bacteria | 1412 |
| 528 | Ga0501077_0241339 | 3300049593 | Bacteria | 1149 |
| 529 | Ga0501077_0657962 | 3300049593 | Bacteria | 673 |
| 530 | Ga0501208_130984 | 3300049655 | Bacteria | 560 |
| 531 | Ga0501211_004634 | 3300049658 | Bacteria | 1394 |
| 532 | Ga0501217_080814 | 3300049661 | Bacteria | 899 |
| 533 | Ga0501233_080764 | 3300049668 | Bacteria | 837 |
| 534 | Ga0501246_006699 | 3300049676 | Bacteria | 992 |
| 535 | Ga0501261_008614 | 3300049690 | Bacteria | 1320 |
| 536 | Ga0501225_0205906 | 3300049705 | Bacteria | 627 |
| 537 | Ga0501079_0121992 | 3300049741 | Bacteria | 2027 |
| 538 | Ga0501079_0862700 | 3300049741 | Bacteria | 713 |
| 539 | Ga0501080_0004681 | 3300049742 | Bacteria | 12201 |
| 540 | Ga0501080_0046088 | 3300049742 | Bacteria | 4061 |
| 541 | Ga0501080_0059920 | 3300049742 | Bacteria | 3542 |
| 542 | Ga0501080_0711364 | 3300049742 | Bacteria | 885 |
| 543 | Ga0501081_0047734 | 3300049743 | Bacteria | 2946 |
| 544 | Ga0501081_0160062 | 3300049743 | Bacteria | 1622 |
| 545 | Ga0501083_0011535 | 3300049744 | Bacteria | 6198 |
| 546 | Ga0501083_0035680 | 3300049744 | Bacteria | 3396 |
| 547 | Ga0501083_0044372 | 3300049744 | Bacteria | 3009 |
| 548 | Ga0501083_0621858 | 3300049744 | Bacteria | 702 |
| 549 | Ga0501266_053971 | 3300049763 | Bacteria | 627 |
| 550 | Ga0501270_017764 | 3300049767 | Bacteria | 1045 |
| 551 | Ga0501283_037067 | 3300049779 | Bacteria | 834 |
| 552 | Ga0501035_0087739 | 3300049822 | Bacteria | 2741 |
| 553 | Ga0501035_0621703 | 3300049822 | Bacteria | 878 |
| 554 | Ga0501035_0799212 | 3300049822 | Bacteria | 754 |
| 555 | Ga0501044_0399364 | 3300049823 | Bacteria | 1287 |
| 556 | Ga0501044_0790490 | 3300049823 | Bacteria | 829 |
| 557 | Ga0501045_0003977 | 3300049824 | Bacteria | 10174 |
| 558 | Ga0501045_0203817 | 3300049824 | Bacteria | 1474 |
| 559 | Ga0501045_0252051 | 3300049824 | Bacteria | 1314 |
| 560 | nmdc:mga03683_130170_c1 | 3300050489 | Bacteria | 1125 |
| 561 | nmdc:mga03683_18662_c1 | 3300050489 | Bacteria | 2639 |
| 562 | nmdc:mga00v17_209911_c1 | 3300050491 | Bacteria | 1260 |
| 563 | nmdc:mga00v17_258565_c1 | 3300050491 | Bacteria | 1129 |
| 564 | nmdc:mga00v17_3790_c1 | 3300050491 | Bacteria | 5428 |
| 565 | nmdc:mga0yw44_314216_c1 | 3300050492 | Bacteria | 1051 |
| 566 | nmdc:mga0k408_369372_c1 | 3300050493 | Bacteria | 855 |
| 567 | nmdc:mga0k408_8033_c1 | 3300050493 | Bacteria | 5656 |
| 568 | nmdc:mga0k408_8489_c1 | 3300050493 | Bacteria | 5517 |
| 569 | nmdc:mga06z11_167416_c1 | 3300050494 | Bacteria | 1260 |
| 570 | nmdc:mga06z11_50336_c1 | 3300050494 | Bacteria | 2129 |
| 571 | nmdc:mga06z11_60949_c1 | 3300050494 | Bacteria | 1966 |
| 572 | nmdc:mga04h51_15505_c1 | 3300050495 | Bacteria | 2196 |
| 573 | nmdc:mga04h51_18673_c1 | 3300050495 | Bacteria | 1702 |
| 574 | nmdc:mga05p37_1981_c1 | 3300050507 | Bacteria | 23880 |
| 575 | nmdc:mga05p37_2447_c1 | 3300050507 | Bacteria | 21583 |
| 576 | nmdc:mga05p37_36837_c2 | 3300050507 | Bacteria | 5679 |
| 577 | nmdc:mga05p37_59395_c1 | 3300050507 | Bacteria | 4709 |
| 578 | nmdc:mga05p37_8178_c1 | 3300050507 | Bacteria | 12363 |
| 579 | nmdc:mga09592_316841_c1 | 3300050508 | Bacteria | 1351 |
| 580 | nmdc:mga09592_472546_c1 | 3300050508 | Bacteria | 1081 |
| 581 | nmdc:mga09592_55588_c1 | 3300050508 | Bacteria | 3345 |
| 582 | nmdc:mga09592_866322_c1 | 3300050508 | Bacteria | 761 |
| 583 | nmdc:mga0qj67_19983_c1 | 3300050509 | Bacteria | 5126 |
| 584 | nmdc:mga0qj67_24872_c1 | 3300050509 | Bacteria | 4621 |
| 585 | nmdc:mga0qj67_5153_c1 | 3300050509 | Bacteria | 9527 |
| 586 | nmdc:mga0qj67_726744_c1 | 3300050509 | Bacteria | 789 |
| 587 | nmdc:mga0qj67_76380_c1 | 3300050509 | Bacteria | 2679 |
| 588 | nmdc:mga06r32_1282030_c1 | 3300050510 | Bacteria | 677 |
| 589 | nmdc:mga06r32_13185_c1 | 3300050510 | Bacteria | 7488 |
| 590 | nmdc:mga06r32_156746_c1 | 3300050510 | Bacteria | 2258 |
| 591 | nmdc:mga06r32_1592340_c1 | 3300050510 | Bacteria | 592 |
| 592 | nmdc:mga06r32_324008_c1 | 3300050510 | Bacteria | 1526 |
| 593 | nmdc:mga06r32_38067_c1 | 3300050510 | Bacteria | 4554 |
| 594 | nmdc:mga06r32_9552_c1 | 3300050510 | Bacteria | 8758 |
| 595 | nmdc:mga08y16_109057_c1 | 3300050511 | Bacteria | 2882 |
| 596 | nmdc:mga08y16_1150799_c1 | 3300050511 | Bacteria | 749 |
| 597 | nmdc:mga08y16_17529_c1 | 3300050511 | Bacteria | 7542 |
| 598 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 599 | nmdc:mga08y16_3529_c1 | 3300050511 | Bacteria | 16237 |
| 600 | nmdc:mga08y16_408326_c1 | 3300050511 | Bacteria | 1389 |
| 601 | nmdc:mga08y16_52143_c1 | 3300050511 | Bacteria | 4280 |
| 602 | nmdc:mga08y16_666541_c1 | 3300050511 | Bacteria | 1043 |
| 603 | nmdc:mga0n895_195581_c2 | 3300050512 | Bacteria | 1040 |
| 604 | nmdc:mga0n895_376660_c1 | 3300050512 | Bacteria | 1436 |
| 605 | nmdc:mga0n895_5943_c1 | 3300050512 | Bacteria | 10266 |
| 606 | nmdc:mga0a205_18430_c1 | 3300050515 | Bacteria | 6563 |
| 607 | nmdc:mga0a205_18629_c1 | 3300050515 | Bacteria | 6531 |
| 608 | nmdc:mga0a205_389558_c1 | 3300050515 | Bacteria | 1258 |
| 609 | nmdc:mga0a205_42207_c1 | 3300050515 | Bacteria | 4394 |
| 610 | nmdc:mga0a205_48168_c1 | 3300050515 | Bacteria | 4113 |
| 611 | nmdc:mga0a205_74704_c1 | 3300050515 | Bacteria | 3275 |
| 612 | nmdc:mga0a205_82233_c1 | 3300050515 | Bacteria | 3110 |
| 613 | Ga0495601_0312208 | 3300053077 | Bacteria | 1024 |
| 614 | Ga0495601_0469590 | 3300053077 | Bacteria | 813 |
| 615 | Ga0495612_0342904 | 3300053078 | Bacteria | 674 |
| 616 | Ga0500641_0006072 | 3300053096 | Bacteria | 4280 |
| 617 | Ga0500556_0007078 | 3300053104 | Bacteria | 3203 |
| 618 | Ga0500568_0013092 | 3300053139 | Bacteria | 3793 |
| 619 | Ga0500616_0003513 | 3300053153 | Bacteria | 11902 |
| 620 | Ga0500611_043423 | 3300053727 | Bacteria | 998 |
| 621 | Ga0501084_0006193 | 3300054114 | Bacteria | 9838 |
| 622 | Ga0501084_0012966 | 3300054114 | Bacteria | 6902 |
| 623 | Ga0501084_0228904 | 3300054114 | Bacteria | 1569 |
| 624 | Ga0501084_0710714 | 3300054114 | Bacteria | 847 |
| 625 | Ga0501084_0895238 | 3300054114 | Bacteria | 746 |
| 626 | Ga0590071_040230 | 3300059421 | Bacteria | 1124 |
| 627 | Ga0590071_052993 | 3300059421 | Bacteria | 985 |
| 628 | Ga0590071_057838 | 3300059421 | Bacteria | 945 |
| 629 | Ga0590075_050668 | 3300059424 | Bacteria | 1065 |
| 630 | Ga0590075_066463 | 3300059424 | Bacteria | 930 |
| 631 | Ga0590077_000256 | 3300059426 | Bacteria | 15185 |
| 632 | Ga0501082_0074604 | 3300060353 | Bacteria | 2922 |
| 633 | Ga0501082_0084295 | 3300060353 | Bacteria | 2741 |
| 634 | Ga0501082_0269235 | 3300060353 | Bacteria | 1482 |
| 635 | Ga0501082_0763864 | 3300060353 | Bacteria | 846 |
| 636 | Ga0501082_0884055 | 3300060353 | Bacteria | 782 |
| 637 | Ga0501082_1077570 | 3300060353 | Bacteria | 702 |
| 638 | Ga0530510_0004651 | 3300061734 | Bacteria | 9494 |
| 639 | Ga0530510_0487647 | 3300061734 | Bacteria | 934 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10664206 | Ga0207643_106642061 | 134 |
| 2 | 3300049572 | Ga0501036_1696559 | Ga0501036_1696559_52_480 | 140 |
| 3 | 3300049574 | Ga0501038_0173861 | Ga0501038_0173861_1298_1729 | 141 |
| 4 | 3300050515 | nmdc:mga0a205_389558_c1 | nmdc:mga0a205_389558_c1_690_1196 | 141 |
| 5 | 3300035085 | Ga0373929_0082191 | Ga0373929_0082191_333_776 | 142 |
| 6 | 3300049591 | Ga0501075_1304262 | Ga0501075_1304262_34_468 | 143 |
| 7 | 3300049763 | Ga0501266_053971 | Ga0501266_053971_25_465 | 144 |
| 8 | 3300014326 | Ga0157380_11587689 | Ga0157380_115876892 | 147 |
| 9 | 3300025937 | Ga0207669_10121789 | Ga0207669_101217892 | 147 |
| 10 | 3300006237 | Ga0097621_100894088 | Ga0097621_1008940882 | 152 |
| 11 | 3300003203 | JGI25406J46586_10000551 | JGI25406J46586_1000055112 | 153 |
| 12 | 3300005985 | Ga0081539_10000074 | Ga0081539_1000007418 | 153 |
| 13 | 3300006042 | Ga0075368_10052983 | Ga0075368_100529833 | 153 |
| 14 | 3300006048 | Ga0075363_100323192 | Ga0075363_1003231922 | 153 |
| 15 | 3300006178 | Ga0075367_10173273 | Ga0075367_101732732 | 153 |
| 16 | 3300027866 | Ga0209813_10107085 | Ga0209813_101070852 | 153 |
| 17 | 3300050495 | nmdc:mga04h51_18673_c1 | nmdc:mga04h51_18673_c1_348_875 | 153 |
| 18 | 3300005331 | Ga0070670_100186698 | Ga0070670_1001866982 | 154 |
| 19 | 3300005344 | Ga0070661_100934584 | Ga0070661_1009345841 | 154 |
| 20 | 3300005564 | Ga0070664_100415934 | Ga0070664_1004159342 | 154 |
| 21 | 3300041486 | Ga0451807_1318327 | Ga0451807_1318327_178_714 | 154 |
| 22 | 3300046475 | Ga0495639_0574761 | Ga0495639_0574761_18_497 | 154 |
| 23 | 3300025937 | Ga0207669_10763035 | Ga0207669_107630352 | 155 |
| 24 | 3300027526 | Ga0209968_1018725 | Ga0209968_10187251 | 155 |
| 25 | 3300047320 | Ga0495672_0120022 | Ga0495672_0120022_702_1229 | 155 |
| 26 | 3300053139 | Ga0500568_0013092 | Ga0500568_0013092_2803_3330 | 155 |
| 27 | 3300007076 | Ga0075435_100902238 | Ga0075435_1009022382 | 157 |
| 28 | 3300005344 | Ga0070661_100697914 | Ga0070661_1006979142 | 158 |
| 29 | 3300006051 | Ga0075364_10180189 | Ga0075364_101801891 | 158 |
| 30 | 3300006177 | Ga0075362_10130114 | Ga0075362_101301142 | 158 |
| 31 | 3300006195 | Ga0075366_10122669 | Ga0075366_101226692 | 158 |
| 32 | 3300009093 | Ga0105240_10151938 | Ga0105240_101519382 | 158 |
| 33 | 3300050489 | nmdc:mga03683_130170_c1 | nmdc:mga03683_130170_c1_263_790 | 158 |
| 34 | 3300050491 | nmdc:mga00v17_258565_c1 | nmdc:mga00v17_258565_c1_564_1091 | 158 |
| 35 | 3300050494 | nmdc:mga06z11_50336_c1 | nmdc:mga06z11_50336_c1_782_1309 | 158 |
| 36 | 3300005347 | Ga0070668_101386338 | Ga0070668_1013863381 | 159 |
| 37 | 3300005441 | Ga0070700_100038200 | Ga0070700_1000382002 | 159 |
| 38 | 3300005719 | Ga0068861_100019101 | Ga0068861_1000191014 | 159 |
| 39 | 3300005844 | Ga0068862_100331869 | Ga0068862_1003318692 | 159 |
| 40 | 3300013308 | Ga0157375_10780624 | Ga0157375_107806242 | 159 |
| 41 | 3300014326 | Ga0157380_10108216 | Ga0157380_101082163 | 159 |
| 42 | 3300025935 | Ga0207709_11071088 | Ga0207709_110710881 | 159 |
| 43 | 3300025972 | Ga0207668_11098358 | Ga0207668_110983581 | 159 |
| 44 | 3300025981 | Ga0207640_10837246 | Ga0207640_108372461 | 159 |
| 45 | 3300026075 | Ga0207708_10070516 | Ga0207708_100705162 | 159 |
| 46 | 3300026118 | Ga0207675_100011213 | Ga0207675_1000112132 | 159 |
| 47 | 3300028380 | Ga0268265_10355028 | Ga0268265_103550282 | 159 |
| 48 | 3300035116 | Ga0373945_0079918 | Ga0373945_0079918_695_1213 | 159 |
| 49 | 3300035171 | Ga0373946_0159597 | Ga0373946_0159597_449_967 | 159 |
| 50 | 3300035692 | Ga0373935_0188915 | Ga0373935_0188915_200_718 | 159 |
| 51 | 3300037068 | Ga0373925_1050376 | Ga0373925_1050376_22_618 | 159 |
| 52 | 3300042004 | Ga0439445_0022985 | Ga0439445_0022985_640_1167 | 159 |
| 53 | 3300060353 | Ga0501082_0884055 | Ga0501082_0884055_194_697 | 159 |
| 54 | 3300005543 | Ga0070672_100693113 | Ga0070672_1006931131 | 160 |
| 55 | 3300009177 | Ga0105248_13044020 | Ga0105248_130440201 | 160 |
| 56 | 3300025923 | Ga0207681_11352844 | Ga0207681_113528441 | 160 |
| 57 | 3300005295 | Ga0065707_10318638 | Ga0065707_103186381 | 161 |
| 58 | 3300005985 | Ga0081539_10001853 | Ga0081539_1000185330 | 161 |
| 59 | 3300006852 | Ga0075433_10149209 | Ga0075433_101492093 | 161 |
| 60 | 3300009094 | Ga0111539_10024995 | Ga0111539_100249957 | 161 |
| 61 | 3300027907 | Ga0207428_10243210 | Ga0207428_102432102 | 161 |
| 62 | 3300050515 | nmdc:mga0a205_48168_c1 | nmdc:mga0a205_48168_c1_86_622 | 161 |
| 63 | 3300003203 | JGI25406J46586_10001262 | JGI25406J46586_100012623 | 163 |
| 64 | 3300005290 | Ga0065712_10084760 | Ga0065712_100847602 | 163 |
| 65 | 3300005985 | Ga0081539_10001558 | Ga0081539_100015583 | 163 |
| 66 | 3300006844 | Ga0075428_100000017 | Ga0075428_10000001756 | 163 |
| 67 | 3300006846 | Ga0075430_101013247 | Ga0075430_1010132472 | 163 |
| 68 | 3300006847 | Ga0075431_100120157 | Ga0075431_1001201573 | 163 |
| 69 | 3300006880 | Ga0075429_100399298 | Ga0075429_1003992982 | 163 |
| 70 | 3300009094 | Ga0111539_10000002 | Ga0111539_10000002382 | 163 |
| 71 | 3300025937 | Ga0207669_10041536 | Ga0207669_100415362 | 163 |
| 72 | 3300025941 | Ga0207711_10907801 | Ga0207711_109078012 | 163 |
| 73 | 3300025960 | Ga0207651_11392180 | Ga0207651_113921802 | 163 |
| 74 | 3300027907 | Ga0207428_10000004 | Ga0207428_10000004274 | 163 |
| 75 | 3300031548 | Ga0307408_100201185 | Ga0307408_1002011851 | 163 |
| 76 | 3300032002 | Ga0307416_100077431 | Ga0307416_1000774312 | 163 |
| 77 | 3300042436 | Ga0439435_0138662 | Ga0439435_0138662_86_616 | 163 |
| 78 | 3300042876 | Ga0451577_0125270 | Ga0451577_0125270_1478_1996 | 163 |
| 79 | 3300044712 | Ga0453684_0335310 | Ga0453684_0335310_1151_1669 | 163 |
| 80 | 3300050508 | nmdc:mga09592_472546_c1 | nmdc:mga09592_472546_c1_227_766 | 163 |
| 81 | 3300050511 | nmdc:mga08y16_2_c1 | nmdc:mga08y16_2_c1_529207_529746 | 163 |
| 82 | 3300005436 | Ga0070713_100018924 | Ga0070713_1000189241 | 164 |
| 83 | 3300005455 | Ga0070663_100098572 | Ga0070663_1000985722 | 164 |
| 84 | 3300006028 | Ga0070717_10415409 | Ga0070717_104154092 | 164 |
| 85 | 3300006051 | Ga0075364_10272761 | Ga0075364_102727612 | 164 |
| 86 | 3300009545 | Ga0105237_10148692 | Ga0105237_101486923 | 164 |
| 87 | 3300010375 | Ga0105239_10340380 | Ga0105239_103403802 | 164 |
| 88 | 3300025914 | Ga0207671_10082575 | Ga0207671_100825753 | 164 |
| 89 | 3300026067 | Ga0207678_10132479 | Ga0207678_101324793 | 164 |
| 90 | 3300028381 | Ga0268264_11064473 | Ga0268264_110644732 | 164 |
| 91 | 3300035724 | Ga0373933_0172169 | Ga0373933_0172169_80_604 | 164 |
| 92 | 3300046511 | Ga0495608_0197436 | Ga0495608_0197436_637_1161 | 164 |
| 93 | 3300047319 | Ga0495674_0249426 | Ga0495674_0249426_924_1448 | 164 |
| 94 | 3300047471 | Ga0495684_0261197 | Ga0495684_0261197_135_659 | 164 |
| 95 | 3300053077 | Ga0495601_0312208 | Ga0495601_0312208_76_600 | 164 |
| 96 | 3300005295 | Ga0065707_10167221 | Ga0065707_101672213 | 165 |
| 97 | 3300025961 | Ga0207712_10372625 | Ga0207712_103726253 | 165 |
| 98 | 3300041509 | Ga0451843_0700692 | Ga0451843_0700692_119_652 | 165 |
| 99 | 3300041512 | Ga0451853_1554116 | Ga0451853_1554116_297_806 | 165 |
| 100 | 3300042156 | Ga0439446_0072768 | Ga0439446_0072768_333_842 | 165 |
| 101 | 3300049583 | Ga0501067_0102782 | Ga0501067_0102782_179_721 | 165 |
| 102 | 3300053153 | Ga0500616_0003513 | Ga0500616_0003513_9429_9956 | 165 |
| 103 | 3300005518 | Ga0070699_100972890 | Ga0070699_1009728901 | 166 |
| 104 | 3300006871 | Ga0075434_101469276 | Ga0075434_1014692761 | 166 |
| 105 | 3300026095 | Ga0207676_10140197 | Ga0207676_101401972 | 166 |
| 106 | 3300046460 | Ga0495638_0008491 | Ga0495638_0008491_3642_4172 | 166 |
| 107 | 3300048905 | Ga0496102_0339962 | Ga0496102_0339962_533_1033 | 166 |
| 108 | 3300049592 | Ga0501076_0718808 | Ga0501076_0718808_82_642 | 166 |
| 109 | 3300050512 | nmdc:mga0n895_195581_c2 | nmdc:mga0n895_195581_c2_94_612 | 166 |
| 110 | 3300053096 | Ga0500641_0006072 | Ga0500641_0006072_1498_2028 | 166 |
| 111 | 3300053727 | Ga0500611_043423 | Ga0500611_043423_261_791 | 166 |
| 112 | 3300005366 | Ga0070659_100639026 | Ga0070659_1006390262 | 167 |
| 113 | 3300005458 | Ga0070681_10259734 | Ga0070681_102597342 | 167 |
| 114 | 3300005614 | Ga0068856_100265569 | Ga0068856_1002655692 | 167 |
| 115 | 3300005841 | Ga0068863_101485358 | Ga0068863_1014853582 | 167 |
| 116 | 3300009093 | Ga0105240_10103506 | Ga0105240_101035063 | 167 |
| 117 | 3300014326 | Ga0157380_11297186 | Ga0157380_112971862 | 167 |
| 118 | 3300014968 | Ga0157379_11452105 | Ga0157379_114521051 | 167 |
| 119 | 3300025912 | Ga0207707_10125793 | Ga0207707_101257932 | 167 |
| 120 | 3300025932 | Ga0207690_10077857 | Ga0207690_100778573 | 167 |
| 121 | 3300026078 | Ga0207702_10135324 | Ga0207702_101353243 | 167 |
| 122 | 3300026116 | Ga0207674_10603316 | Ga0207674_106033161 | 167 |
| 123 | 3300036401 | Ga0373937_0025518 | Ga0373937_0025518_50_559 | 167 |
| 124 | 3300048917 | Ga0496114_0438191 | Ga0496114_0438191_76_585 | 167 |
| 125 | 3300049568 | Ga0501031_0077005 | Ga0501031_0077005_1541_2050 | 167 |
| 126 | 3300049568 | Ga0501031_0202990 | Ga0501031_0202990_90_599 | 167 |
| 127 | 3300049569 | Ga0501032_0316046 | Ga0501032_0316046_176_685 | 167 |
| 128 | 3300049570 | Ga0501033_0137386 | Ga0501033_0137386_361_870 | 167 |
| 129 | 3300049571 | Ga0501034_0106719 | Ga0501034_0106719_98_607 | 167 |
| 130 | 3300049571 | Ga0501034_0115821 | Ga0501034_0115821_2042_2551 | 167 |
| 131 | 3300049571 | Ga0501034_0861575 | Ga0501034_0861575_189_698 | 167 |
| 132 | 3300049572 | Ga0501036_0018205 | Ga0501036_0018205_4243_4752 | 167 |
| 133 | 3300049573 | Ga0501037_0104826 | Ga0501037_0104826_913_1422 | 167 |
| 134 | 3300049574 | Ga0501038_0433622 | Ga0501038_0433622_104_613 | 167 |
| 135 | 3300049575 | Ga0501039_0006784 | Ga0501039_0006784_714_1223 | 167 |
| 136 | 3300049575 | Ga0501039_0146214 | Ga0501039_0146214_346_855 | 167 |
| 137 | 3300049578 | Ga0501042_0175687 | Ga0501042_0175687_788_1297 | 167 |
| 138 | 3300049579 | Ga0501043_0001515 | Ga0501043_0001515_18321_18830 | 167 |
| 139 | 3300049581 | Ga0501047_0000655 | Ga0501047_0000655_4021_4530 | 167 |
| 140 | 3300049581 | Ga0501047_0020226 | Ga0501047_0020226_98_607 | 167 |
| 141 | 3300049581 | Ga0501047_0997622 | Ga0501047_0997622_98_607 | 167 |
| 142 | 3300049582 | Ga0501048_0395491 | Ga0501048_0395491_258_767 | 167 |
| 143 | 3300049583 | Ga0501067_0104188 | Ga0501067_0104188_563_1072 | 167 |
| 144 | 3300049584 | Ga0501068_0023032 | Ga0501068_0023032_3036_3545 | 167 |
| 145 | 3300049584 | Ga0501068_0374429 | Ga0501068_0374429_98_607 | 167 |
| 146 | 3300049586 | Ga0501070_0289836 | Ga0501070_0289836_804_1313 | 167 |
| 147 | 3300049588 | Ga0501072_0121998 | Ga0501072_0121998_1428_1937 | 167 |
| 148 | 3300049588 | Ga0501072_0235429 | Ga0501072_0235429_208_717 | 167 |
| 149 | 3300049589 | Ga0501073_0069110 | Ga0501073_0069110_601_1110 | 167 |
| 150 | 3300049589 | Ga0501073_0745195 | Ga0501073_0745195_48_557 | 167 |
| 151 | 3300049593 | Ga0501077_0241339 | Ga0501077_0241339_20_529 | 167 |
| 152 | 3300049742 | Ga0501080_0004681 | Ga0501080_0004681_342_851 | 167 |
| 153 | 3300049742 | Ga0501080_0059920 | Ga0501080_0059920_1167_1676 | 167 |
| 154 | 3300049742 | Ga0501080_0711364 | Ga0501080_0711364_190_699 | 167 |
| 155 | 3300049744 | Ga0501083_0011535 | Ga0501083_0011535_4311_4820 | 167 |
| 156 | 3300049744 | Ga0501083_0035680 | Ga0501083_0035680_1025_1534 | 167 |
| 157 | 3300049744 | Ga0501083_0044372 | Ga0501083_0044372_1852_2361 | 167 |
| 158 | 3300049744 | Ga0501083_0621858 | Ga0501083_0621858_163_672 | 167 |
| 159 | 3300049822 | Ga0501035_0087739 | Ga0501035_0087739_2205_2714 | 167 |
| 160 | 3300049823 | Ga0501044_0399364 | Ga0501044_0399364_73_582 | 167 |
| 161 | 3300049824 | Ga0501045_0252051 | Ga0501045_0252051_782_1288 | 167 |
| 162 | 3300054114 | Ga0501084_0006193 | Ga0501084_0006193_4578_5087 | 167 |
| 163 | 3300054114 | Ga0501084_0895238 | Ga0501084_0895238_102_611 | 167 |
| 164 | 3300059424 | Ga0590075_066463 | Ga0590075_066463_89_598 | 167 |
| 165 | 3300060353 | Ga0501082_0269235 | Ga0501082_0269235_168_677 | 167 |
| 166 | 3300060353 | Ga0501082_0763864 | Ga0501082_0763864_127_633 | 167 |
| 167 | 3300060353 | Ga0501082_1077570 | Ga0501082_1077570_99_608 | 167 |
| 168 | 3300005336 | Ga0070680_100336784 | Ga0070680_1003367843 | 168 |
| 169 | 3300005338 | Ga0068868_100049345 | Ga0068868_1000493452 | 168 |
| 170 | 3300005343 | Ga0070687_100060313 | Ga0070687_1000603132 | 168 |
| 171 | 3300005441 | Ga0070700_100020842 | Ga0070700_1000208423 | 168 |
| 172 | 3300005545 | Ga0070695_100828934 | Ga0070695_1008289342 | 168 |
| 173 | 3300005547 | Ga0070693_100026270 | Ga0070693_1000262703 | 168 |
| 174 | 3300005615 | Ga0070702_100005168 | Ga0070702_1000051683 | 168 |
| 175 | 3300005834 | Ga0068851_10270367 | Ga0068851_102703671 | 168 |
| 176 | 3300005985 | Ga0081539_10179139 | Ga0081539_101791392 | 168 |
| 177 | 3300006871 | Ga0075434_100504270 | Ga0075434_1005042703 | 168 |
| 178 | 3300009094 | Ga0111539_10568136 | Ga0111539_105681362 | 168 |
| 179 | 3300009094 | Ga0111539_11339402 | Ga0111539_113394022 | 168 |
| 180 | 3300009174 | Ga0105241_10036009 | Ga0105241_100360093 | 168 |
| 181 | 3300009551 | Ga0105238_10298326 | Ga0105238_102983263 | 168 |
| 182 | 3300027876 | Ga0209974_10176669 | Ga0209974_101766692 | 168 |
| 183 | 3300028380 | Ga0268265_11780363 | Ga0268265_117803631 | 168 |
| 184 | 3300031824 | Ga0307413_10690389 | Ga0307413_106903891 | 168 |
| 185 | 3300032005 | Ga0307411_10022399 | Ga0307411_100223993 | 168 |
| 186 | 3300046454 | Ga0495592_0135150 | Ga0495592_0135150_275_787 | 168 |
| 187 | 3300049576 | Ga0501040_0960159 | Ga0501040_0960159_65_574 | 168 |
| 188 | 3300049578 | Ga0501042_0198924 | Ga0501042_0198924_50_559 | 168 |
| 189 | 3300049582 | Ga0501048_0322227 | Ga0501048_0322227_272_781 | 168 |
| 190 | 3300049587 | Ga0501071_0198355 | Ga0501071_0198355_566_1096 | 168 |
| 191 | 3300049587 | Ga0501071_0386114 | Ga0501071_0386114_15_545 | 168 |
| 192 | 3300049588 | Ga0501072_0096244 | Ga0501072_0096244_701_1210 | 168 |
| 193 | 3300049589 | Ga0501073_0179319 | Ga0501073_0179319_232_762 | 168 |
| 194 | 3300049590 | Ga0501074_0226228 | Ga0501074_0226228_322_852 | 168 |
| 195 | 3300049591 | Ga0501075_0655270 | Ga0501075_0655270_33_542 | 168 |
| 196 | 3300049592 | Ga0501076_0325057 | Ga0501076_0325057_24_533 | 168 |
| 197 | 3300049593 | Ga0501077_0163910 | Ga0501077_0163910_563_1093 | 168 |
| 198 | 3300049741 | Ga0501079_0862700 | Ga0501079_0862700_71_580 | 168 |
| 199 | 3300049743 | Ga0501081_0160062 | Ga0501081_0160062_190_717 | 168 |
| 200 | 3300050511 | nmdc:mga08y16_666541_c1 | nmdc:mga08y16_666541_c1_409_918 | 168 |
| 201 | 3300053078 | Ga0495612_0342904 | Ga0495612_0342904_39_551 | 168 |
| 202 | 3300005290 | Ga0065712_10310482 | Ga0065712_103104822 | 169 |
| 203 | 3300005333 | Ga0070677_10128962 | Ga0070677_101289622 | 169 |
| 204 | 3300005353 | Ga0070669_101048725 | Ga0070669_1010487252 | 169 |
| 205 | 3300005456 | Ga0070678_100685909 | Ga0070678_1006859091 | 169 |
| 206 | 3300005617 | Ga0068859_100784460 | Ga0068859_1007844602 | 169 |
| 207 | 3300005719 | Ga0068861_100170030 | Ga0068861_1001700302 | 169 |
| 208 | 3300006051 | Ga0075364_10001357 | Ga0075364_100013578 | 169 |
| 209 | 3300006177 | Ga0075362_10000746 | Ga0075362_100007465 | 169 |
| 210 | 3300006178 | Ga0075367_10030679 | Ga0075367_100306793 | 169 |
| 211 | 3300006178 | Ga0075367_10076777 | Ga0075367_100767771 | 169 |
| 212 | 3300006195 | Ga0075366_10159559 | Ga0075366_101595592 | 169 |
| 213 | 3300006237 | Ga0097621_100435440 | Ga0097621_1004354402 | 169 |
| 214 | 3300006353 | Ga0075370_10215271 | Ga0075370_102152712 | 169 |
| 215 | 3300006844 | Ga0075428_100069014 | Ga0075428_1000690142 | 169 |
| 216 | 3300006846 | Ga0075430_100017811 | Ga0075430_1000178114 | 169 |
| 217 | 3300006847 | Ga0075431_100047382 | Ga0075431_1000473824 | 169 |
| 218 | 3300006931 | Ga0097620_100784377 | Ga0097620_1007843772 | 169 |
| 219 | 3300009094 | Ga0111539_10724381 | Ga0111539_107243812 | 169 |
| 220 | 3300009094 | Ga0111539_11574096 | Ga0111539_115740961 | 169 |
| 221 | 3300009147 | Ga0114129_10015583 | Ga0114129_100155836 | 169 |
| 222 | 3300009176 | Ga0105242_10862317 | Ga0105242_108623172 | 169 |
| 223 | 3300009176 | Ga0105242_12162645 | Ga0105242_121626451 | 169 |
| 224 | 3300009177 | Ga0105248_10222454 | Ga0105248_102224543 | 169 |
| 225 | 3300009177 | Ga0105248_10777388 | Ga0105248_107773883 | 169 |
| 226 | 3300009553 | Ga0105249_10339804 | Ga0105249_103398042 | 169 |
| 227 | 3300011119 | Ga0105246_10531502 | Ga0105246_105315021 | 169 |
| 228 | 3300013306 | Ga0163162_10256904 | Ga0163162_102569043 | 169 |
| 229 | 3300025893 | Ga0207682_10082501 | Ga0207682_100825013 | 169 |
| 230 | 3300025926 | Ga0207659_10622685 | Ga0207659_106226852 | 169 |
| 231 | 3300025981 | Ga0207640_11707054 | Ga0207640_117070541 | 169 |
| 232 | 3300026116 | Ga0207674_10975228 | Ga0207674_109752282 | 169 |
| 233 | 3300031548 | Ga0307408_100396225 | Ga0307408_1003962252 | 169 |
| 234 | 3300031911 | Ga0307412_10004341 | Ga0307412_100043412 | 169 |
| 235 | 3300032002 | Ga0307416_100032671 | Ga0307416_1000326712 | 169 |
| 236 | 3300032002 | Ga0307416_100111565 | Ga0307416_1001115653 | 169 |
| 237 | 3300032002 | Ga0307416_100939416 | Ga0307416_1009394162 | 169 |
| 238 | 3300032005 | Ga0307411_10336041 | Ga0307411_103360412 | 169 |
| 239 | 3300032126 | Ga0307415_100233055 | Ga0307415_1002330552 | 169 |
| 240 | 3300035692 | Ga0373935_0251565 | Ga0373935_0251565_442_957 | 169 |
| 241 | 3300035724 | Ga0373933_0517343 | Ga0373933_0517343_169_684 | 169 |
| 242 | 3300041459 | Ga0451800_1266025 | Ga0451800_1266025_247_768 | 169 |
| 243 | 3300041997 | Ga0439431_0045483 | Ga0439431_0045483_551_1069 | 169 |
| 244 | 3300041999 | Ga0439433_0040321 | Ga0439433_0040321_528_1046 | 169 |
| 245 | 3300041999 | Ga0439433_0114530 | Ga0439433_0114530_106_633 | 169 |
| 246 | 3300042015 | Ga0439462_0058283 | Ga0439462_0058283_322_834 | 169 |
| 247 | 3300042156 | Ga0439446_0017402 | Ga0439446_0017402_21_539 | 169 |
| 248 | 3300042436 | Ga0439435_0044165 | Ga0439435_0044165_135_650 | 169 |
| 249 | 3300042461 | Ga0439460_0033799 | Ga0439460_0033799_632_1153 | 169 |
| 250 | 3300042461 | Ga0439460_0080817 | Ga0439460_0080817_487_999 | 169 |
| 251 | 3300046473 | Ga0495582_0281907 | Ga0495582_0281907_135_650 | 169 |
| 252 | 3300046663 | Ga0495635_0049123 | Ga0495635_0049123_2173_2688 | 169 |
| 253 | 3300046683 | Ga0495658_0061320 | Ga0495658_0061320_127_642 | 169 |
| 254 | 3300047319 | Ga0495674_0107881 | Ga0495674_0107881_1273_1788 | 169 |
| 255 | 3300047319 | Ga0495674_1065018 | Ga0495674_1065018_57_572 | 169 |
| 256 | 3300049568 | Ga0501031_0100742 | Ga0501031_0100742_432_944 | 169 |
| 257 | 3300049570 | Ga0501033_0532023 | Ga0501033_0532023_196_711 | 169 |
| 258 | 3300049571 | Ga0501034_0020238 | Ga0501034_0020238_1264_1779 | 169 |
| 259 | 3300049576 | Ga0501040_0698474 | Ga0501040_0698474_187_696 | 169 |
| 260 | 3300049589 | Ga0501073_0909887 | Ga0501073_0909887_68_589 | 169 |
| 261 | 3300049822 | Ga0501035_0799212 | Ga0501035_0799212_107_619 | 169 |
| 262 | 3300050489 | nmdc:mga03683_18662_c1 | nmdc:mga03683_18662_c1_1301_1816 | 169 |
| 263 | 3300050491 | nmdc:mga00v17_209911_c1 | nmdc:mga00v17_209911_c1_547_1062 | 169 |
| 264 | 3300050491 | nmdc:mga00v17_3790_c1 | nmdc:mga00v17_3790_c1_3113_3628 | 169 |
| 265 | 3300050492 | nmdc:mga0yw44_314216_c1 | nmdc:mga0yw44_314216_c1_40_555 | 169 |
| 266 | 3300050493 | nmdc:mga0k408_8033_c1 | nmdc:mga0k408_8033_c1_3059_3574 | 169 |
| 267 | 3300050493 | nmdc:mga0k408_8489_c1 | nmdc:mga0k408_8489_c1_4693_5208 | 169 |
| 268 | 3300050494 | nmdc:mga06z11_60949_c1 | nmdc:mga06z11_60949_c1_306_821 | 169 |
| 269 | 3300050507 | nmdc:mga05p37_59395_c1 | nmdc:mga05p37_59395_c1_415_930 | 169 |
| 270 | 3300050509 | nmdc:mga0qj67_24872_c1 | nmdc:mga0qj67_24872_c1_2848_3363 | 169 |
| 271 | 3300050510 | nmdc:mga06r32_1282030_c1 | nmdc:mga06r32_1282030_c1_122_652 | 169 |
| 272 | 3300050510 | nmdc:mga06r32_38067_c1 | nmdc:mga06r32_38067_c1_3248_3763 | 169 |
| 273 | 3300050515 | nmdc:mga0a205_42207_c1 | nmdc:mga0a205_42207_c1_1411_1926 | 169 |
| 274 | 3300053104 | Ga0500556_0007078 | Ga0500556_0007078_1786_2319 | 169 |
| 275 | 3300059421 | Ga0590071_040230 | Ga0590071_040230_227_745 | 169 |
| 276 | 3300059421 | Ga0590071_052993 | Ga0590071_052993_40_564 | 169 |
| 277 | 3300059424 | Ga0590075_050668 | Ga0590075_050668_174_701 | 169 |
| 278 | 3300005290 | Ga0065712_10009881 | Ga0065712_100098813 | 170 |
| 279 | 3300005293 | Ga0065715_10009346 | Ga0065715_100093461 | 170 |
| 280 | 3300005334 | Ga0068869_100239485 | Ga0068869_1002394852 | 170 |
| 281 | 3300005353 | Ga0070669_100040998 | Ga0070669_1000409983 | 170 |
| 282 | 3300005354 | Ga0070675_100235798 | Ga0070675_1002357983 | 170 |
| 283 | 3300005356 | Ga0070674_100356010 | Ga0070674_1003560102 | 170 |
| 284 | 3300005365 | Ga0070688_100868461 | Ga0070688_1008684611 | 170 |
| 285 | 3300005365 | Ga0070688_101017771 | Ga0070688_1010177711 | 170 |
| 286 | 3300005367 | Ga0070667_100939165 | Ga0070667_1009391651 | 170 |
| 287 | 3300005444 | Ga0070694_100608024 | Ga0070694_1006080242 | 170 |
| 288 | 3300005455 | Ga0070663_100590807 | Ga0070663_1005908071 | 170 |
| 289 | 3300005456 | Ga0070678_100363343 | Ga0070678_1003633432 | 170 |
| 290 | 3300005548 | Ga0070665_101281379 | Ga0070665_1012813792 | 170 |
| 291 | 3300005719 | Ga0068861_100599356 | Ga0068861_1005993562 | 170 |
| 292 | 3300005719 | Ga0068861_101830081 | Ga0068861_1018300811 | 170 |
| 293 | 3300005841 | Ga0068863_100865763 | Ga0068863_1008657631 | 170 |
| 294 | 3300005844 | Ga0068862_100200782 | Ga0068862_1002007822 | 170 |
| 295 | 3300006237 | Ga0097621_100146702 | Ga0097621_1001467023 | 170 |
| 296 | 3300006844 | Ga0075428_100000295 | Ga0075428_10000029539 | 170 |
| 297 | 3300006846 | Ga0075430_100003248 | Ga0075430_10000324813 | 170 |
| 298 | 3300006846 | Ga0075430_100033466 | Ga0075430_1000334665 | 170 |
| 299 | 3300006846 | Ga0075430_100315830 | Ga0075430_1003158302 | 170 |
| 300 | 3300006846 | Ga0075430_100822014 | Ga0075430_1008220142 | 170 |
| 301 | 3300006847 | Ga0075431_100004098 | Ga0075431_1000040986 | 170 |
| 302 | 3300006847 | Ga0075431_100139379 | Ga0075431_1001393793 | 170 |
| 303 | 3300006847 | Ga0075431_100238020 | Ga0075431_1002380203 | 170 |
| 304 | 3300006847 | Ga0075431_100781717 | Ga0075431_1007817172 | 170 |
| 305 | 3300006852 | Ga0075433_10260473 | Ga0075433_102604733 | 170 |
| 306 | 3300006871 | Ga0075434_101262632 | Ga0075434_1012626322 | 170 |
| 307 | 3300006880 | Ga0075429_100043580 | Ga0075429_1000435803 | 170 |
| 308 | 3300006880 | Ga0075429_100517201 | Ga0075429_1005172012 | 170 |
| 309 | 3300006880 | Ga0075429_100810836 | Ga0075429_1008108362 | 170 |
| 310 | 3300006881 | Ga0068865_100695936 | Ga0068865_1006959362 | 170 |
| 311 | 3300009094 | Ga0111539_10000037 | Ga0111539_100000379 | 170 |
| 312 | 3300009094 | Ga0111539_10132671 | Ga0111539_101326712 | 170 |
| 313 | 3300009094 | Ga0111539_10366981 | Ga0111539_103669812 | 170 |
| 314 | 3300009101 | Ga0105247_11185299 | Ga0105247_111852991 | 170 |
| 315 | 3300009147 | Ga0114129_10004316 | Ga0114129_1000431613 | 170 |
| 316 | 3300009147 | Ga0114129_10008636 | Ga0114129_100086367 | 170 |
| 317 | 3300009147 | Ga0114129_10009195 | Ga0114129_1000919511 | 170 |
| 318 | 3300009147 | Ga0114129_11368661 | Ga0114129_113686612 | 170 |
| 319 | 3300009553 | Ga0105249_10656757 | Ga0105249_106567572 | 170 |
| 320 | 3300013297 | Ga0157378_10479074 | Ga0157378_104790743 | 170 |
| 321 | 3300013308 | Ga0157375_10439164 | Ga0157375_104391642 | 170 |
| 322 | 3300013308 | Ga0157375_12076562 | Ga0157375_120765621 | 170 |
| 323 | 3300014325 | Ga0163163_10003825 | Ga0163163_100038259 | 170 |
| 324 | 3300014326 | Ga0157380_10396133 | Ga0157380_103961332 | 170 |
| 325 | 3300014326 | Ga0157380_10545858 | Ga0157380_105458582 | 170 |
| 326 | 3300014326 | Ga0157380_10984312 | Ga0157380_109843122 | 170 |
| 327 | 3300014969 | Ga0157376_10357727 | Ga0157376_103577272 | 170 |
| 328 | 3300014969 | Ga0157376_10382089 | Ga0157376_103820891 | 170 |
| 329 | 3300025903 | Ga0207680_10192550 | Ga0207680_101925502 | 170 |
| 330 | 3300025926 | Ga0207659_10200018 | Ga0207659_102000183 | 170 |
| 331 | 3300025926 | Ga0207659_10261151 | Ga0207659_102611512 | 170 |
| 332 | 3300025933 | Ga0207706_10345068 | Ga0207706_103450682 | 170 |
| 333 | 3300025937 | Ga0207669_10076108 | Ga0207669_100761082 | 170 |
| 334 | 3300025937 | Ga0207669_10079190 | Ga0207669_100791903 | 170 |
| 335 | 3300025937 | Ga0207669_10112204 | Ga0207669_101122043 | 170 |
| 336 | 3300025940 | Ga0207691_10523878 | Ga0207691_105238782 | 170 |
| 337 | 3300025961 | Ga0207712_10669844 | Ga0207712_106698442 | 170 |
| 338 | 3300025986 | Ga0207658_10978303 | Ga0207658_109783032 | 170 |
| 339 | 3300026088 | Ga0207641_10291226 | Ga0207641_102912262 | 170 |
| 340 | 3300026088 | Ga0207641_10812847 | Ga0207641_108128472 | 170 |
| 341 | 3300026118 | Ga0207675_100339487 | Ga0207675_1003394872 | 170 |
| 342 | 3300026121 | Ga0207683_10118218 | Ga0207683_101182183 | 170 |
| 343 | 3300026121 | Ga0207683_10413841 | Ga0207683_104138412 | 170 |
| 344 | 3300026121 | Ga0207683_10731172 | Ga0207683_107311722 | 170 |
| 345 | 3300027907 | Ga0207428_10001068 | Ga0207428_100010686 | 170 |
| 346 | 3300027907 | Ga0207428_10535986 | Ga0207428_105359862 | 170 |
| 347 | 3300028380 | Ga0268265_10159237 | Ga0268265_101592373 | 170 |
| 348 | 3300028380 | Ga0268265_10378813 | Ga0268265_103788133 | 170 |
| 349 | 3300028381 | Ga0268264_10129238 | Ga0268264_101292383 | 170 |
| 350 | 3300031548 | Ga0307408_101617492 | Ga0307408_1016174921 | 170 |
| 351 | 3300031731 | Ga0307405_10030293 | Ga0307405_100302933 | 170 |
| 352 | 3300031731 | Ga0307405_10973968 | Ga0307405_109739682 | 170 |
| 353 | 3300031824 | Ga0307413_10081301 | Ga0307413_100813011 | 170 |
| 354 | 3300031824 | Ga0307413_10794136 | Ga0307413_107941362 | 170 |
| 355 | 3300031852 | Ga0307410_10031322 | Ga0307410_100313223 | 170 |
| 356 | 3300031852 | Ga0307410_10357881 | Ga0307410_103578812 | 170 |
| 357 | 3300031901 | Ga0307406_10078753 | Ga0307406_100787532 | 170 |
| 358 | 3300031903 | Ga0307407_10013207 | Ga0307407_100132073 | 170 |
| 359 | 3300031903 | Ga0307407_10473829 | Ga0307407_104738292 | 170 |
| 360 | 3300031903 | Ga0307407_10559304 | Ga0307407_105593041 | 170 |
| 361 | 3300031911 | Ga0307412_10057260 | Ga0307412_100572602 | 170 |
| 362 | 3300031995 | Ga0307409_100198041 | Ga0307409_1001980413 | 170 |
| 363 | 3300031995 | Ga0307409_100440710 | Ga0307409_1004407102 | 170 |
| 364 | 3300032002 | Ga0307416_100019683 | Ga0307416_1000196833 | 170 |
| 365 | 3300032002 | Ga0307416_100108892 | Ga0307416_1001088922 | 170 |
| 366 | 3300032002 | Ga0307416_100131191 | Ga0307416_1001311913 | 170 |
| 367 | 3300032002 | Ga0307416_100294305 | Ga0307416_1002943052 | 170 |
| 368 | 3300032002 | Ga0307416_101195397 | Ga0307416_1011953972 | 170 |
| 369 | 3300032005 | Ga0307411_10074438 | Ga0307411_100744383 | 170 |
| 370 | 3300032005 | Ga0307411_10249991 | Ga0307411_102499913 | 170 |
| 371 | 3300032005 | Ga0307411_10584277 | Ga0307411_105842772 | 170 |
| 372 | 3300032005 | Ga0307411_10670192 | Ga0307411_106701922 | 170 |
| 373 | 3300032126 | Ga0307415_100067318 | Ga0307415_1000673183 | 170 |
| 374 | 3300032126 | Ga0307415_100416548 | Ga0307415_1004165482 | 170 |
| 375 | 3300041498 | Ga0451841_0375391 | Ga0451841_0375391_33_554 | 170 |
| 376 | 3300042000 | Ga0439437_017052 | Ga0439437_017052_288_803 | 170 |
| 377 | 3300042008 | Ga0439450_010750 | Ga0439450_010750_1211_1726 | 170 |
| 378 | 3300042436 | Ga0439435_0012867 | Ga0439435_0012867_443_958 | 170 |
| 379 | 3300042437 | Ga0439444_0074934 | Ga0439444_0074934_123_638 | 170 |
| 380 | 3300042439 | Ga0439464_0039402 | Ga0439464_0039402_670_1185 | 170 |
| 381 | 3300042993 | Ga0439440_0046765 | Ga0439440_0046765_418_933 | 170 |
| 382 | 3300045051 | Ga0451576_0043533 | Ga0451576_0043533_2319_2840 | 170 |
| 383 | 3300045051 | Ga0451576_0094215 | Ga0451576_0094215_636_1148 | 170 |
| 384 | 3300046615 | Ga0495656_0039211 | Ga0495656_0039211_961_1473 | 170 |
| 385 | 3300046664 | Ga0495659_0307617 | Ga0495659_0307617_138_650 | 170 |
| 386 | 3300046681 | Ga0495647_0152101 | Ga0495647_0152101_304_816 | 170 |
| 387 | 3300047318 | Ga0495636_0120564 | Ga0495636_0120564_300_833 | 170 |
| 388 | 3300048905 | Ga0496102_0028152 | Ga0496102_0028152_517_1029 | 170 |
| 389 | 3300048906 | Ga0496103_0529891 | Ga0496103_0529891_103_624 | 170 |
| 390 | 3300048907 | Ga0496104_0282814 | Ga0496104_0282814_953_1474 | 170 |
| 391 | 3300048909 | Ga0496106_0631757 | Ga0496106_0631757_299_811 | 170 |
| 392 | 3300048912 | Ga0496109_1558771 | Ga0496109_1558771_53_574 | 170 |
| 393 | 3300048917 | Ga0496114_0100789 | Ga0496114_0100789_351_872 | 170 |
| 394 | 3300049515 | Ga0501292_001564 | Ga0501292_001564_1335_1850 | 170 |
| 395 | 3300049522 | Ga0501299_022960 | Ga0501299_022960_571_1125 | 170 |
| 396 | 3300049522 | Ga0501299_097809 | Ga0501299_097809_89_604 | 170 |
| 397 | 3300049523 | Ga0501300_032088 | Ga0501300_032088_201_755 | 170 |
| 398 | 3300049568 | Ga0501031_0028667 | Ga0501031_0028667_2543_3055 | 170 |
| 399 | 3300049572 | Ga0501036_0323016 | Ga0501036_0323016_321_833 | 170 |
| 400 | 3300049572 | Ga0501036_1097418 | Ga0501036_1097418_73_585 | 170 |
| 401 | 3300049573 | Ga0501037_0291201 | Ga0501037_0291201_242_754 | 170 |
| 402 | 3300049574 | Ga0501038_0361112 | Ga0501038_0361112_77_589 | 170 |
| 403 | 3300049575 | Ga0501039_0293359 | Ga0501039_0293359_194_706 | 170 |
| 404 | 3300049576 | Ga0501040_0067255 | Ga0501040_0067255_1285_1797 | 170 |
| 405 | 3300049576 | Ga0501040_0238818 | Ga0501040_0238818_70_585 | 170 |
| 406 | 3300049577 | Ga0501041_0012600 | Ga0501041_0012600_2818_3330 | 170 |
| 407 | 3300049577 | Ga0501041_0449975 | Ga0501041_0449975_176_688 | 170 |
| 408 | 3300049580 | Ga0501046_0056943 | Ga0501046_0056943_1824_2336 | 170 |
| 409 | 3300049584 | Ga0501068_0144844 | Ga0501068_0144844_419_931 | 170 |
| 410 | 3300049587 | Ga0501071_0040967 | Ga0501071_0040967_2224_2736 | 170 |
| 411 | 3300049588 | Ga0501072_0188081 | Ga0501072_0188081_706_1218 | 170 |
| 412 | 3300049588 | Ga0501072_0205294 | Ga0501072_0205294_293_805 | 170 |
| 413 | 3300049588 | Ga0501072_0620448 | Ga0501072_0620448_54_569 | 170 |
| 414 | 3300049590 | Ga0501074_0057226 | Ga0501074_0057226_19_534 | 170 |
| 415 | 3300049590 | Ga0501074_0836872 | Ga0501074_0836872_40_552 | 170 |
| 416 | 3300049591 | Ga0501075_0016140 | Ga0501075_0016140_954_1466 | 170 |
| 417 | 3300049591 | Ga0501075_0025261 | Ga0501075_0025261_3058_3573 | 170 |
| 418 | 3300049591 | Ga0501075_0304239 | Ga0501075_0304239_612_1127 | 170 |
| 419 | 3300049592 | Ga0501076_0002349 | Ga0501076_0002349_3959_4471 | 170 |
| 420 | 3300049592 | Ga0501076_0017306 | Ga0501076_0017306_1977_2489 | 170 |
| 421 | 3300049592 | Ga0501076_0052814 | Ga0501076_0052814_2366_2881 | 170 |
| 422 | 3300049593 | Ga0501077_0033000 | Ga0501077_0033000_300_815 | 170 |
| 423 | 3300049593 | Ga0501077_0657962 | Ga0501077_0657962_53_568 | 170 |
| 424 | 3300049655 | Ga0501208_130984 | Ga0501208_130984_23_538 | 170 |
| 425 | 3300049658 | Ga0501211_004634 | Ga0501211_004634_678_1232 | 170 |
| 426 | 3300049661 | Ga0501217_080814 | Ga0501217_080814_323_838 | 170 |
| 427 | 3300049668 | Ga0501233_080764 | Ga0501233_080764_86_640 | 170 |
| 428 | 3300049676 | Ga0501246_006699 | Ga0501246_006699_316_831 | 170 |
| 429 | 3300049690 | Ga0501261_008614 | Ga0501261_008614_486_1001 | 170 |
| 430 | 3300049741 | Ga0501079_0121992 | Ga0501079_0121992_476_988 | 170 |
| 431 | 3300049742 | Ga0501080_0046088 | Ga0501080_0046088_569_1084 | 170 |
| 432 | 3300049743 | Ga0501081_0047734 | Ga0501081_0047734_601_1113 | 170 |
| 433 | 3300049767 | Ga0501270_017764 | Ga0501270_017764_348_872 | 170 |
| 434 | 3300049779 | Ga0501283_037067 | Ga0501283_037067_175_690 | 170 |
| 435 | 3300049822 | Ga0501035_0621703 | Ga0501035_0621703_328_840 | 170 |
| 436 | 3300049823 | Ga0501044_0790490 | Ga0501044_0790490_141_653 | 170 |
| 437 | 3300049824 | Ga0501045_0003977 | Ga0501045_0003977_2798_3310 | 170 |
| 438 | 3300049824 | Ga0501045_0203817 | Ga0501045_0203817_674_1189 | 170 |
| 439 | 3300050507 | nmdc:mga05p37_1981_c1 | nmdc:mga05p37_1981_c1_6193_6708 | 170 |
| 440 | 3300050507 | nmdc:mga05p37_2447_c1 | nmdc:mga05p37_2447_c1_11032_11547 | 170 |
| 441 | 3300050507 | nmdc:mga05p37_8178_c1 | nmdc:mga05p37_8178_c1_1817_2332 | 170 |
| 442 | 3300050508 | nmdc:mga09592_316841_c1 | nmdc:mga09592_316841_c1_738_1250 | 170 |
| 443 | 3300050508 | nmdc:mga09592_55588_c1 | nmdc:mga09592_55588_c1_2648_3163 | 170 |
| 444 | 3300050509 | nmdc:mga0qj67_5153_c1 | nmdc:mga0qj67_5153_c1_5584_6099 | 170 |
| 445 | 3300050509 | nmdc:mga0qj67_726744_c1 | nmdc:mga0qj67_726744_c1_246_761 | 170 |
| 446 | 3300050509 | nmdc:mga0qj67_76380_c1 | nmdc:mga0qj67_76380_c1_1188_1703 | 170 |
| 447 | 3300050510 | nmdc:mga06r32_156746_c1 | nmdc:mga06r32_156746_c1_997_1509 | 170 |
| 448 | 3300050510 | nmdc:mga06r32_1592340_c1 | nmdc:mga06r32_1592340_c1_53_565 | 170 |
| 449 | 3300050510 | nmdc:mga06r32_9552_c1 | nmdc:mga06r32_9552_c1_6088_6603 | 170 |
| 450 | 3300050511 | nmdc:mga08y16_1150799_c1 | nmdc:mga08y16_1150799_c1_175_690 | 170 |
| 451 | 3300050511 | nmdc:mga08y16_3529_c1 | nmdc:mga08y16_3529_c1_4297_4812 | 170 |
| 452 | 3300050511 | nmdc:mga08y16_408326_c1 | nmdc:mga08y16_408326_c1_585_1100 | 170 |
| 453 | 3300050511 | nmdc:mga08y16_52143_c1 | nmdc:mga08y16_52143_c1_539_1057 | 170 |
| 454 | 3300050512 | nmdc:mga0n895_376660_c1 | nmdc:mga0n895_376660_c1_424_945 | 170 |
| 455 | 3300050515 | nmdc:mga0a205_18629_c1 | nmdc:mga0a205_18629_c1_5734_6249 | 170 |
| 456 | 3300054114 | Ga0501084_0012966 | Ga0501084_0012966_2610_3122 | 170 |
| 457 | 3300054114 | Ga0501084_0228904 | Ga0501084_0228904_1017_1532 | 170 |
| 458 | 3300054114 | Ga0501084_0710714 | Ga0501084_0710714_256_768 | 170 |
| 459 | 3300059421 | Ga0590071_057838 | Ga0590071_057838_392_913 | 170 |
| 460 | 3300059426 | Ga0590077_000256 | Ga0590077_000256_14345_14863 | 170 |
| 461 | 3300060353 | Ga0501082_0074604 | Ga0501082_0074604_1728_2243 | 170 |
| 462 | 3300060353 | Ga0501082_0084295 | Ga0501082_0084295_75_587 | 170 |
| 463 | 3300061734 | Ga0530510_0004651 | Ga0530510_0004651_8409_8921 | 170 |
| 464 | 3300061734 | Ga0530510_0487647 | Ga0530510_0487647_241_756 | 170 |
| 465 | 3300002073 | JGI24745J21846_1016045 | JGI24745J21846_10160451 | 171 |
| 466 | 3300002126 | JGI24035J26624_1009355 | JGI24035J26624_10093551 | 171 |
| 467 | 3300003203 | JGI25406J46586_10120242 | JGI25406J46586_101202422 | 171 |
| 468 | 3300005288 | Ga0065714_10072204 | Ga0065714_100722043 | 171 |
| 469 | 3300005289 | Ga0065704_10005852 | Ga0065704_100058522 | 171 |
| 470 | 3300005290 | Ga0065712_10018740 | Ga0065712_100187403 | 171 |
| 471 | 3300005290 | Ga0065712_10087888 | Ga0065712_100878881 | 171 |
| 472 | 3300005290 | Ga0065712_10406397 | Ga0065712_104063972 | 171 |
| 473 | 3300005293 | Ga0065715_10009247 | Ga0065715_100092473 | 171 |
| 474 | 3300005293 | Ga0065715_10105744 | Ga0065715_101057443 | 171 |
| 475 | 3300005293 | Ga0065715_10462750 | Ga0065715_104627502 | 171 |
| 476 | 3300005295 | Ga0065707_10103611 | Ga0065707_101036113 | 171 |
| 477 | 3300005329 | Ga0070683_100000094 | Ga0070683_1000000949 | 171 |
| 478 | 3300005329 | Ga0070683_100103115 | Ga0070683_1001031153 | 171 |
| 479 | 3300005331 | Ga0070670_100029410 | Ga0070670_1000294103 | 171 |
| 480 | 3300005331 | Ga0070670_100047811 | Ga0070670_1000478113 | 171 |
| 481 | 3300005331 | Ga0070670_100674048 | Ga0070670_1006740482 | 171 |
| 482 | 3300005333 | Ga0070677_10320386 | Ga0070677_103203861 | 171 |
| 483 | 3300005335 | Ga0070666_10528333 | Ga0070666_105283331 | 171 |
| 484 | 3300005336 | Ga0070680_100259809 | Ga0070680_1002598092 | 171 |
| 485 | 3300005337 | Ga0070682_100213800 | Ga0070682_1002138001 | 171 |
| 486 | 3300005339 | Ga0070660_100265946 | Ga0070660_1002659461 | 171 |
| 487 | 3300005344 | Ga0070661_100016313 | Ga0070661_1000163133 | 171 |
| 488 | 3300005344 | Ga0070661_100169844 | Ga0070661_1001698443 | 171 |
| 489 | 3300005347 | Ga0070668_100367769 | Ga0070668_1003677692 | 171 |
| 490 | 3300005353 | Ga0070669_100005170 | Ga0070669_1000051706 | 171 |
| 491 | 3300005353 | Ga0070669_100351989 | Ga0070669_1003519892 | 171 |
| 492 | 3300005354 | Ga0070675_100041683 | Ga0070675_1000416834 | 171 |
| 493 | 3300005354 | Ga0070675_100386547 | Ga0070675_1003865471 | 171 |
| 494 | 3300005354 | Ga0070675_100397586 | Ga0070675_1003975862 | 171 |
| 495 | 3300005354 | Ga0070675_100398057 | Ga0070675_1003980573 | 171 |
| 496 | 3300005355 | Ga0070671_100050359 | Ga0070671_1000503593 | 171 |
| 497 | 3300005355 | Ga0070671_100437696 | Ga0070671_1004376962 | 171 |
| 498 | 3300005364 | Ga0070673_100581237 | Ga0070673_1005812372 | 171 |
| 499 | 3300005365 | Ga0070688_100050003 | Ga0070688_1000500033 | 171 |
| 500 | 3300005367 | Ga0070667_100943757 | Ga0070667_1009437571 | 171 |
| 501 | 3300005444 | Ga0070694_100738971 | Ga0070694_1007389712 | 171 |
| 502 | 3300005456 | Ga0070678_100132984 | Ga0070678_1001329842 | 171 |
| 503 | 3300005471 | Ga0070698_100034849 | Ga0070698_1000348492 | 171 |
| 504 | 3300005518 | Ga0070699_100001266 | Ga0070699_10000126610 | 171 |
| 505 | 3300005535 | Ga0070684_100000166 | Ga0070684_10000016634 | 171 |
| 506 | 3300005535 | Ga0070684_100506079 | Ga0070684_1005060792 | 171 |
| 507 | 3300005543 | Ga0070672_100197870 | Ga0070672_1001978702 | 171 |
| 508 | 3300005543 | Ga0070672_100304866 | Ga0070672_1003048662 | 171 |
| 509 | 3300005543 | Ga0070672_100382132 | Ga0070672_1003821322 | 171 |
| 510 | 3300005543 | Ga0070672_100557131 | Ga0070672_1005571312 | 171 |
| 511 | 3300005544 | Ga0070686_100386376 | Ga0070686_1003863763 | 171 |
| 512 | 3300005545 | Ga0070695_100072900 | Ga0070695_1000729003 | 171 |
| 513 | 3300005546 | Ga0070696_100215415 | Ga0070696_1002154152 | 171 |
| 514 | 3300005546 | Ga0070696_100540765 | Ga0070696_1005407652 | 171 |
| 515 | 3300005549 | Ga0070704_100030216 | Ga0070704_1000302162 | 171 |
| 516 | 3300005564 | Ga0070664_100009365 | Ga0070664_1000093656 | 171 |
| 517 | 3300005564 | Ga0070664_100128339 | Ga0070664_1001283392 | 171 |
| 518 | 3300005564 | Ga0070664_100716256 | Ga0070664_1007162562 | 171 |
| 519 | 3300005618 | Ga0068864_101170761 | Ga0068864_1011707612 | 171 |
| 520 | 3300005844 | Ga0068862_100035412 | Ga0068862_1000354124 | 171 |
| 521 | 3300005844 | Ga0068862_100557333 | Ga0068862_1005573332 | 171 |
| 522 | 3300005985 | Ga0081539_10040561 | Ga0081539_100405613 | 171 |
| 523 | 3300006178 | Ga0075367_10100255 | Ga0075367_101002552 | 171 |
| 524 | 3300006353 | Ga0075370_10100482 | Ga0075370_101004823 | 171 |
| 525 | 3300006844 | Ga0075428_100073237 | Ga0075428_1000732374 | 171 |
| 526 | 3300006846 | Ga0075430_100020871 | Ga0075430_1000208714 | 171 |
| 527 | 3300006852 | Ga0075433_10090367 | Ga0075433_100903672 | 171 |
| 528 | 3300006852 | Ga0075433_10125663 | Ga0075433_101256633 | 171 |
| 529 | 3300006852 | Ga0075433_10553867 | Ga0075433_105538672 | 171 |
| 530 | 3300009094 | Ga0111539_10008348 | Ga0111539_100083489 | 171 |
| 531 | 3300009147 | Ga0114129_10055131 | Ga0114129_100551313 | 171 |
| 532 | 3300009148 | Ga0105243_11554325 | Ga0105243_115543251 | 171 |
| 533 | 3300009177 | Ga0105248_10221608 | Ga0105248_102216084 | 171 |
| 534 | 3300009553 | Ga0105249_10116358 | Ga0105249_101163582 | 171 |
| 535 | 3300013306 | Ga0163162_10008950 | Ga0163162_100089509 | 171 |
| 536 | 3300013306 | Ga0163162_10841242 | Ga0163162_108412422 | 171 |
| 537 | 3300014325 | Ga0163163_10030417 | Ga0163163_100304174 | 171 |
| 538 | 3300014325 | Ga0163163_10304756 | Ga0163163_103047563 | 171 |
| 539 | 3300014326 | Ga0157380_11152707 | Ga0157380_111527072 | 171 |
| 540 | 3300014745 | Ga0157377_10041220 | Ga0157377_100412202 | 171 |
| 541 | 3300014969 | Ga0157376_10904952 | Ga0157376_109049521 | 171 |
| 542 | 3300025271 | Ga0207666_1040252 | Ga0207666_10402521 | 171 |
| 543 | 3300025315 | Ga0207697_10000717 | Ga0207697_100007176 | 171 |
| 544 | 3300025901 | Ga0207688_10001322 | Ga0207688_1000132213 | 171 |
| 545 | 3300025903 | Ga0207680_10093459 | Ga0207680_100934591 | 171 |
| 546 | 3300025903 | Ga0207680_10330409 | Ga0207680_103304092 | 171 |
| 547 | 3300025908 | Ga0207643_10106690 | Ga0207643_101066902 | 171 |
| 548 | 3300025909 | Ga0207705_10779332 | Ga0207705_107793322 | 171 |
| 549 | 3300025919 | Ga0207657_10649472 | Ga0207657_106494722 | 171 |
| 550 | 3300025920 | Ga0207649_10021247 | Ga0207649_100212473 | 171 |
| 551 | 3300025920 | Ga0207649_10862147 | Ga0207649_108621471 | 171 |
| 552 | 3300025923 | Ga0207681_10003863 | Ga0207681_100038634 | 171 |
| 553 | 3300025925 | Ga0207650_10016257 | Ga0207650_100162573 | 171 |
| 554 | 3300025925 | Ga0207650_10077153 | Ga0207650_100771532 | 171 |
| 555 | 3300025925 | Ga0207650_10260187 | Ga0207650_102601872 | 171 |
| 556 | 3300025926 | Ga0207659_10028324 | Ga0207659_100283242 | 171 |
| 557 | 3300025926 | Ga0207659_10055057 | Ga0207659_100550573 | 171 |
| 558 | 3300025926 | Ga0207659_10095935 | Ga0207659_100959353 | 171 |
| 559 | 3300025931 | Ga0207644_10052792 | Ga0207644_100527923 | 171 |
| 560 | 3300025931 | Ga0207644_10455445 | Ga0207644_104554452 | 171 |
| 561 | 3300025940 | Ga0207691_10149718 | Ga0207691_101497182 | 171 |
| 562 | 3300025940 | Ga0207691_10211982 | Ga0207691_102119822 | 171 |
| 563 | 3300025940 | Ga0207691_10547518 | Ga0207691_105475181 | 171 |
| 564 | 3300025941 | Ga0207711_10120457 | Ga0207711_101204573 | 171 |
| 565 | 3300025944 | Ga0207661_10020111 | Ga0207661_100201111 | 171 |
| 566 | 3300025944 | Ga0207661_10108572 | Ga0207661_101085722 | 171 |
| 567 | 3300025945 | Ga0207679_10005801 | Ga0207679_100058015 | 171 |
| 568 | 3300025945 | Ga0207679_10641560 | Ga0207679_106415602 | 171 |
| 569 | 3300025960 | Ga0207651_10187694 | Ga0207651_101876942 | 171 |
| 570 | 3300025961 | Ga0207712_10004344 | Ga0207712_100043446 | 171 |
| 571 | 3300025972 | Ga0207668_10270489 | Ga0207668_102704892 | 171 |
| 572 | 3300025981 | Ga0207640_10267345 | Ga0207640_102673451 | 171 |
| 573 | 3300025986 | Ga0207658_10857419 | Ga0207658_108574192 | 171 |
| 574 | 3300026075 | Ga0207708_10067174 | Ga0207708_100671743 | 171 |
| 575 | 3300026075 | Ga0207708_10744203 | Ga0207708_107442032 | 171 |
| 576 | 3300026088 | Ga0207641_11385543 | Ga0207641_113855432 | 171 |
| 577 | 3300026095 | Ga0207676_10159926 | Ga0207676_101599262 | 171 |
| 578 | 3300026118 | Ga0207675_101233964 | Ga0207675_1012339641 | 171 |
| 579 | 3300026121 | Ga0207683_10055481 | Ga0207683_100554813 | 171 |
| 580 | 3300027717 | Ga0209998_10046096 | Ga0209998_100460962 | 171 |
| 581 | 3300027907 | Ga0207428_10012687 | Ga0207428_100126873 | 171 |
| 582 | 3300028380 | Ga0268265_10018118 | Ga0268265_100181182 | 171 |
| 583 | 3300028380 | Ga0268265_10545157 | Ga0268265_105451573 | 171 |
| 584 | 3300031548 | Ga0307408_100030568 | Ga0307408_1000305684 | 171 |
| 585 | 3300031548 | Ga0307408_101103814 | Ga0307408_1011038142 | 171 |
| 586 | 3300031852 | Ga0307410_10187188 | Ga0307410_101871882 | 171 |
| 587 | 3300031901 | Ga0307406_10534429 | Ga0307406_105344292 | 171 |
| 588 | 3300031903 | Ga0307407_10488159 | Ga0307407_104881592 | 171 |
| 589 | 3300031995 | Ga0307409_100016611 | Ga0307409_1000166113 | 171 |
| 590 | 3300032002 | Ga0307416_100107948 | Ga0307416_1001079483 | 171 |
| 591 | 3300032004 | Ga0307414_10065988 | Ga0307414_100659883 | 171 |
| 592 | 3300032004 | Ga0307414_10499577 | Ga0307414_104995773 | 171 |
| 593 | 3300032005 | Ga0307411_10573462 | Ga0307411_105734622 | 171 |
| 594 | 3300032126 | Ga0307415_100679630 | Ga0307415_1006796302 | 171 |
| 595 | 3300035691 | Ga0373931_0909359 | Ga0373931_0909359_15_533 | 171 |
| 596 | 3300042122 | Ga0450920_039900 | Ga0450920_039900_85_603 | 171 |
| 597 | 3300042133 | Ga0450896_026488 | Ga0450896_026488_118_645 | 171 |
| 598 | 3300042156 | Ga0439446_0018579 | Ga0439446_0018579_1331_1849 | 171 |
| 599 | 3300042437 | Ga0439444_0067247 | Ga0439444_0067247_137_655 | 171 |
| 600 | 3300042439 | Ga0439464_0090786 | Ga0439464_0090786_311_844 | 171 |
| 601 | 3300042461 | Ga0439460_0026127 | Ga0439460_0026127_417_950 | 171 |
| 602 | 3300046536 | Ga0495587_0475331 | Ga0495587_0475331_106_636 | 171 |
| 603 | 3300046537 | Ga0495598_0040628 | Ga0495598_0040628_33_569 | 171 |
| 604 | 3300046664 | Ga0495659_0021490 | Ga0495659_0021490_645_1181 | 171 |
| 605 | 3300046809 | Ga0495600_0117828 | Ga0495600_0117828_201_731 | 171 |
| 606 | 3300047471 | Ga0495684_0273969 | Ga0495684_0273969_145_675 | 171 |
| 607 | 3300048904 | Ga0496101_0601485 | Ga0496101_0601485_95_613 | 171 |
| 608 | 3300048907 | Ga0496104_0265287 | Ga0496104_0265287_643_1158 | 171 |
| 609 | 3300048908 | Ga0496105_0339869 | Ga0496105_0339869_586_1104 | 171 |
| 610 | 3300048911 | Ga0496108_0050479 | Ga0496108_0050479_1008_1526 | 171 |
| 611 | 3300048912 | Ga0496109_0018373 | Ga0496109_0018373_1869_2387 | 171 |
| 612 | 3300048913 | Ga0496110_0011815 | Ga0496110_0011815_2665_3183 | 171 |
| 613 | 3300048914 | Ga0496111_0012097 | Ga0496111_0012097_239_757 | 171 |
| 614 | 3300048914 | Ga0496111_0088437 | Ga0496111_0088437_1204_1719 | 171 |
| 615 | 3300048915 | Ga0496112_0003634 | Ga0496112_0003634_5691_6209 | 171 |
| 616 | 3300048916 | Ga0496113_0212734 | Ga0496113_0212734_369_887 | 171 |
| 617 | 3300048917 | Ga0496114_0710662 | Ga0496114_0710662_235_768 | 171 |
| 618 | 3300048918 | Ga0496115_0520649 | Ga0496115_0520649_258_791 | 171 |
| 619 | 3300049576 | Ga0501040_0568752 | Ga0501040_0568752_97_630 | 171 |
| 620 | 3300049583 | Ga0501067_0086419 | Ga0501067_0086419_597_1130 | 171 |
| 621 | 3300049584 | Ga0501068_0582052 | Ga0501068_0582052_95_628 | 171 |
| 622 | 3300049591 | Ga0501075_0137163 | Ga0501075_0137163_140_673 | 171 |
| 623 | 3300049592 | Ga0501076_1054189 | Ga0501076_1054189_15_548 | 171 |
| 624 | 3300049705 | Ga0501225_0205906 | Ga0501225_0205906_84_602 | 171 |
| 625 | 3300050493 | nmdc:mga0k408_369372_c1 | nmdc:mga0k408_369372_c1_320_844 | 171 |
| 626 | 3300050494 | nmdc:mga06z11_167416_c1 | nmdc:mga06z11_167416_c1_222_746 | 171 |
| 627 | 3300050495 | nmdc:mga04h51_15505_c1 | nmdc:mga04h51_15505_c1_575_1099 | 171 |
| 628 | 3300050507 | nmdc:mga05p37_36837_c2 | nmdc:mga05p37_36837_c2_3048_3566 | 171 |
| 629 | 3300050508 | nmdc:mga09592_866322_c1 | nmdc:mga09592_866322_c1_122_724 | 171 |
| 630 | 3300050509 | nmdc:mga0qj67_19983_c1 | nmdc:mga0qj67_19983_c1_2168_2701 | 171 |
| 631 | 3300050510 | nmdc:mga06r32_13185_c1 | nmdc:mga06r32_13185_c1_5486_6019 | 171 |
| 632 | 3300050510 | nmdc:mga06r32_324008_c1 | nmdc:mga06r32_324008_c1_149_682 | 171 |
| 633 | 3300050511 | nmdc:mga08y16_109057_c1 | nmdc:mga08y16_109057_c1_412_930 | 171 |
| 634 | 3300050511 | nmdc:mga08y16_17529_c1 | nmdc:mga08y16_17529_c1_6572_7090 | 171 |
| 635 | 3300050512 | nmdc:mga0n895_5943_c1 | nmdc:mga0n895_5943_c1_9493_10011 | 171 |
| 636 | 3300050515 | nmdc:mga0a205_18430_c1 | nmdc:mga0a205_18430_c1_1055_1573 | 171 |
| 637 | 3300050515 | nmdc:mga0a205_74704_c1 | nmdc:mga0a205_74704_c1_2671_3192 | 171 |
| 638 | 3300050515 | nmdc:mga0a205_82233_c1 | nmdc:mga0a205_82233_c1_1817_2335 | 171 |
| 639 | 3300053077 | Ga0495601_0469590 | Ga0495601_0469590_56_586 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l8f-assembly1.cif.gz_C | crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a, e62a, h65a. | 0.9893 | 2 | 48 |
| 5l8b-assembly2.cif.gz_Q | crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a | 0.9892 | 2 | 48 |
| 5l8b-assembly1.cif.gz_E | crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a | 0.988 | 2 | 48 |
| 5l8b-assembly4.cif.gz_a | crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a | 0.9868 | 2 | 48 |
| 5l8b-assembly1.cif.gz_J | crystal structure of rhodospirillum rubrum rru_a0973 mutant e62a | 0.9863 | 2 | 48 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5l8bX00 | Special;Helix non-globular;Helix Hairpins; | 0.9877 | 2 | 48 | 6.10.140.1960 |
| 5l8bP00 | Special;Helix non-globular;Helix Hairpins; | 0.9872 | 2 | 48 | 6.10.140.1960 |
| 5l8fA00 | Special;Helix non-globular;Helix Hairpins; | 0.9869 | 2 | 48 | 6.10.140.1960 |
| 5l8ba00 | Special;Helix non-globular;Helix Hairpins; | 0.9868 | 2 | 48 | 6.10.140.1960 |
| 5l8gQ00 | Special;Helix non-globular;Helix Hairpins; | 0.9848 | 2 | 48 | 6.10.140.1960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G2JYV0-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.9753 | 1 | 60 |
GO:0005886
GO:0008137 GO:0048038 |
| AF-A0A526ZEA5-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.9629 | 2 | 60 |
GO:0005886
GO:0008137 GO:0048038 |
| AF-A0A2G2JYV0-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.9598 | 1 | 60 |
GO:0005886
GO:0008137 GO:0048038 |
| AF-A0A355SYS2-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.9585 | 2 | 60 |
GO:0005886
GO:0008137 GO:0048038 |
| AF-A0A257VTF4-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.9165 | 1 | 70 |
GO:0005886
GO:0008137 GO:0048038 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar