F471647

General Info

Members Datasets Scaffolds Average Seq Length
639 333 618 326

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_001221|Ga0500643_001221_3059_4111
Length 350
Sequence MDVDRRLHHAPDDQFQDLTAMEHQVTPHFIQTLISIGLALATTIVILILGASLVRNMGRDPMARRVKALNDRREQLKAGVAASKTRRRAKQEKKSVSTVRMRKFLQALKMLQDSQLKVAQLNLSRAGIRTKDTAITVIFCRLVGPVLIGGTMVLGVYVLNWFPEAGPLKRYMIVAASLLLSYKGPDIFVKNLITKRQVAIRRGLPDALDLLVICAEAGLTVDMAFNRVSRELGKAYPELGDEFSLTAIELGFLTDRRMAFDNLAQRANIDAIRDVVTTMIQTEKYGTPLAAALRTLSADFRHTRMMKAEEKAARLPAIMTVPLILFILPVLFIVILGPAACSIKDHVLKG

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
8 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
9 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
10 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
11 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
12 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
13 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
14 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
15 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
16 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
17 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
18 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
19 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
20 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
21 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
22 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
29 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
32 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
33 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
34 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
107 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
122 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
222 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
229 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
285 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
286 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
287 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
288 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
289 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
294 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
295 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
296 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
297 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
298 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
301 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
302 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
305 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
306 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
307 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
315 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
316 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
319 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
320 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
321 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0.47
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 15.34
Nodule 0
Rhizoplane 2.35
Rhizosphere 73.4
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c001007 3300000041 Bacteria 3006
2 JGI24736J21556_1000278 3300001904 Bacteria 9373
3 JGI24736J21556_1000502 3300001904 Bacteria 7288
4 JGI24741J21665_1000107 3300001915 Bacteria 22051
5 JGI24741J21665_1001457 3300001915 Bacteria 6775
6 JGI24741J21665_1009791 3300001915 Bacteria 1744
7 JGI24740J21852_10001479 3300001979 Bacteria 10791
8 JGI24740J21852_10009011 3300001979 Bacteria 3934
9 JGI24740J21852_10009375 3300001979 Bacteria 3836
10 JGI24740J21852_10037438 3300001979 Bacteria 1498
11 JGI24739J22299_10005370 3300001989 Bacteria 4878
12 JGI24739J22299_10007049 3300001989 Bacteria 4229
13 JGI24737J22298_10002879 3300001990 Bacteria 6104
14 JGI24737J22298_10004084 3300001990 Bacteria 5098
15 JGI24737J22298_10034203 3300001990 Bacteria 1576
16 JGI24737J22298_10058939 3300001990 Bacteria 1157
17 JGI24735J21928_10003861 3300002067 Bacteria 5072
18 JGI24735J21928_10004443 3300002067 Bacteria 4716
19 JGI24735J21928_10020838 3300002067 Bacteria 2006
20 JGI24735J21928_10042522 3300002067 Bacteria 1323
21 JGI24750J21931_1000228 3300002070 Bacteria 9572
22 JGI24748J21848_1000062 3300002074 Bacteria 40740
23 JGI24738J21930_10000825 3300002075 Bacteria 8869
24 JGI24738J21930_10001993 3300002075 Bacteria 5489
25 JGI24749J21850_1001345 3300002076 Bacteria 3488
26 JGI24034J26672_10000028 3300002239 Bacteria 105058
27 JGI25150J39212_1000096 3300002774 Bacteria 50476
28 JGI25151J46595_10014451 3300003187 Bacteria 3515
29 JGI25165J46597_1000021 3300003214 Bacteria 359288
30 JGI25165J46597_1000173 3300003214 Bacteria 100834
31 JGI25153J46596_10000021 3300003215 Bacteria 252651
32 JGI25153J46596_10000028 3300003215 Bacteria 209842
33 Ga0055525_1000070 3300003759 Bacteria 183047
34 Ga0055542_1000102 3300003762 Bacteria 115614
35 Ga0055529_1000136 3300003763 Bacteria 104102
36 Ga0055537_1001305 3300003773 Bacteria 10227
37 Ga0055537_1001847 3300003773 Bacteria 7645
38 Ga0055524_1000335 3300003775 Bacteria 43434
39 Ga0055536_1002813 3300003781 Bacteria 9601
40 Ga0055530_10000270 3300003791 Bacteria 46941
41 Ga0055540_1002865 3300003792 Bacteria 8763
42 Ga0055531_10000371 3300003794 Bacteria 43284
43 Ga0055531_10004998 3300003794 Bacteria 7866
44 Ga0065165_1001326 3300005262 Bacteria 27536
45 Ga0065165_1003242 3300005262 Bacteria 11791
46 Ga0065704_10086168 3300005289 Bacteria 3147
47 Ga0065704_10122327 3300005289 Bacteria 1741
48 Ga0065707_10116834 3300005295 Bacteria 2226
49 Ga0065707_10120781 3300005295 Bacteria 2125
50 Ga0065707_10158556 3300005295 Bacteria 1585
51 Ga0070658_10000611 3300005327 Bacteria 30913
52 Ga0070658_10000967 3300005327 Bacteria 24637
53 Ga0070658_10068159 3300005327 Bacteria 2908
54 Ga0070676_10000029 3300005328 Bacteria 43536
55 Ga0070690_100000003 3300005330 Bacteria 144748
56 Ga0070670_100000209 3300005331 Bacteria 54253
57 Ga0070670_100008607 3300005331 Bacteria 8707
58 Ga0068869_100001320 3300005334 Bacteria 14687
59 Ga0070666_10000006 3300005335 Bacteria 319173
60 Ga0068868_100000139 3300005338 Bacteria 46645
61 Ga0068868_100027515 3300005338 Bacteria 4339
62 Ga0070660_100000692 3300005339 Bacteria 22324
63 Ga0070660_100002653 3300005339 Bacteria 12288
64 Ga0070660_100017257 3300005339 Bacteria 5259
65 Ga0070661_100072177 3300005344 Bacteria 2540
66 Ga0070661_100072734 3300005344 Bacteria 2530
67 Ga0070661_100159803 3300005344 Bacteria 1706
68 Ga0070668_100000028 3300005347 Bacteria 89707
69 Ga0070668_100000993 3300005347 Bacteria 19904
70 Ga0070668_100043344 3300005347 Bacteria 3451
71 Ga0070668_100081706 3300005347 Bacteria 2534
72 Ga0070669_100001833 3300005353 Bacteria 15325
73 Ga0070669_100037973 3300005353 Bacteria 3495
74 Ga0070669_100059756 3300005353 Bacteria 2799
75 Ga0070669_100157572 3300005353 Bacteria 1762
76 Ga0070671_100000750 3300005355 Bacteria 23268
77 Ga0070671_100136506 3300005355 Bacteria 2068
78 Ga0070674_100002600 3300005356 Bacteria 9991
79 Ga0070673_100000013 3300005364 Bacteria 137021
80 Ga0070688_100002243 3300005365 Bacteria 9748
81 Ga0070659_100092389 3300005366 Bacteria 2426
82 Ga0070667_100000016 3300005367 Bacteria 237028
83 Ga0070667_100000127 3300005367 Bacteria 95853
84 Ga0070667_100000199 3300005367 Bacteria 71115
85 Ga0070667_100012288 3300005367 Bacteria 7083
86 Ga0070667_100082230 3300005367 Bacteria 2757
87 Ga0070667_100281697 3300005367 Bacteria 1493
88 Ga0070667_100381647 3300005367 Bacteria 1280
89 Ga0070663_100001752 3300005455 Bacteria 12072
90 Ga0070663_100057355 3300005455 Bacteria 2793
91 Ga0070678_100000175 3300005456 Bacteria 27570
92 Ga0070678_100003484 3300005456 Bacteria 8769
93 Ga0070662_100198543 3300005457 Bacteria 1590
94 Ga0070662_100240974 3300005457 Bacteria 1450
95 Ga0068867_100000009 3300005459 Bacteria 137021
96 Ga0068867_100013678 3300005459 Bacteria 5747
97 Ga0070685_10000072 3300005466 Bacteria 59953
98 Ga0068853_100000819 3300005539 Bacteria 21710
99 Ga0068853_100141762 3300005539 Bacteria 2158
100 Ga0070672_100117950 3300005543 Bacteria 2170
101 Ga0070686_100000022 3300005544 Bacteria 131168
102 Ga0070693_100154324 3300005547 Bacteria 1457
103 Ga0070665_100000019 3300005548 Bacteria 413972
104 Ga0070665_100000021 3300005548 Bacteria 389668
105 Ga0070665_100104964 3300005548 Bacteria 2828
106 Ga0070665_100416648 3300005548 Bacteria 1352
107 Ga0068855_100178788 3300005563 Bacteria 2400
108 Ga0068857_100019321 3300005577 Bacteria 5981
109 Ga0068857_100218684 3300005577 Bacteria 1739
110 Ga0068856_100028579 3300005614 Bacteria 5445
111 Ga0068859_100020455 3300005617 Bacteria 6642
112 Ga0068859_100062524 3300005617 Bacteria 3753
113 Ga0068864_100000062 3300005618 Bacteria 121206
114 Ga0068864_100001277 3300005618 Bacteria 20922
115 Ga0068864_100022260 3300005618 Bacteria 5313
116 Ga0068861_100000061 3300005719 Bacteria 51630
117 Ga0068851_10015119 3300005834 Bacteria 3674
118 Ga0068851_10015156 3300005834 Bacteria 3669
119 Ga0068863_100000029 3300005841 Bacteria 177191
120 Ga0068863_100000048 3300005841 Bacteria 135912
121 Ga0068863_100000064 3300005841 Bacteria 118153
122 Ga0068863_100000092 3300005841 Bacteria 97076
123 Ga0068863_100008963 3300005841 Bacteria 9770
124 Ga0068858_100000414 3300005842 Bacteria 44330
125 Ga0068858_100003008 3300005842 Bacteria 16905
126 Ga0068858_100007591 3300005842 Bacteria 10479
127 Ga0068860_100000014 3300005843 Bacteria 319437
128 Ga0068860_100000196 3300005843 Bacteria 97096
129 Ga0068860_100002353 3300005843 Bacteria 19855
130 Ga0068860_100012465 3300005843 Bacteria 8372
131 Ga0068862_100000079 3300005844 Bacteria 113551
132 Ga0068862_100000149 3300005844 Bacteria 79784
133 Ga0068862_100000613 3300005844 Bacteria 37071
134 Ga0068862_100053430 3300005844 Bacteria 3458
135 Ga0081455_10000175 3300005937 Bacteria 80027
136 Ga0081539_10019897 3300005985 Bacteria 4570
137 Ga0075368_10001402 3300006042 Bacteria 7693
138 Ga0075367_10000205 3300006178 Bacteria 19719
139 Ga0075367_10162903 3300006178 Bacteria 1387
140 Ga0075369_10021312 3300006186 Bacteria 2661
141 Ga0068865_100000005 3300006881 Bacteria 213248
142 Ga0097620_100020455 3300006931 Bacteria 6642
143 Ga0097620_100045333 3300006931 Bacteria 4418
144 Ga0097620_100062523 3300006931 Bacteria 3753
145 Ga0105251_10000625 3300009011 Bacteria 32540
146 Ga0105245_10000244 3300009098 Bacteria 52007
147 Ga0105245_10013346 3300009098 Bacteria 7158
148 Ga0105247_10007007 3300009101 Bacteria 6937
149 Ga0105243_10000032 3300009148 Bacteria 183324
150 Ga0105243_10000222 3300009148 Bacteria 65448
151 Ga0105243_10080635 3300009148 Bacteria 2655
152 Ga0105241_10002643 3300009174 Bacteria 13422
153 Ga0105241_10003710 3300009174 Bacteria 11344
154 Ga0105242_10000166 3300009176 Bacteria 49832
155 Ga0105242_10506303 3300009176 Bacteria 1149
156 Ga0105248_10000014 3300009177 Bacteria 324729
157 Ga0105248_10006249 3300009177 Bacteria 13060
158 Ga0105248_10095109 3300009177 Bacteria 3354
159 Ga0105248_10099258 3300009177 Bacteria 3281
160 Ga0105238_10043952 3300009551 Bacteria 4519
161 Ga0105238_10257937 3300009551 Bacteria 1723
162 Ga0105249_10000056 3300009553 Bacteria 160443
163 Ga0105249_10000104 3300009553 Bacteria 118213
164 Ga0105249_10001836 3300009553 Bacteria 18458
165 Ga0105249_10002730 3300009553 Bacteria 15266
166 Ga0105249_10016580 3300009553 Bacteria 6538
167 Ga0105249_10100916 3300009553 Bacteria 2714
168 Ga0105148_100043 3300009978 Bacteria 18692
169 Ga0105239_10080033 3300010375 Bacteria 3595
170 Ga0105246_10008273 3300011119 Bacteria 6389
171 Ga0157327_1001315 3300012512 Bacteria 1533
172 Ga0157326_1003975 3300012513 Bacteria 1554
173 Ga0157373_10066776 3300013100 Bacteria 2543
174 Ga0157373_10141361 3300013100 Bacteria 1693
175 Ga0157373_10190886 3300013100 Bacteria 1444
176 Ga0157371_10000066 3300013102 Bacteria 168406
177 Ga0157371_10020886 3300013102 Bacteria 4815
178 Ga0157371_10096344 3300013102 Bacteria 2097
179 Ga0157370_10001083 3300013104 Bacteria 34095
180 Ga0157370_10016012 3300013104 Bacteria 7606
181 Ga0157370_10226994 3300013104 Bacteria 1729
182 Ga0157370_10259886 3300013104 Bacteria 1605
183 Ga0157369_10010603 3300013105 Bacteria 10489
184 Ga0157369_10021033 3300013105 Bacteria 7294
185 Ga0157369_10038117 3300013105 Bacteria 5258
186 Ga0157369_10052174 3300013105 Bacteria 4426
187 Ga0157369_10109922 3300013105 Bacteria 2930
188 Ga0157369_10223889 3300013105 Bacteria 1968
189 Ga0157374_10000134 3300013296 Bacteria 67433
190 Ga0157378_10001179 3300013297 Bacteria 23765
191 Ga0157378_10019764 3300013297 Bacteria 5923
192 Ga0163162_10001705 3300013306 Bacteria 20605
193 Ga0163162_10062080 3300013306 Bacteria 3776
194 Ga0163162_10141442 3300013306 Bacteria 2520
195 Ga0163162_10203112 3300013306 Bacteria 2111
196 Ga0163162_10271226 3300013306 Bacteria 1828
197 Ga0157372_10162906 3300013307 Bacteria 2578
198 Ga0157372_10211356 3300013307 Bacteria 2248
199 Ga0157372_10324574 3300013307 Bacteria 1792
200 Ga0157372_10613967 3300013307 Bacteria 1267
201 Ga0157372_10730494 3300013307 Bacteria 1151
202 Ga0157375_10000242 3300013308 Bacteria 50251
203 Ga0157375_10339182 3300013308 Bacteria 1668
204 Ga0163163_10043130 3300014325 Bacteria 4421
205 Ga0163163_10229418 3300014325 Bacteria 1906
206 Ga0157380_10005135 3300014326 Bacteria 9148
207 Ga0157380_10036797 3300014326 Bacteria 3789
208 Ga0157377_10021784 3300014745 Bacteria 3376
209 Ga0157376_10000111 3300014969 Bacteria 58460
210 Ga0183363_1007 3300015690 Bacteria 315687
211 Ga0183361_10316 3300016635 Bacteria 1968
212 Ga0163161_10000020 3300017792 Bacteria 214642
213 Ga0163161_10024192 3300017792 Bacteria 4289
214 Ga0206354_10830840 3300020081 Bacteria 1715
215 Ga0206353_11220810 3300020082 Bacteria 6693
216 Ga0213875_10000606 3300021388 Bacteria 29042
217 Ga0209674_102934 3300025226 Bacteria 3353
218 Ga0209147_103310 3300025229 Bacteria 3213
219 Ga0209563_100053 3300025230 Bacteria 332370
220 Ga0207427_100765 3300025231 Bacteria 14626
221 Ga0207425_1000005 3300025245 Bacteria 900502
222 Ga0207425_1019426 3300025245 Bacteria 1462
223 Ga0209026_1006768 3300025250 Bacteria 2728
224 Ga0209677_106246 3300025253 Bacteria 2869
225 Ga0209148_1000159 3300025254 Bacteria 139560
226 Ga0209129_1000649 3300025258 Bacteria 23347
227 Ga0209233_1000003 3300025261 Bacteria 1607366
228 Ga0209233_1000065 3300025261 Bacteria 387195
229 Ga0209565_1000030 3300025263 Bacteria 325058
230 Ga0209565_1000056 3300025263 Bacteria 200189
231 Ga0209455_1000045 3300025272 Bacteria 383329
232 Ga0209455_1015249 3300025272 Bacteria 1698
233 Ga0209673_1000768 3300025273 Bacteria 43336
234 Ga0209675_1000275 3300025291 Bacteria 49474
235 Ga0209675_1011380 3300025291 Bacteria 2955
236 Ga0209676_1000085 3300025292 Bacteria 273425
237 Ga0209676_1000349 3300025292 Bacteria 87517
238 Ga0209676_1000648 3300025292 Bacteria 49941
239 Ga0209676_1003919 3300025292 Bacteria 8634
240 Ga0209676_1053111 3300025292 Bacteria 1053
241 Ga0209025_1000464 3300025294 Bacteria 79341
242 Ga0209564_1001019 3300025295 Bacteria 34584
243 Ga0209758_1000002 3300025297 Bacteria 1400310
244 Ga0209758_1000023 3300025297 Bacteria 612453
245 Ga0209758_1066035 3300025297 Bacteria 1164
246 Ga0209050_1000005 3300025298 Bacteria 1557793
247 Ga0209050_1000042 3300025298 Bacteria 402842
248 Ga0209050_1006583 3300025298 Bacteria 6823
249 Ga0209050_1008927 3300025298 Bacteria 5235
250 Ga0209256_1000046 3300025299 Bacteria 325040
251 Ga0207426_1039161 3300025302 Bacteria 1487
252 Ga0209051_1000153 3300025303 Bacteria 131166
253 Ga0209257_1000135 3300025304 Bacteria 205668
254 Ga0209257_1000482 3300025304 Bacteria 72375
255 Ga0209257_1000533 3300025304 Bacteria 66037
256 Ga0209257_1002082 3300025304 Bacteria 21069
257 Ga0209257_1002135 3300025304 Bacteria 20606
258 Ga0209257_1024529 3300025304 Bacteria 2086
259 Ga0207656_10002317 3300025321 Bacteria 6390
260 Ga0207656_10021344 3300025321 Bacteria 2586
261 Ga0207656_10042917 3300025321 Bacteria 1927
262 Ga0207713_1004428 3300025735 Bacteria 9106
263 Ga0207710_10007599 3300025900 Bacteria 4585
264 Ga0207680_10000011 3300025903 Bacteria 391225
265 Ga0207647_10000312 3300025904 Bacteria 40325
266 Ga0207647_10007098 3300025904 Bacteria 8124
267 Ga0207647_10018586 3300025904 Bacteria 4696
268 Ga0207647_10033652 3300025904 Bacteria 3280
269 Ga0207645_10005071 3300025907 Bacteria 9644
270 Ga0207705_10000456 3300025909 Bacteria 35093
271 Ga0207705_10000875 3300025909 Bacteria 24669
272 Ga0207705_10052970 3300025909 Bacteria 2923
273 Ga0207705_10088799 3300025909 Bacteria 2261
274 Ga0207654_10009333 3300025911 Bacteria 4980
275 Ga0207654_10020536 3300025911 Bacteria 3503
276 Ga0207695_10002974 3300025913 Bacteria 24437
277 Ga0207695_10048674 3300025913 Bacteria 4475
278 Ga0207695_10069656 3300025913 Bacteria 3599
279 Ga0207671_10001453 3300025914 Bacteria 27348
280 Ga0207671_10006388 3300025914 Bacteria 10508
281 Ga0207657_10001940 3300025919 Bacteria 22345
282 Ga0207657_10003878 3300025919 Bacteria 15869
283 Ga0207657_10004639 3300025919 Bacteria 14521
284 Ga0207657_10016196 3300025919 Bacteria 7197
285 Ga0207649_10000069 3300025920 Bacteria 91425
286 Ga0207649_10073759 3300025920 Bacteria 2187
287 Ga0207681_10000045 3300025923 Bacteria 128454
288 Ga0207681_10049545 3300025923 Bacteria 2839
289 Ga0207681_10135236 3300025923 Bacteria 1828
290 Ga0207681_10191261 3300025923 Bacteria 1566
291 Ga0207694_10005782 3300025924 Bacteria 9472
292 Ga0207694_10008940 3300025924 Bacteria 7563
293 Ga0207694_10025396 3300025924 Bacteria 4504
294 Ga0207694_10049392 3300025924 Bacteria 3257
295 Ga0207650_10000367 3300025925 Bacteria 42933
296 Ga0207650_10096956 3300025925 Bacteria 2263
297 Ga0207650_10104402 3300025925 Bacteria 2186
298 Ga0207687_10005555 3300025927 Bacteria 8332
299 Ga0207687_10013629 3300025927 Bacteria 5307
300 Ga0207644_10000094 3300025931 Bacteria 64592
301 Ga0207644_10001102 3300025931 Bacteria 17341
302 Ga0207644_10104327 3300025931 Bacteria 2134
303 Ga0207690_10000846 3300025932 Bacteria 19607
304 Ga0207706_10057717 3300025933 Bacteria 3419
305 Ga0207686_10000250 3300025934 Bacteria 40936
306 Ga0207686_10093872 3300025934 Bacteria 1988
307 Ga0207709_10000047 3300025935 Bacteria 238649
308 Ga0207709_10000051 3300025935 Bacteria 227968
309 Ga0207709_10050177 3300025935 Bacteria 2550
310 Ga0207669_10000508 3300025937 Bacteria 16974
311 Ga0207704_10000001 3300025938 Bacteria 716296
312 Ga0207711_10000021 3300025941 Bacteria 355952
313 Ga0207711_10006119 3300025941 Bacteria 10165
314 Ga0207711_10043015 3300025941 Bacteria 3851
315 Ga0207689_10000059 3300025942 Bacteria 85713
316 Ga0207667_10000001 3300025949 Bacteria 1178522
317 Ga0207667_10016642 3300025949 Bacteria 8302
318 Ga0207667_10426821 3300025949 Bacteria 1348
319 Ga0207651_10000006 3300025960 Bacteria 227893
320 Ga0207651_10180758 3300025960 Bacteria 1673
321 Ga0207712_10000013 3300025961 Bacteria 391208
322 Ga0207712_10000015 3300025961 Bacteria 346689
323 Ga0207712_10001145 3300025961 Bacteria 18468
324 Ga0207712_10003624 3300025961 Bacteria 9735
325 Ga0207712_10019149 3300025961 Bacteria 4466
326 Ga0207668_10000313 3300025972 Bacteria 31786
327 Ga0207668_10001023 3300025972 Bacteria 16730
328 Ga0207668_10002891 3300025972 Bacteria 10075
329 Ga0207668_10050054 3300025972 Bacteria 2876
330 Ga0207668_10078823 3300025972 Bacteria 2380
331 Ga0207640_10005337 3300025981 Bacteria 7005
332 Ga0207640_10009764 3300025981 Bacteria 5380
333 Ga0207640_10101329 3300025981 Bacteria 2020
334 Ga0207658_10000159 3300025986 Bacteria 71280
335 Ga0207658_10000424 3300025986 Bacteria 40038
336 Ga0207658_10001075 3300025986 Bacteria 22159
337 Ga0207658_10012317 3300025986 Bacteria 5838
338 Ga0207658_10060590 3300025986 Bacteria 2825
339 Ga0207658_10306400 3300025986 Bacteria 1370
340 Ga0207677_10000251 3300026023 Bacteria 41529
341 Ga0207677_10057934 3300026023 Bacteria 2664
342 Ga0207703_10000634 3300026035 Bacteria 35367
343 Ga0207703_10000888 3300026035 Bacteria 29349
344 Ga0207703_10000927 3300026035 Bacteria 28560
345 Ga0207639_10000379 3300026041 Bacteria 30706
346 Ga0207639_10003124 3300026041 Bacteria 11134
347 Ga0207639_10004254 3300026041 Bacteria 9652
348 Ga0207639_10023343 3300026041 Bacteria 4466
349 Ga0207678_10002708 3300026067 Bacteria 16071
350 Ga0207678_10006156 3300026067 Bacteria 10673
351 Ga0207678_10021653 3300026067 Bacteria 5637
352 Ga0207702_10001108 3300026078 Bacteria 27539
353 Ga0207702_10006148 3300026078 Bacteria 10394
354 Ga0207702_10007410 3300026078 Bacteria 9366
355 Ga0207702_10027313 3300026078 Bacteria 4739
356 Ga0207641_10000004 3300026088 Bacteria 481088
357 Ga0207641_10000049 3300026088 Bacteria 177222
358 Ga0207641_10000101 3300026088 Bacteria 122493
359 Ga0207641_10000107 3300026088 Bacteria 121220
360 Ga0207641_10000973 3300026088 Bacteria 29317
361 Ga0207641_10005433 3300026088 Bacteria 10876
362 Ga0207648_10000022 3300026089 Bacteria 137000
363 Ga0207648_10353481 3300026089 Bacteria 1325
364 Ga0207676_10000057 3300026095 Bacteria 121220
365 Ga0207676_10000877 3300026095 Bacteria 23341
366 Ga0207676_10002582 3300026095 Bacteria 12910
367 Ga0207674_10003490 3300026116 Bacteria 19200
368 Ga0207674_10050177 3300026116 Bacteria 4264
369 Ga0207674_10282219 3300026116 Bacteria 1609
370 Ga0207675_100000011 3300026118 Bacteria 143162
371 Ga0207675_100000640 3300026118 Bacteria 34358
372 Ga0207675_100244282 3300026118 Bacteria 1735
373 Ga0207683_10000882 3300026121 Bacteria 27546
374 Ga0207683_10059531 3300026121 Bacteria 3355
375 Ga0207698_10000220 3300026142 Bacteria 35458
376 Ga0207698_10060351 3300026142 Bacteria 2949
377 Ga0209813_10000456 3300027866 Bacteria 9927
378 Ga0268266_10000015 3300028379 Bacteria 630629
379 Ga0268266_10000025 3300028379 Bacteria 477143
380 Ga0268265_10000021 3300028380 Bacteria 272292
381 Ga0268265_10000080 3300028380 Bacteria 121220
382 Ga0268265_10000345 3300028380 Bacteria 50171
383 Ga0268264_10000037 3300028381 Bacteria 391116
384 Ga0268264_10000087 3300028381 Bacteria 236696
385 Ga0268264_10000330 3300028381 Bacteria 74311
386 Ga0268264_10001925 3300028381 Bacteria 18720
387 Ga0268264_10002475 3300028381 Bacteria 16228
388 Ga0307517_10016221 3300028786 Bacteria 9809
389 Ga0307513_10004798 3300031456 Bacteria 17959
390 Ga0307513_10148823 3300031456 Bacteria 2255
391 Ga0307508_10000810 3300031616 Bacteria 36605
392 Ga0307410_10155866 3300031852 Bacteria 1705
393 Ga0307406_10053216 3300031901 Bacteria 2578
394 Ga0307407_10026585 3300031903 Bacteria 3067
395 Ga0307412_10020035 3300031911 Bacteria 4063
396 Ga0307412_10041222 3300031911 Bacteria 2991
397 Ga0307409_100025655 3300031995 Bacteria 4139
398 Ga0307416_100315910 3300032002 Bacteria 1561
399 Ga0307416_100356616 3300032002 Bacteria 1482
400 Ga0307414_10043107 3300032004 Bacteria 3071
401 Ga0307411_10293418 3300032005 Bacteria 1300
402 Ga0373937_0132943 3300036401 Bacteria 2325
403 Ga0316582_0131893 3300036647 Bacteria 1679
404 Ga0316584_0102695 3300036712 Bacteria 2141
405 Ga0395899_0012157 3300037312 Bacteria 6592
406 Ga0395899_0028173 3300037312 Bacteria 4230
407 Ga0395900_0553670 3300037418 Bacteria 1094
408 Ga0436364_0822555 3300037853 Bacteria 215682
409 Ga0395901_0036154 3300038443 Bacteria 5103
410 Ga0395901_0071415 3300038443 Bacteria 3618
411 Ga0395901_0082745 3300038443 Bacteria 3354
412 Ga0439431_0001796 3300041997 Bacteria 4742
413 Ga0439442_013096 3300042002 Bacteria 1701
414 Ga0439445_0002709 3300042004 Bacteria 3942
415 Ga0439445_0005432 3300042004 Bacteria 2904
416 Ga0439448_0000396 3300042005 Bacteria 9914
417 Ga0439432_000061 3300042006 Bacteria 33172
418 Ga0439455_0000160 3300042012 Bacteria 7529
419 Ga0439462_0006232 3300042015 Bacteria 2959
420 Ga0439462_0012507 3300042015 Bacteria 2168
421 Ga0439458_0001403 3300042157 Bacteria 6077
422 Ga0439434_0000912 3300042435 Bacteria 8504
423 Ga0439434_0022240 3300042435 Bacteria 1906
424 Ga0466961_0141986 3300044693 Bacteria 1503
425 Ga0466963_0034956 3300044694 Bacteria 3272
426 Ga0466971_0011717 3300044719 Bacteria 3840
427 Ga0466967_0033834 3300045976 Bacteria 4331
428 Ga0495617_013763 3300046452 Bacteria 2751
429 Ga0495627_000494 3300046453 Bacteria 33081
430 Ga0495627_004180 3300046453 Bacteria 6120
431 Ga0495629_0131858 3300046459 Bacteria 1741
432 Ga0495638_0000481 3300046460 Bacteria 47890
433 Ga0495638_0012818 3300046460 Bacteria 5728
434 Ga0495638_0039322 3300046460 Bacteria 3003
435 Ga0495650_0000491 3300046471 Bacteria 60068
436 Ga0495650_0012970 3300046471 Bacteria 4444
437 Ga0495584_0024841 3300046491 Bacteria 3038
438 Ga0495584_0053178 3300046491 Bacteria 2038
439 Ga0495585_0005748 3300046492 Bacteria 7782
440 Ga0495585_0111556 3300046492 Bacteria 1454
441 Ga0495607_0042348 3300046501 Bacteria 2699
442 Ga0495583_0001935 3300046506 Bacteria 19137
443 Ga0495583_0029621 3300046506 Bacteria 2676
444 Ga0495583_0036850 3300046506 Bacteria 2322
445 Ga0495606_0000379 3300046507 Bacteria 75426
446 Ga0495606_0019327 3300046507 Bacteria 5074
447 Ga0495606_0048488 3300046507 Bacteria 2793
448 Ga0495610_0002686 3300046512 Bacteria 14666
449 Ga0495610_0013533 3300046512 Bacteria 4844
450 Ga0495616_0000017 3300046513 Bacteria 167324
451 Ga0495632_0000079 3300046519 Bacteria 100131
452 Ga0495637_0004742 3300046520 Bacteria 7015
453 Ga0495637_0006673 3300046520 Bacteria 5779
454 Ga0495643_0000030 3300046522 Bacteria 260229
455 Ga0495643_0001764 3300046522 Bacteria 18603
456 Ga0495643_0002663 3300046522 Bacteria 13820
457 Ga0495648_0000444 3300046524 Bacteria 44706
458 Ga0495648_0012061 3300046524 Bacteria 6472
459 Ga0495663_0000006 3300046525 Bacteria 306938
460 Ga0495663_0000341 3300046525 Bacteria 17397
461 Ga0495663_0012403 3300046525 Bacteria 2374
462 Ga0495642_0054486 3300046528 Bacteria 1649
463 Ga0495587_0113534 3300046536 Bacteria 1555
464 Ga0495597_0065307 3300046542 Bacteria 1579
465 Ga0495622_0002047 3300046557 Bacteria 9852
466 Ga0495622_0006810 3300046557 Bacteria 5304
467 Ga0495633_0000227 3300046558 Bacteria 69862
468 Ga0495633_0004374 3300046558 Bacteria 9015
469 Ga0495668_0000548 3300046616 Bacteria 46481
470 Ga0495668_0007147 3300046616 Bacteria 7180
471 Ga0495668_0057371 3300046616 Bacteria 2149
472 Ga0495668_0109215 3300046616 Bacteria 1513
473 Ga0495611_0005333 3300046648 Bacteria 5501
474 Ga0495611_0102881 3300046648 Bacteria 1327
475 Ga0495625_0000112 3300046660 Bacteria 124365
476 Ga0495625_0000652 3300046660 Bacteria 49796
477 Ga0495625_0000971 3300046660 Bacteria 38119
478 Ga0495625_0018551 3300046660 Bacteria 5426
479 Ga0495625_0093982 3300046660 Bacteria 2069
480 Ga0495661_0151100 3300046665 Bacteria 1254
481 Ga0495669_0000378 3300046684 Bacteria 22467
482 Ga0495670_0001636 3300046691 Bacteria 10969
483 Ga0495671_0000072 3300046692 Bacteria 97315
484 Ga0495671_0003821 3300046692 Bacteria 9157
485 Ga0495671_0015865 3300046692 Bacteria 4032
486 Ga0495600_0029068 3300046809 Bacteria 3578
487 Ga0495660_0027691 3300046810 Bacteria 3206
488 Ga0495660_0120367 3300046810 Bacteria 1329
489 Ga0495687_000192 3300047443 Bacteria 87877
490 Ga0495687_012328 3300047443 Bacteria 4525
491 Ga0495677_0048013 3300047445 Bacteria 1568
492 Ga0495681_0000055 3300047470 Bacteria 104502
493 Ga0495681_0005121 3300047470 Bacteria 8835
494 Ga0495681_0016328 3300047470 Bacteria 4165
495 Ga0495686_0000057 3300047472 Bacteria 250088
496 Ga0495686_0001111 3300047472 Bacteria 31908
497 Ga0495686_0005131 3300047472 Bacteria 10460
498 Ga0495686_0025738 3300047472 Bacteria 3855
499 Ga0495686_0069513 3300047472 Bacteria 2171
500 Ga0495686_0099095 3300047472 Bacteria 1760
501 Ga0495686_0142559 3300047472 Bacteria 1413
502 Ga0496102_0000049 3300048905 Bacteria 179480
503 Ga0496102_0001816 3300048905 Bacteria 18445
504 Ga0496103_0000037 3300048906 Bacteria 179474
505 Ga0496103_0000177 3300048906 Bacteria 65489
506 Ga0496103_0005733 3300048906 Bacteria 7416
507 Ga0496104_0003305 3300048907 Bacteria 13919
508 Ga0496105_0005988 3300048908 Bacteria 9284
509 Ga0496106_0076540 3300048909 Bacteria 2565
510 Ga0496108_0260277 3300048911 Bacteria 1510
511 Ga0496109_0212969 3300048912 Bacteria 1817
512 Ga0496110_0032029 3300048913 Bacteria 4538
513 Ga0496111_0127609 3300048914 Bacteria 1881
514 Ga0496111_0245733 3300048914 Bacteria 1328
515 Ga0496115_0000410 3300048918 Bacteria 35215
516 Ga0496116_0003064 3300048919 Bacteria 16874
517 Ga0496116_0007919 3300048919 Bacteria 9312
518 Ga0496117_0000115 3300048920 Bacteria 179488
519 Ga0496117_0001327 3300048920 Bacteria 36380
520 Ga0496117_0003281 3300048920 Bacteria 18981
521 Ga0496117_0010519 3300048920 Bacteria 8413
522 Ga0496117_0016395 3300048920 Bacteria 6254
523 Ga0496117_0028282 3300048920 Bacteria 4345
524 Ga0496117_0030617 3300048920 Bacteria 4125
525 Ga0496118_0000086 3300048921 Bacteria 179488
526 Ga0496118_0000162 3300048921 Bacteria 119635
527 Ga0496118_0000597 3300048921 Bacteria 59798
528 Ga0496118_0004352 3300048921 Bacteria 16851
529 Ga0496118_0008578 3300048921 Bacteria 10520
530 Ga0496118_0033415 3300048921 Bacteria 4220
531 Ga0496119_0025524 3300048922 Bacteria 4124
532 Ga0496120_0073501 3300048923 Bacteria 1871
533 Ga0496121_0015897 3300048924 Bacteria 7819
534 Ga0496121_0023324 3300048924 Bacteria 5964
535 Ga0496121_0074667 3300048924 Bacteria 2711
536 Ga0496122_0008312 3300048925 Bacteria 11241
537 Ga0496122_0015584 3300048925 Bacteria 7255
538 Ga0496122_0018167 3300048925 Bacteria 6513
539 Ga0496122_0250748 3300048925 Bacteria 990
540 Ga0496123_0045632 3300048926 Bacteria 2983
541 Ga0496123_0080726 3300048926 Bacteria 1980
542 Ga0496123_0209367 3300048926 Bacteria 992
543 Ga0496124_0000102 3300048927 Bacteria 179488
544 Ga0496124_0003194 3300048927 Bacteria 20239
545 Ga0496124_0025172 3300048927 Bacteria 5395
546 Ga0496125_0003670 3300048928 Bacteria 18342
547 Ga0496125_0018080 3300048928 Bacteria 6700
548 Ga0496125_0062597 3300048928 Bacteria 2974
549 Ga0496125_0097178 3300048928 Bacteria 2183
550 Ga0496125_0160325 3300048928 Bacteria 1529
551 Ga0496125_0164668 3300048928 Bacteria 1500
552 Ga0496125_0333330 3300048928 Bacteria 914
553 Ga0496126_0000467 3300048929 Bacteria 80295
554 Ga0496126_0037594 3300048929 Bacteria 4516
555 Ga0496126_0089420 3300048929 Bacteria 2711
556 Ga0496126_0300304 3300048929 Bacteria 1325
557 Ga0501290_002015 3300049513 Bacteria 2669
558 Ga0501292_000015 3300049515 Bacteria 64087
559 Ga0501293_001610 3300049516 Bacteria 1696
560 Ga0501294_000034 3300049517 Bacteria 13717
561 Ga0501300_000543 3300049523 Bacteria 5641
562 Ga0501315_002062 3300049531 Bacteria 1838
563 Ga0501047_0240125 3300049581 Bacteria 1663
564 Ga0501047_0252223 3300049581 Bacteria 1613
565 Ga0501069_0013786 3300049585 Bacteria 4313
566 Ga0501070_0211297 3300049586 Bacteria 1592
567 Ga0501211_000869 3300049658 Bacteria 3165
568 Ga0501222_000470 3300049662 Bacteria 6017
569 Ga0501223_000010 3300049663 Bacteria 106901
570 Ga0501224_001100 3300049664 Bacteria 3521
571 Ga0501233_001690 3300049668 Bacteria 3798
572 Ga0501235_000937 3300049669 Bacteria 6031
573 Ga0501235_012080 3300049669 Bacteria 1897
574 Ga0501249_000649 3300049679 Bacteria 7950
575 Ga0501257_000133 3300049686 Bacteria 16944
576 Ga0501257_008979 3300049686 Bacteria 2253
577 Ga0501259_001871 3300049688 Bacteria 3487
578 Ga0501261_001713 3300049690 Bacteria 2695
579 Ga0501225_0000008 3300049705 Bacteria 95521
580 Ga0501225_0000376 3300049705 Bacteria 14073
581 Ga0501225_0001874 3300049705 Bacteria 6603
582 Ga0501241_007939 3300049758 Bacteria 1943
583 Ga0501279_000015 3300049775 Bacteria 64426
584 Ga0501280_000226 3300049776 Bacteria 14226
585 Ga0501281_00176 3300049777 Bacteria 7350
586 nmdc:mga06z11_52_c1 3300050494 Bacteria 49109
587 nmdc:mga04h51_621_c1 3300050495 Bacteria 8335
588 Ga0500610_0001803 3300053079 Bacteria 7543
589 Ga0500643_000137 3300053087 Bacteria 74194
590 Ga0500643_000166 3300053087 Bacteria 65586
591 Ga0500643_001128 3300053087 Bacteria 15935
592 Ga0500643_001221 3300053087 Bacteria 15319
593 Ga0500651_0001233 3300053093 Bacteria 12727
594 Ga0500566_0049106 3300053094 Bacteria 2417
595 Ga0500562_008982 3300053108 Bacteria 2524
596 Ga0500592_000996 3300053116 Bacteria 4622
597 Ga0500592_006810 3300053116 Bacteria 1819
598 Ga0500594_0002524 3300053118 Bacteria 3981
599 Ga0500594_0002974 3300053118 Bacteria 3705
600 Ga0500595_026446 3300053119 Bacteria 1999
601 Ga0500618_007279 3300053125 Bacteria 3174
602 Ga0500642_0000389 3300053130 Bacteria 14472
603 Ga0500642_0001261 3300053130 Bacteria 7244
604 Ga0500655_000048 3300053133 Bacteria 32768
605 Ga0500658_0003044 3300053134 Bacteria 6416
606 Ga0500568_0001915 3300053139 Bacteria 12764
607 Ga0500573_0000086 3300053140 Bacteria 42361
608 Ga0500590_014633 3300053148 Bacteria 4045
609 Ga0500604_0004487 3300053151 Bacteria 3703
610 Ga0500622_0011112 3300053156 Bacteria 4916
611 Ga0500627_0000005 3300053158 Bacteria 167950
612 Ga0500627_0007631 3300053158 Bacteria 3784
613 Ga0500639_068118 3300053163 Bacteria 1819
614 Ga0500636_0000568 3300053177 Bacteria 20153
615 Ga0500645_000116 3300053730 Bacteria 63698
616 Ga0500645_050436 3300053730 Bacteria 1215
617 Ga0500587_003581 3300053739 Bacteria 2165
618 Ga0500661_000842 3300055283 Bacteria 5730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10000967 Ga0070658_1000096722 264
2 3300005339 Ga0070660_100002653 Ga0070660_10000265310 264
3 3300025909 Ga0207705_10000875 Ga0207705_1000087521 264
4 3300025919 Ga0207657_10004639 Ga0207657_1000463910 264
5 3300048928 Ga0496125_0333330 Ga0496125_0333330_11_901 296
6 3300053119 Ga0500595_026446 Ga0500595_026446_98_994 298
7 3300049658 Ga0501211_000869 Ga0501211_000869_442_1344 300
8 3300005719 Ga0068861_100000061 Ga0068861_10000006144 302
9 3300026118 Ga0207675_100000011 Ga0207675_100000011141 302
10 3300042005 Ga0439448_0000396 Ga0439448_0000396_7423_8373 302
11 3300042012 Ga0439455_0000160 Ga0439455_0000160_1648_2598 302
12 3300042157 Ga0439458_0001403 Ga0439458_0001403_2484_3434 302
13 3300013102 Ga0157371_10096344 Ga0157371_100963442 304
14 3300013105 Ga0157369_10223889 Ga0157369_102238891 305
15 3300013307 Ga0157372_10211356 Ga0157372_102113562 305
16 3300025933 Ga0207706_10057717 Ga0207706_100577172 305
17 3300053116 Ga0500592_006810 Ga0500592_006810_787_1743 305
18 3300046507 Ga0495606_0019327 Ga0495606_0019327_2802_3779 306
19 3300005262 Ga0065165_1001326 Ga0065165_100132627 307
20 3300005547 Ga0070693_100154324 Ga0070693_1001543241 308
21 3300006042 Ga0075368_10001402 Ga0075368_100014023 308
22 3300006178 Ga0075367_10000205 Ga0075367_100002057 308
23 3300027866 Ga0209813_10000456 Ga0209813_100004569 308
24 3300050494 nmdc:mga06z11_52_c1 nmdc:mga06z11_52_c1_40228_41217 308
25 3300050495 nmdc:mga04h51_621_c1 nmdc:mga04h51_621_c1_1360_2349 308
26 3300001904 JGI24736J21556_1000502 JGI24736J21556_10005025 309
27 3300001915 JGI24741J21665_1000107 JGI24741J21665_100010720 309
28 3300001979 JGI24740J21852_10009011 JGI24740J21852_100090114 309
29 3300001989 JGI24739J22299_10005370 JGI24739J22299_100053702 309
30 3300001990 JGI24737J22298_10002879 JGI24737J22298_100028795 309
31 3300002067 JGI24735J21928_10003861 JGI24735J21928_100038615 309
32 3300002075 JGI24738J21930_10001993 JGI24738J21930_100019935 309
33 3300005327 Ga0070658_10068159 Ga0070658_100681591 309
34 3300005344 Ga0070661_100072734 Ga0070661_1000727343 309
35 3300005366 Ga0070659_100092389 Ga0070659_1000923891 309
36 3300005455 Ga0070663_100001752 Ga0070663_10000175213 309
37 3300005614 Ga0068856_100028579 Ga0068856_1000285792 309
38 3300005834 Ga0068851_10015119 Ga0068851_100151194 309
39 3300009174 Ga0105241_10003710 Ga0105241_100037104 309
40 3300013100 Ga0157373_10066776 Ga0157373_100667762 309
41 3300025321 Ga0207656_10021344 Ga0207656_100213444 309
42 3300025904 Ga0207647_10018586 Ga0207647_100185866 309
43 3300025909 Ga0207705_10052970 Ga0207705_100529702 309
44 3300025911 Ga0207654_10020536 Ga0207654_100205363 309
45 3300025913 Ga0207695_10069656 Ga0207695_100696562 309
46 3300025919 Ga0207657_10003878 Ga0207657_100038789 309
47 3300025981 Ga0207640_10005337 Ga0207640_100053375 309
48 3300026041 Ga0207639_10003124 Ga0207639_100031245 309
49 3300026067 Ga0207678_10006156 Ga0207678_1000615610 309
50 3300026078 Ga0207702_10007410 Ga0207702_100074104 309
51 3300026142 Ga0207698_10060351 Ga0207698_100603512 309
52 3300031852 Ga0307410_10155866 Ga0307410_101558662 309
53 3300032002 Ga0307416_100356616 Ga0307416_1003566162 309
54 3300032005 Ga0307411_10293418 Ga0307411_102934181 309
55 3300046491 Ga0495584_0024841 Ga0495584_0024841_1606_2595 309
56 3300046519 Ga0495632_0000079 Ga0495632_0000079_67484_68473 309
57 3300046520 Ga0495637_0004742 Ga0495637_0004742_2859_3848 309
58 3300046522 Ga0495643_0000030 Ga0495643_0000030_256045_257034 309
59 3300046525 Ga0495663_0000006 Ga0495663_0000006_238466_239455 309
60 3300046558 Ga0495633_0000227 Ga0495633_0000227_41367_42356 309
61 3300046692 Ga0495671_0000072 Ga0495671_0000072_93131_94120 309
62 3300047470 Ga0495681_0016328 Ga0495681_0016328_2511_3500 309
63 3300047472 Ga0495686_0069513 Ga0495686_0069513_465_1454 309
64 3300003214 JGI25165J46597_1000021 JGI25165J46597_100002110 310
65 3300017792 Ga0163161_10024192 Ga0163161_100241922 310
66 3300020081 Ga0206354_10830840 Ga0206354_108308401 310
67 3300020082 Ga0206353_11220810 Ga0206353_112208103 310
68 3300025261 Ga0209233_1000065 Ga0209233_10000659 310
69 3300025972 Ga0207668_10002891 Ga0207668_100028919 310
70 3300046452 Ga0495617_013763 Ga0495617_013763_255_1244 310
71 3300046453 Ga0495627_000494 Ga0495627_000494_3400_4392 310
72 3300046453 Ga0495627_004180 Ga0495627_004180_3792_4781 310
73 3300046512 Ga0495610_0002686 Ga0495610_0002686_9245_10234 310
74 3300046520 Ga0495637_0006673 Ga0495637_0006673_3186_4175 310
75 3300046524 Ga0495648_0012061 Ga0495648_0012061_2251_3243 310
76 3300046691 Ga0495670_0001636 Ga0495670_0001636_2613_3608 310
77 3300047470 Ga0495681_0000055 Ga0495681_0000055_10703_11692 310
78 3300048928 Ga0496125_0160325 Ga0496125_0160325_514_1503 310
79 3300005289 Ga0065704_10122327 Ga0065704_101223271 311
80 3300026089 Ga0207648_10353481 Ga0207648_103534812 311
81 3300046512 Ga0495610_0013533 Ga0495610_0013533_1404_2393 311
82 3300047472 Ga0495686_0025738 Ga0495686_0025738_55_1044 311
83 3300047472 Ga0495686_0099095 Ga0495686_0099095_488_1474 311
84 3300048914 Ga0496111_0127609 Ga0496111_0127609_762_1754 311
85 3300048924 Ga0496121_0074667 Ga0496121_0074667_1700_2692 311
86 3300048925 Ga0496122_0018167 Ga0496122_0018167_4778_5770 311
87 3300048926 Ga0496123_0080726 Ga0496123_0080726_595_1587 311
88 3300048926 Ga0496123_0209367 Ga0496123_0209367_38_982 311
89 3300048927 Ga0496124_0025172 Ga0496124_0025172_701_1693 311
90 3300048928 Ga0496125_0018080 Ga0496125_0018080_5248_6240 311
91 3300048929 Ga0496126_0089420 Ga0496126_0089420_1071_2063 311
92 3300005353 Ga0070669_100037973 Ga0070669_1000379733 312
93 3300005355 Ga0070671_100136506 Ga0070671_1001365062 312
94 3300005367 Ga0070667_100381647 Ga0070667_1003816472 312
95 3300005548 Ga0070665_100000021 Ga0070665_100000021329 312
96 3300005842 Ga0068858_100003008 Ga0068858_10000300814 312
97 3300009098 Ga0105245_10000244 Ga0105245_1000024435 312
98 3300009148 Ga0105243_10080635 Ga0105243_100806353 312
99 3300009176 Ga0105242_10506303 Ga0105242_105063031 312
100 3300013297 Ga0157378_10019764 Ga0157378_100197642 312
101 3300025229 Ga0209147_103310 Ga0209147_1033105 312
102 3300025302 Ga0207426_1039161 Ga0207426_10391612 312
103 3300025923 Ga0207681_10191261 Ga0207681_101912612 312
104 3300025927 Ga0207687_10005555 Ga0207687_100055556 312
105 3300025931 Ga0207644_10104327 Ga0207644_101043273 312
106 3300025934 Ga0207686_10093872 Ga0207686_100938722 312
107 3300025935 Ga0207709_10050177 Ga0207709_100501772 312
108 3300025986 Ga0207658_10060590 Ga0207658_100605901 312
109 3300026035 Ga0207703_10000927 Ga0207703_1000092714 312
110 3300028379 Ga0268266_10000015 Ga0268266_10000015124 312
111 3300038443 Ga0395901_0082745 Ga0395901_0082745_1427_2425 312
112 3300048920 Ga0496117_0003281 Ga0496117_0003281_8508_9500 312
113 3300048921 Ga0496118_0000162 Ga0496118_0000162_77898_78890 312
114 3300003773 Ga0055537_1001305 Ga0055537_10013052 313
115 3300005844 Ga0068862_100053430 Ga0068862_1000534303 313
116 3300005937 Ga0081455_10000175 Ga0081455_1000017556 313
117 3300009551 Ga0105238_10257937 Ga0105238_102579372 313
118 3300015690 Ga0183363_1007 Ga0183363_1007194 313
119 3300016635 Ga0183361_10316 Ga0183361_103162 313
120 3300025263 Ga0209565_1000056 Ga0209565_100005652 313
121 3300025272 Ga0209455_1015249 Ga0209455_10152492 313
122 3300025924 Ga0207694_10049392 Ga0207694_100493924 313
123 3300031616 Ga0307508_10000810 Ga0307508_100008107 313
124 3300046460 Ga0495638_0000481 Ga0495638_0000481_4636_5631 313
125 3300046525 Ga0495663_0012403 Ga0495663_0012403_120_1115 313
126 3300046660 Ga0495625_0000112 Ga0495625_0000112_2827_3822 313
127 3300047472 Ga0495686_0005131 Ga0495686_0005131_111_1094 313
128 3300025295 Ga0209564_1001019 Ga0209564_10010195 314
129 3300031911 Ga0307412_10020035 Ga0307412_100200352 314
130 3300046492 Ga0495585_0111556 Ga0495585_0111556_191_1189 314
131 3300053116 Ga0500592_000996 Ga0500592_000996_1787_2818 314
132 3300053158 Ga0500627_0000005 Ga0500627_0000005_41960_42991 314
133 3300002067 JGI24735J21928_10020838 JGI24735J21928_100208381 315
134 3300005367 Ga0070667_100281697 Ga0070667_1002816971 315
135 3300005618 Ga0068864_100001277 Ga0068864_1000012776 315
136 3300005842 Ga0068858_100000414 Ga0068858_10000041432 315
137 3300009177 Ga0105248_10006249 Ga0105248_100062498 315
138 3300013306 Ga0163162_10001705 Ga0163162_1000170520 315
139 3300013306 Ga0163162_10271226 Ga0163162_102712262 315
140 3300013307 Ga0157372_10730494 Ga0157372_107304942 315
141 3300014325 Ga0163163_10229418 Ga0163163_102294182 315
142 3300025941 Ga0207711_10043015 Ga0207711_100430152 315
143 3300025986 Ga0207658_10306400 Ga0207658_103064001 315
144 3300026035 Ga0207703_10000634 Ga0207703_1000063423 315
145 3300026095 Ga0207676_10000877 Ga0207676_1000087722 315
146 3300031456 Ga0307513_10148823 Ga0307513_101488233 315
147 3300046460 Ga0495638_0039322 Ga0495638_0039322_202_1206 315
148 3300046660 Ga0495625_0018551 Ga0495625_0018551_617_1618 315
149 3300048906 Ga0496103_0005733 Ga0496103_0005733_6015_7004 315
150 3300048920 Ga0496117_0016395 Ga0496117_0016395_2997_3986 315
151 3300048921 Ga0496118_0033415 Ga0496118_0033415_650_1639 315
152 3300053087 Ga0500643_001128 Ga0500643_001128_11226_12227 315
153 3300053730 Ga0500645_050436 Ga0500645_050436_126_1127 315
154 3300009011 Ga0105251_10000625 Ga0105251_100006258 316
155 3300009101 Ga0105247_10007007 Ga0105247_100070075 316
156 3300009177 Ga0105248_10000014 Ga0105248_10000014269 316
157 3300009553 Ga0105249_10001836 Ga0105249_1000183613 316
158 3300013306 Ga0163162_10141442 Ga0163162_101414422 316
159 3300014325 Ga0163163_10043130 Ga0163163_100431302 316
160 3300025904 Ga0207647_10007098 Ga0207647_100070986 316
161 3300048920 Ga0496117_0028282 Ga0496117_0028282_2248_3204 316
162 3300048921 Ga0496118_0000597 Ga0496118_0000597_14516_15472 316
163 3300046460 Ga0495638_0012818 Ga0495638_0012818_461_1456 317
164 3300013105 Ga0157369_10010603 Ga0157369_1001060311 318
165 3300048925 Ga0496122_0250748 Ga0496122_0250748_22_978 318
166 iso_pu_bacteria 2582581305 2585262923 319
167 3300048912 Ga0496109_0212969 Ga0496109_0212969_20_982 320
168 3300049705 Ga0501225_0000376 Ga0501225_0000376_10891_11862 320
169 3300005295 Ga0065707_10158556 Ga0065707_101585562 321
170 3300005367 Ga0070667_100000016 Ga0070667_10000001684 321
171 3300005548 Ga0070665_100416648 Ga0070665_1004166481 321
172 3300005843 Ga0068860_100000196 Ga0068860_10000019623 321
173 3300009553 Ga0105249_10002730 Ga0105249_1000273012 321
174 3300025986 Ga0207658_10012317 Ga0207658_100123174 321
175 3300026088 Ga0207641_10000973 Ga0207641_1000097324 321
176 3300028381 Ga0268264_10000087 Ga0268264_1000008783 321
177 3300046536 Ga0495587_0113534 Ga0495587_0113534_421_1416 321
178 3300006178 Ga0075367_10162903 Ga0075367_101629031 322
179 3300009177 Ga0105248_10099258 Ga0105248_100992582 322
180 3300009553 Ga0105249_10100916 Ga0105249_101009162 322
181 3300013102 Ga0157371_10020886 Ga0157371_100208865 322
182 3300013105 Ga0157369_10109922 Ga0157369_101099222 322
183 3300026116 Ga0207674_10050177 Ga0207674_100501772 322
184 3300046616 Ga0495668_0057371 Ga0495668_0057371_294_1286 322
185 3300046616 Ga0495668_0109215 Ga0495668_0109215_192_1181 322
186 3300046810 Ga0495660_0120367 Ga0495660_0120367_320_1312 322
187 3300048928 Ga0496125_0164668 Ga0496125_0164668_122_1114 322
188 3300048929 Ga0496126_0300304 Ga0496126_0300304_271_1251 322
189 3300049679 Ga0501249_000649 Ga0501249_000649_2315_3307 322
190 3300053093 Ga0500651_0001233 Ga0500651_0001233_10430_11422 322
191 3300053125 Ga0500618_007279 Ga0500618_007279_63_1055 322
192 3300053130 Ga0500642_0001261 Ga0500642_0001261_3809_4801 322
193 3300053133 Ga0500655_000048 Ga0500655_000048_3917_4909 322
194 3300053148 Ga0500590_014633 Ga0500590_014633_2892_3884 322
195 3300053156 Ga0500622_0011112 Ga0500622_0011112_3861_4853 322
196 3300053163 Ga0500639_068118 Ga0500639_068118_659_1651 322
197 3300047472 Ga0495686_0142559 Ga0495686_0142559_45_1034 323
198 3300053087 Ga0500643_001221 Ga0500643_001221_3059_4111 323
199 3300036647 Ga0316582_0131893 Ga0316582_0131893_414_1403 324
200 3300036712 Ga0316584_0102695 Ga0316584_0102695_49_1038 324
201 iso_pu_bacteria 2512564014 2512644586 324
202 iso_pu_bacteria 2808606401 2809062338 324
203 iso_pu_bacteria 2808606404 2809078322 324
204 iso_pu_bacteria 2808606405 2809082727 324
205 iso_pu_bacteria 2880518877 2880522403 324
206 iso_pu_bacteria 2919709256 2919709653 324
207 3300003794 Ga0055531_10004998 Ga0055531_100049986 325
208 3300009551 Ga0105238_10043952 Ga0105238_100439523 325
209 3300025292 Ga0209676_1000085 Ga0209676_10000856 325
210 3300025304 Ga0209257_1000482 Ga0209257_10004826 325
211 3300025924 Ga0207694_10025396 Ga0207694_100253963 325
212 3300044693 Ga0466961_0141986 Ga0466961_0141986_234_1220 325
213 3300044694 Ga0466963_0034956 Ga0466963_0034956_249_1235 325
214 3300044719 Ga0466971_0011717 Ga0466971_0011717_2103_3089 325
215 3300045976 Ga0466967_0033834 Ga0466967_0033834_191_1177 325
216 3300047472 Ga0495686_0000057 Ga0495686_0000057_216435_217412 325
217 3300048920 Ga0496117_0010519 Ga0496117_0010519_893_1879 325
218 3300048924 Ga0496121_0015897 Ga0496121_0015897_840_1826 325
219 3300048925 Ga0496122_0015584 Ga0496122_0015584_859_1845 325
220 3300048926 Ga0496123_0045632 Ga0496123_0045632_867_1853 325
221 iso_pu_bacteria 2599185354 2600200375 325
222 iso_pu_bacteria 2751185897 2753763813 325
223 iso_pu_bacteria 2775507255 2778124690 325
224 iso_pu_bacteria 2830075706 2830078981 325
225 iso_pu_bacteria 2885429604 2885430272 325
226 iso_pu_bacteria 2928027323 2928028601 325
227 iso_pu_bacteria 2984555340 2984555822 325
228 iso_pu_bacteria 2984564862 2984566068 325
229 iso_pu_bacteria 2993356040 2993357080 325
230 3300005262 Ga0065165_1003242 Ga0065165_10032428 326
231 3300005289 Ga0065704_10086168 Ga0065704_100861682 326
232 3300005295 Ga0065707_10116834 Ga0065707_101168342 326
233 3300005353 Ga0070669_100157572 Ga0070669_1001575722 326
234 3300009978 Ga0105148_100043 Ga0105148_1000434 326
235 3300014326 Ga0157380_10036797 Ga0157380_100367971 326
236 3300025923 Ga0207681_10135236 Ga0207681_101352362 326
237 3300048911 Ga0496108_0260277 Ga0496108_0260277_261_1250 326
238 3300048928 Ga0496125_0097178 Ga0496125_0097178_372_1361 326
239 3300048929 Ga0496126_0037594 Ga0496126_0037594_276_1259 326
240 3300049669 Ga0501235_012080 Ga0501235_012080_336_1325 326
241 iso_pu_bacteria 8057101203 8057102858 326
242 3300046513 Ga0495616_0000017 Ga0495616_0000017_66718_67704 327
243 3300046557 Ga0495622_0006810 Ga0495622_0006810_2768_3754 327
244 3300046616 Ga0495668_0007147 Ga0495668_0007147_2033_3019 327
245 3300046692 Ga0495671_0003821 Ga0495671_0003821_7221_8207 327
246 3300049663 Ga0501223_000010 Ga0501223_000010_89516_90508 327
247 3300049705 Ga0501225_0000008 Ga0501225_0000008_77868_78860 327
248 3300053108 Ga0500562_008982 Ga0500562_008982_32_1024 327
249 3300053118 Ga0500594_0002974 Ga0500594_0002974_1897_2883 327
250 3300053151 Ga0500604_0004487 Ga0500604_0004487_964_1950 327
251 3300053158 Ga0500627_0007631 Ga0500627_0007631_315_1301 327
252 iso_pu_bacteria 2643221622 2644128341 327
253 3300001915 JGI24741J21665_1009791 JGI24741J21665_10097912 328
254 3300001979 JGI24740J21852_10037438 JGI24740J21852_100374381 328
255 3300001990 JGI24737J22298_10058939 JGI24737J22298_100589391 328
256 3300002067 JGI24735J21928_10004443 JGI24735J21928_100044433 328
257 3300002067 JGI24735J21928_10042522 JGI24735J21928_100425222 328
258 3300003214 JGI25165J46597_1000173 JGI25165J46597_100017373 328
259 3300005328 Ga0070676_10000029 Ga0070676_100000293 328
260 3300005334 Ga0068869_100001320 Ga0068869_1000013209 328
261 3300005338 Ga0068868_100000139 Ga0068868_10000013941 328
262 3300005339 Ga0070660_100000692 Ga0070660_1000006923 328
263 3300005347 Ga0070668_100000993 Ga0070668_1000009936 328
264 3300005353 Ga0070669_100059756 Ga0070669_1000597562 328
265 3300005364 Ga0070673_100000013 Ga0070673_10000001322 328
266 3300005367 Ga0070667_100000199 Ga0070667_10000019953 328
267 3300005459 Ga0068867_100000009 Ga0068867_100000009104 328
268 3300005539 Ga0068853_100000819 Ga0068853_1000008193 328
269 3300005539 Ga0068853_100141762 Ga0068853_1001417621 328
270 3300005543 Ga0070672_100117950 Ga0070672_1001179502 328
271 3300005563 Ga0068855_100178788 Ga0068855_1001787881 328
272 3300005577 Ga0068857_100019321 Ga0068857_1000193213 328
273 3300005841 Ga0068863_100000029 Ga0068863_10000002917 328
274 3300005843 Ga0068860_100002353 Ga0068860_1000023537 328
275 3300006881 Ga0068865_100000005 Ga0068865_1000000057 328
276 3300009098 Ga0105245_10013346 Ga0105245_100133464 328
277 3300009148 Ga0105243_10000032 Ga0105243_1000003222 328
278 3300009176 Ga0105242_10000166 Ga0105242_1000016630 328
279 3300009553 Ga0105249_10016580 Ga0105249_100165805 328
280 3300011119 Ga0105246_10008273 Ga0105246_100082734 328
281 3300013104 Ga0157370_10001083 Ga0157370_1000108319 328
282 3300013104 Ga0157370_10226994 Ga0157370_102269942 328
283 3300013105 Ga0157369_10021033 Ga0157369_100210333 328
284 3300013296 Ga0157374_10000134 Ga0157374_1000013457 328
285 3300013297 Ga0157378_10001179 Ga0157378_1000117921 328
286 3300013307 Ga0157372_10162906 Ga0157372_101629062 328
287 3300013308 Ga0157375_10000242 Ga0157375_1000024222 328
288 3300014745 Ga0157377_10021784 Ga0157377_100217843 328
289 3300014969 Ga0157376_10000111 Ga0157376_1000011118 328
290 3300025231 Ga0207427_100765 Ga0207427_1007658 328
291 3300025261 Ga0209233_1000003 Ga0209233_10000031262 328
292 3300025321 Ga0207656_10042917 Ga0207656_100429172 328
293 3300025904 Ga0207647_10033652 Ga0207647_100336523 328
294 3300025907 Ga0207645_10005071 Ga0207645_1000507110 328
295 3300025913 Ga0207695_10048674 Ga0207695_100486742 328
296 3300025919 Ga0207657_10001940 Ga0207657_1000194018 328
297 3300025923 Ga0207681_10049545 Ga0207681_100495452 328
298 3300025927 Ga0207687_10013629 Ga0207687_100136293 328
299 3300025934 Ga0207686_10000250 Ga0207686_1000025022 328
300 3300025935 Ga0207709_10000051 Ga0207709_10000051218 328
301 3300025938 Ga0207704_10000001 Ga0207704_1000000122 328
302 3300025942 Ga0207689_10000059 Ga0207689_1000005956 328
303 3300025949 Ga0207667_10426821 Ga0207667_104268211 328
304 3300025960 Ga0207651_10000006 Ga0207651_10000006217 328
305 3300025961 Ga0207712_10003624 Ga0207712_100036245 328
306 3300025972 Ga0207668_10000313 Ga0207668_100003135 328
307 3300025986 Ga0207658_10000159 Ga0207658_1000015954 328
308 3300026023 Ga0207677_10000251 Ga0207677_1000025120 328
309 3300026041 Ga0207639_10004254 Ga0207639_100042546 328
310 3300026041 Ga0207639_10023343 Ga0207639_100233433 328
311 3300026078 Ga0207702_10006148 Ga0207702_100061484 328
312 3300026088 Ga0207641_10000049 Ga0207641_1000004917 328
313 3300026089 Ga0207648_10000022 Ga0207648_10000022107 328
314 3300026116 Ga0207674_10003490 Ga0207674_1000349023 328
315 3300026118 Ga0207675_100244282 Ga0207675_1002442823 328
316 3300028381 Ga0268264_10001925 Ga0268264_1000192512 328
317 3300037312 Ga0395899_0012157 Ga0395899_0012157_59_1048 328
318 3300037418 Ga0395900_0553670 Ga0395900_0553670_40_1029 328
319 3300038443 Ga0395901_0036154 Ga0395901_0036154_3053_4039 328
320 3300038443 Ga0395901_0071415 Ga0395901_0071415_1632_2618 328
321 3300041997 Ga0439431_0001796 Ga0439431_0001796_801_1787 328
322 3300042002 Ga0439442_013096 Ga0439442_013096_178_1164 328
323 3300042004 Ga0439445_0002709 Ga0439445_0002709_1633_2619 328
324 3300042006 Ga0439432_000061 Ga0439432_000061_1763_2749 328
325 3300042015 Ga0439462_0006232 Ga0439462_0006232_400_1386 328
326 3300042435 Ga0439434_0000912 Ga0439434_0000912_3140_4126 328
327 3300046459 Ga0495629_0131858 Ga0495629_0131858_50_1045 328
328 3300046471 Ga0495650_0012970 Ga0495650_0012970_2234_3226 328
329 3300048920 Ga0496117_0030617 Ga0496117_0030617_535_1527 328
330 3300048921 Ga0496118_0008578 Ga0496118_0008578_8997_9989 328
331 3300048928 Ga0496125_0062597 Ga0496125_0062597_1547_2539 328
332 3300053087 Ga0500643_000137 Ga0500643_000137_3158_4150 328
333 3300055283 Ga0500661_000842 Ga0500661_000842_1719_2711 328
334 3300001904 JGI24736J21556_1000278 JGI24736J21556_10002789 329
335 3300001915 JGI24741J21665_1001457 JGI24741J21665_10014576 329
336 3300001979 JGI24740J21852_10001479 JGI24740J21852_100014795 329
337 3300001979 JGI24740J21852_10009375 JGI24740J21852_100093753 329
338 3300001989 JGI24739J22299_10007049 JGI24739J22299_100070494 329
339 3300001990 JGI24737J22298_10004084 JGI24737J22298_100040843 329
340 3300001990 JGI24737J22298_10034203 JGI24737J22298_100342032 329
341 3300002070 JGI24750J21931_1000228 JGI24750J21931_10002289 329
342 3300002074 JGI24748J21848_1000062 JGI24748J21848_10000624 329
343 3300002075 JGI24738J21930_10000825 JGI24738J21930_100008255 329
344 3300002076 JGI24749J21850_1001345 JGI24749J21850_10013455 329
345 3300002239 JGI24034J26672_10000028 JGI24034J26672_1000002883 329
346 3300003215 JGI25153J46596_10000021 JGI25153J46596_1000002121 329
347 3300003759 Ga0055525_1000070 Ga0055525_1000070126 329
348 3300003762 Ga0055542_1000102 Ga0055542_1000102100 329
349 3300003763 Ga0055529_1000136 Ga0055529_100013688 329
350 3300005327 Ga0070658_10000611 Ga0070658_100006118 329
351 3300005330 Ga0070690_100000003 Ga0070690_100000003113 329
352 3300005331 Ga0070670_100008607 Ga0070670_1000086078 329
353 3300005335 Ga0070666_10000006 Ga0070666_1000000678 329
354 3300005338 Ga0068868_100027515 Ga0068868_1000275154 329
355 3300005339 Ga0070660_100017257 Ga0070660_1000172573 329
356 3300005344 Ga0070661_100072177 Ga0070661_1000721772 329
357 3300005344 Ga0070661_100159803 Ga0070661_1001598032 329
358 3300005347 Ga0070668_100043344 Ga0070668_1000433442 329
359 3300005347 Ga0070668_100081706 Ga0070668_1000817062 329
360 3300005353 Ga0070669_100001833 Ga0070669_1000018338 329
361 3300005356 Ga0070674_100002600 Ga0070674_1000026001 329
362 3300005365 Ga0070688_100002243 Ga0070688_1000022433 329
363 3300005367 Ga0070667_100012288 Ga0070667_1000122886 329
364 3300005367 Ga0070667_100082230 Ga0070667_1000822304 329
365 3300005455 Ga0070663_100057355 Ga0070663_1000573552 329
366 3300005456 Ga0070678_100000175 Ga0070678_10000017531 329
367 3300005456 Ga0070678_100003484 Ga0070678_1000034844 329
368 3300005457 Ga0070662_100198543 Ga0070662_1001985431 329
369 3300005457 Ga0070662_100240974 Ga0070662_1002409742 329
370 3300005459 Ga0068867_100013678 Ga0068867_1000136786 329
371 3300005466 Ga0070685_10000072 Ga0070685_1000007210 329
372 3300005544 Ga0070686_100000022 Ga0070686_10000002251 329
373 3300005548 Ga0070665_100000019 Ga0070665_100000019310 329
374 3300005577 Ga0068857_100218684 Ga0068857_1002186841 329
375 3300005618 Ga0068864_100022260 Ga0068864_1000222605 329
376 3300005834 Ga0068851_10015156 Ga0068851_100151562 329
377 3300005841 Ga0068863_100000048 Ga0068863_10000004843 329
378 3300005842 Ga0068858_100007591 Ga0068858_1000075914 329
379 3300005843 Ga0068860_100000014 Ga0068860_10000001477 329
380 3300005844 Ga0068862_100000613 Ga0068862_10000061335 329
381 3300005985 Ga0081539_10019897 Ga0081539_100198973 329
382 3300006186 Ga0075369_10021312 Ga0075369_100213123 329
383 3300009148 Ga0105243_10000222 Ga0105243_1000022220 329
384 3300009174 Ga0105241_10002643 Ga0105241_100026436 329
385 3300009177 Ga0105248_10095109 Ga0105248_100951093 329
386 3300009553 Ga0105249_10000104 Ga0105249_1000010442 329
387 3300010375 Ga0105239_10080033 Ga0105239_100800333 329
388 3300012513 Ga0157326_1003975 Ga0157326_10039752 329
389 3300013100 Ga0157373_10141361 Ga0157373_101413611 329
390 3300013100 Ga0157373_10190886 Ga0157373_101908862 329
391 3300013102 Ga0157371_10000066 Ga0157371_1000006688 329
392 3300013104 Ga0157370_10016012 Ga0157370_100160125 329
393 3300013104 Ga0157370_10259886 Ga0157370_102598861 329
394 3300013105 Ga0157369_10038117 Ga0157369_100381173 329
395 3300013105 Ga0157369_10052174 Ga0157369_100521742 329
396 3300013306 Ga0163162_10203112 Ga0163162_102031122 329
397 3300013307 Ga0157372_10324574 Ga0157372_103245742 329
398 3300013307 Ga0157372_10613967 Ga0157372_106139671 329
399 3300014326 Ga0157380_10005135 Ga0157380_100051357 329
400 3300017792 Ga0163161_10000020 Ga0163161_1000002040 329
401 3300025226 Ga0209674_102934 Ga0209674_1029344 329
402 3300025230 Ga0209563_100053 Ga0209563_10005370 329
403 3300025250 Ga0209026_1006768 Ga0209026_10067684 329
404 3300025253 Ga0209677_106246 Ga0209677_1062464 329
405 3300025254 Ga0209148_1000159 Ga0209148_1000159122 329
406 3300025272 Ga0209455_1000045 Ga0209455_100004521 329
407 3300025297 Ga0209758_1000023 Ga0209758_1000023262 329
408 3300025321 Ga0207656_10002317 Ga0207656_100023175 329
409 3300025903 Ga0207680_10000011 Ga0207680_1000001176 329
410 3300025904 Ga0207647_10000312 Ga0207647_1000031218 329
411 3300025909 Ga0207705_10000456 Ga0207705_100004563 329
412 3300025909 Ga0207705_10088799 Ga0207705_100887992 329
413 3300025911 Ga0207654_10009333 Ga0207654_100093332 329
414 3300025913 Ga0207695_10002974 Ga0207695_1000297422 329
415 3300025914 Ga0207671_10001453 Ga0207671_100014533 329
416 3300025914 Ga0207671_10006388 Ga0207671_100063885 329
417 3300025919 Ga0207657_10016196 Ga0207657_100161966 329
418 3300025920 Ga0207649_10000069 Ga0207649_1000006969 329
419 3300025920 Ga0207649_10073759 Ga0207649_100737592 329
420 3300025923 Ga0207681_10000045 Ga0207681_10000045100 329
421 3300025924 Ga0207694_10005782 Ga0207694_100057829 329
422 3300025924 Ga0207694_10008940 Ga0207694_100089407 329
423 3300025925 Ga0207650_10096956 Ga0207650_100969562 329
424 3300025925 Ga0207650_10104402 Ga0207650_101044021 329
425 3300025931 Ga0207644_10001102 Ga0207644_1000110211 329
426 3300025932 Ga0207690_10000846 Ga0207690_1000084620 329
427 3300025935 Ga0207709_10000047 Ga0207709_10000047172 329
428 3300025937 Ga0207669_10000508 Ga0207669_100005086 329
429 3300025941 Ga0207711_10006119 Ga0207711_100061193 329
430 3300025949 Ga0207667_10000001 Ga0207667_10000001121 329
431 3300025949 Ga0207667_10016642 Ga0207667_100166422 329
432 3300025960 Ga0207651_10180758 Ga0207651_101807582 329
433 3300025961 Ga0207712_10000013 Ga0207712_1000001376 329
434 3300025972 Ga0207668_10050054 Ga0207668_100500544 329
435 3300025972 Ga0207668_10078823 Ga0207668_100788232 329
436 3300025981 Ga0207640_10009764 Ga0207640_100097642 329
437 3300025981 Ga0207640_10101329 Ga0207640_101013292 329
438 3300025986 Ga0207658_10001075 Ga0207658_1000107517 329
439 3300026023 Ga0207677_10057934 Ga0207677_100579343 329
440 3300026035 Ga0207703_10000888 Ga0207703_1000088832 329
441 3300026041 Ga0207639_10000379 Ga0207639_100003792 329
442 3300026067 Ga0207678_10002708 Ga0207678_100027084 329
443 3300026067 Ga0207678_10021653 Ga0207678_100216535 329
444 3300026078 Ga0207702_10001108 Ga0207702_1000110822 329
445 3300026078 Ga0207702_10027313 Ga0207702_100273132 329
446 3300026088 Ga0207641_10000101 Ga0207641_100001012 329
447 3300026095 Ga0207676_10002582 Ga0207676_100025827 329
448 3300026116 Ga0207674_10282219 Ga0207674_102822192 329
449 3300026118 Ga0207675_100000640 Ga0207675_1000006407 329
450 3300026121 Ga0207683_10000882 Ga0207683_100008821 329
451 3300026121 Ga0207683_10059531 Ga0207683_100595311 329
452 3300026142 Ga0207698_10000220 Ga0207698_1000022036 329
453 3300028379 Ga0268266_10000025 Ga0268266_10000025193 329
454 3300028380 Ga0268265_10000345 Ga0268265_1000034543 329
455 3300028381 Ga0268264_10000037 Ga0268264_1000003776 329
456 3300031456 Ga0307513_10004798 Ga0307513_100047986 329
457 3300037312 Ga0395899_0028173 Ga0395899_0028173_1185_2183 329
458 3300046471 Ga0495650_0000491 Ga0495650_0000491_14757_15755 329
459 3300046491 Ga0495584_0053178 Ga0495584_0053178_323_1321 329
460 3300046492 Ga0495585_0005748 Ga0495585_0005748_6301_7299 329
461 3300046501 Ga0495607_0042348 Ga0495607_0042348_105_1097 329
462 3300046506 Ga0495583_0001935 Ga0495583_0001935_14735_15733 329
463 3300046506 Ga0495583_0029621 Ga0495583_0029621_1231_2229 329
464 3300046506 Ga0495583_0036850 Ga0495583_0036850_757_1755 329
465 3300046507 Ga0495606_0000379 Ga0495606_0000379_12244_13242 329
466 3300046507 Ga0495606_0048488 Ga0495606_0048488_274_1272 329
467 3300046522 Ga0495643_0001764 Ga0495643_0001764_4609_5607 329
468 3300046522 Ga0495643_0002663 Ga0495643_0002663_1409_2407 329
469 3300046524 Ga0495648_0000444 Ga0495648_0000444_35121_36119 329
470 3300046525 Ga0495663_0000341 Ga0495663_0000341_12877_13875 329
471 3300046528 Ga0495642_0054486 Ga0495642_0054486_397_1395 329
472 3300046542 Ga0495597_0065307 Ga0495597_0065307_270_1268 329
473 3300046557 Ga0495622_0002047 Ga0495622_0002047_457_1455 329
474 3300046558 Ga0495633_0004374 Ga0495633_0004374_2980_3978 329
475 3300046616 Ga0495668_0000548 Ga0495668_0000548_549_1547 329
476 3300046648 Ga0495611_0005333 Ga0495611_0005333_3185_4183 329
477 3300046648 Ga0495611_0102881 Ga0495611_0102881_46_1044 329
478 3300046660 Ga0495625_0000971 Ga0495625_0000971_12388_13386 329
479 3300046660 Ga0495625_0093982 Ga0495625_0093982_459_1457 329
480 3300046665 Ga0495661_0151100 Ga0495661_0151100_35_1033 329
481 3300046684 Ga0495669_0000378 Ga0495669_0000378_14895_15893 329
482 3300046809 Ga0495600_0029068 Ga0495600_0029068_1968_2966 329
483 3300046810 Ga0495660_0027691 Ga0495660_0027691_1627_2625 329
484 3300047443 Ga0495687_000192 Ga0495687_000192_80502_81500 329
485 3300047443 Ga0495687_012328 Ga0495687_012328_459_1457 329
486 3300047445 Ga0495677_0048013 Ga0495677_0048013_434_1432 329
487 3300047470 Ga0495681_0005121 Ga0495681_0005121_7665_8663 329
488 3300047472 Ga0495686_0001111 Ga0495686_0001111_26725_27723 329
489 3300048905 Ga0496102_0000049 Ga0496102_0000049_126260_127252 329
490 3300048905 Ga0496102_0001816 Ga0496102_0001816_12807_13805 329
491 3300048906 Ga0496103_0000037 Ga0496103_0000037_52223_53215 329
492 3300048906 Ga0496103_0000177 Ga0496103_0000177_3061_4059 329
493 3300048907 Ga0496104_0003305 Ga0496104_0003305_3100_4098 329
494 3300048908 Ga0496105_0005988 Ga0496105_0005988_4553_5551 329
495 3300048909 Ga0496106_0076540 Ga0496106_0076540_1115_2104 329
496 3300048913 Ga0496110_0032029 Ga0496110_0032029_2618_3616 329
497 3300048914 Ga0496111_0245733 Ga0496111_0245733_220_1218 329
498 3300048918 Ga0496115_0000410 Ga0496115_0000410_29383_30381 329
499 3300048919 Ga0496116_0003064 Ga0496116_0003064_3045_4043 329
500 3300048919 Ga0496116_0007919 Ga0496116_0007919_7099_8091 329
501 3300048920 Ga0496117_0000115 Ga0496117_0000115_126260_127252 329
502 3300048920 Ga0496117_0001327 Ga0496117_0001327_12726_13724 329
503 3300048921 Ga0496118_0000086 Ga0496118_0000086_52237_53229 329
504 3300048921 Ga0496118_0004352 Ga0496118_0004352_2996_3994 329
505 3300048922 Ga0496119_0025524 Ga0496119_0025524_360_1358 329
506 3300048923 Ga0496120_0073501 Ga0496120_0073501_644_1636 329
507 3300048924 Ga0496121_0023324 Ga0496121_0023324_4027_5025 329
508 3300048925 Ga0496122_0008312 Ga0496122_0008312_9790_10788 329
509 3300048927 Ga0496124_0000102 Ga0496124_0000102_52237_53229 329
510 3300048927 Ga0496124_0003194 Ga0496124_0003194_12862_13860 329
511 3300048928 Ga0496125_0003670 Ga0496125_0003670_4449_5447 329
512 3300048929 Ga0496126_0000467 Ga0496126_0000467_12853_13851 329
513 3300049513 Ga0501290_002015 Ga0501290_002015_454_1446 329
514 3300049515 Ga0501292_000015 Ga0501292_000015_62175_63167 329
515 3300049517 Ga0501294_000034 Ga0501294_000034_12556_13548 329
516 3300049523 Ga0501300_000543 Ga0501300_000543_460_1452 329
517 3300049531 Ga0501315_002062 Ga0501315_002062_390_1382 329
518 3300049662 Ga0501222_000470 Ga0501222_000470_4882_5874 329
519 3300049664 Ga0501224_001100 Ga0501224_001100_515_1507 329
520 3300049668 Ga0501233_001690 Ga0501233_001690_2525_3517 329
521 3300049669 Ga0501235_000937 Ga0501235_000937_103_1095 329
522 3300049686 Ga0501257_008979 Ga0501257_008979_168_1160 329
523 3300049688 Ga0501259_001871 Ga0501259_001871_1372_2364 329
524 3300049690 Ga0501261_001713 Ga0501261_001713_834_1826 329
525 3300049705 Ga0501225_0001874 Ga0501225_0001874_1166_2158 329
526 3300049775 Ga0501279_000015 Ga0501279_000015_62231_63223 329
527 3300049776 Ga0501280_000226 Ga0501280_000226_11701_12693 329
528 3300049777 Ga0501281_00176 Ga0501281_00176_586_1578 329
529 3300053079 Ga0500610_0001803 Ga0500610_0001803_136_1134 329
530 3300053087 Ga0500643_000166 Ga0500643_000166_14355_15350 329
531 3300053130 Ga0500642_0000389 Ga0500642_0000389_12871_13869 329
532 3300053177 Ga0500636_0000568 Ga0500636_0000568_9846_10844 329
533 3300053730 Ga0500645_000116 Ga0500645_000116_57006_58004 329
534 3300005295 Ga0065707_10120781 Ga0065707_101207811 330
535 3300005331 Ga0070670_100000209 Ga0070670_10000020919 330
536 3300005347 Ga0070668_100000028 Ga0070668_10000002819 330
537 3300005355 Ga0070671_100000750 Ga0070671_1000007509 330
538 3300005367 Ga0070667_100000127 Ga0070667_10000012715 330
539 3300005548 Ga0070665_100104964 Ga0070665_1001049643 330
540 3300005617 Ga0068859_100020455 Ga0068859_1000204553 330
541 3300005617 Ga0068859_100062524 Ga0068859_1000625244 330
542 3300005618 Ga0068864_100000062 Ga0068864_10000006239 330
543 3300005841 Ga0068863_100000064 Ga0068863_10000006496 330
544 3300005841 Ga0068863_100000092 Ga0068863_10000009294 330
545 3300005841 Ga0068863_100008963 Ga0068863_1000089634 330
546 3300005843 Ga0068860_100012465 Ga0068860_1000124655 330
547 3300005844 Ga0068862_100000079 Ga0068862_10000007985 330
548 3300005844 Ga0068862_100000149 Ga0068862_1000001493 330
549 3300006931 Ga0097620_100020455 Ga0097620_1000204553 330
550 3300006931 Ga0097620_100045333 Ga0097620_1000453332 330
551 3300006931 Ga0097620_100062523 Ga0097620_1000625232 330
552 3300009553 Ga0105249_10000056 Ga0105249_10000056150 330
553 3300013306 Ga0163162_10062080 Ga0163162_100620804 330
554 3300013308 Ga0157375_10339182 Ga0157375_103391822 330
555 3300021388 Ga0213875_10000606 Ga0213875_100006066 330
556 3300025735 Ga0207713_1004428 Ga0207713_10044288 330
557 3300025900 Ga0207710_10007599 Ga0207710_100075994 330
558 3300025925 Ga0207650_10000367 Ga0207650_1000036734 330
559 3300025931 Ga0207644_10000094 Ga0207644_1000009449 330
560 3300025941 Ga0207711_10000021 Ga0207711_1000002160 330
561 3300025961 Ga0207712_10000015 Ga0207712_10000015145 330
562 3300025961 Ga0207712_10001145 Ga0207712_100011453 330
563 3300025961 Ga0207712_10019149 Ga0207712_100191494 330
564 3300025972 Ga0207668_10001023 Ga0207668_100010236 330
565 3300025986 Ga0207658_10000424 Ga0207658_1000042414 330
566 3300026088 Ga0207641_10000004 Ga0207641_10000004397 330
567 3300026088 Ga0207641_10000107 Ga0207641_10000107100 330
568 3300026088 Ga0207641_10005433 Ga0207641_100054332 330
569 3300026095 Ga0207676_10000057 Ga0207676_10000057100 330
570 3300028380 Ga0268265_10000021 Ga0268265_1000002195 330
571 3300028380 Ga0268265_10000080 Ga0268265_10000080100 330
572 3300028381 Ga0268264_10000330 Ga0268264_1000033041 330
573 3300028381 Ga0268264_10002475 Ga0268264_1000247512 330
574 3300028786 Ga0307517_10016221 Ga0307517_100162215 330
575 3300031901 Ga0307406_10053216 Ga0307406_100532162 330
576 3300031903 Ga0307407_10026585 Ga0307407_100265852 330
577 3300031995 Ga0307409_100025655 Ga0307409_1000256552 330
578 3300032002 Ga0307416_100315910 Ga0307416_1003159101 330
579 3300036401 Ga0373937_0132943 Ga0373937_0132943_307_1299 330
580 3300037853 Ga0436364_0822555 Ga0436364_0822555_166350_167351 330
581 3300042004 Ga0439445_0005432 Ga0439445_0005432_1709_2701 330
582 3300042015 Ga0439462_0012507 Ga0439462_0012507_590_1582 330
583 3300042435 Ga0439434_0022240 Ga0439434_0022240_90_1082 330
584 3300046692 Ga0495671_0015865 Ga0495671_0015865_925_1923 330
585 3300049516 Ga0501293_001610 Ga0501293_001610_678_1673 330
586 3300049581 Ga0501047_0240125 Ga0501047_0240125_431_1423 330
587 3300049581 Ga0501047_0252223 Ga0501047_0252223_256_1254 330
588 3300049585 Ga0501069_0013786 Ga0501069_0013786_2322_3320 330
589 3300049586 Ga0501070_0211297 Ga0501070_0211297_306_1304 330
590 3300049686 Ga0501257_000133 Ga0501257_000133_1156_2151 330
591 3300049758 Ga0501241_007939 Ga0501241_007939_115_1107 330
592 3300053118 Ga0500594_0002524 Ga0500594_0002524_899_1897 330
593 3300053134 Ga0500658_0003044 Ga0500658_0003044_2445_3437 330
594 3300053739 Ga0500587_003581 Ga0500587_003581_142_1143 330
595 3300000041 ARcpr5oldR_c001007 ARcpr5oldR_0010073 331
596 3300002774 JGI25150J39212_1000096 JGI25150J39212_100009651 331
597 3300003187 JGI25151J46595_10014451 JGI25151J46595_100144511 331
598 3300003215 JGI25153J46596_10000028 JGI25153J46596_1000002887 331
599 3300003773 Ga0055537_1001847 Ga0055537_10018475 331
600 3300003775 Ga0055524_1000335 Ga0055524_100033528 331
601 3300003781 Ga0055536_1002813 Ga0055536_10028136 331
602 3300003791 Ga0055530_10000270 Ga0055530_1000027028 331
603 3300003792 Ga0055540_1002865 Ga0055540_10028655 331
604 3300003794 Ga0055531_10000371 Ga0055531_1000037129 331
605 3300012512 Ga0157327_1001315 Ga0157327_10013152 331
606 3300025245 Ga0207425_1000005 Ga0207425_100000587 331
607 3300025245 Ga0207425_1019426 Ga0207425_10194262 331
608 3300025258 Ga0209129_1000649 Ga0209129_10006492 331
609 3300025263 Ga0209565_1000030 Ga0209565_1000030205 331
610 3300025273 Ga0209673_1000768 Ga0209673_100076835 331
611 3300025291 Ga0209675_1000275 Ga0209675_100027534 331
612 3300025291 Ga0209675_1011380 Ga0209675_10113801 331
613 3300025292 Ga0209676_1000349 Ga0209676_100034952 331
614 3300025292 Ga0209676_1000648 Ga0209676_100064836 331
615 3300025292 Ga0209676_1003919 Ga0209676_10039195 331
616 3300025292 Ga0209676_1053111 Ga0209676_10531111 331
617 3300025294 Ga0209025_1000464 Ga0209025_100046412 331
618 3300025297 Ga0209758_1000002 Ga0209758_10000021257 331
619 3300025297 Ga0209758_1066035 Ga0209758_10660351 331
620 3300025298 Ga0209050_1000005 Ga0209050_1000005171 331
621 3300025298 Ga0209050_1000042 Ga0209050_1000042232 331
622 3300025298 Ga0209050_1006583 Ga0209050_10065836 331
623 3300025298 Ga0209050_1008927 Ga0209050_10089275 331
624 3300025299 Ga0209256_1000046 Ga0209256_100004680 331
625 3300025303 Ga0209051_1000153 Ga0209051_1000153137 331
626 3300025304 Ga0209257_1000135 Ga0209257_1000135155 331
627 3300025304 Ga0209257_1000533 Ga0209257_100053318 331
628 3300025304 Ga0209257_1002082 Ga0209257_100208216 331
629 3300025304 Ga0209257_1002135 Ga0209257_10021356 331
630 3300025304 Ga0209257_1024529 Ga0209257_10245292 331
631 3300031911 Ga0307412_10041222 Ga0307412_100412223 331
632 3300032004 Ga0307414_10043107 Ga0307414_100431071 331
633 3300046660 Ga0495625_0000652 Ga0495625_0000652_47757_48797 331
634 3300053094 Ga0500566_0049106 Ga0500566_0049106_933_1928 331
635 3300053139 Ga0500568_0001915 Ga0500568_0001915_10313_11356 331
636 3300053140 Ga0500573_0000086 Ga0500573_0000086_4412_5410 331
637 iso_pu_bacteria 2643221563 2643835877 331
638 iso_pu_bacteria 2643221608 2644056802 331
639 iso_pu_bacteria 2852653556 2852655462 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

207

337

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3myf-assembly1.cif.gz_A the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a 0.3913 165 288
5ona-assembly1.cif.gz_A drosophila bag-of-marbles cbm peptide bound to human caf40-cnot1 0.387 77 177
7ugw-assembly1.cif.gz_A m. tuberculosis dna gyrase cleavage core bound to dna and evybactin 0.3667 151 284
3myf-assembly1.cif.gz_A the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a 0.3568 165 288
5bta-assembly1.cif.gz_A crystal structure of a topoisomerase ii complex 0.3557 151 284
ID Description Score Start End Superfamily
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8044 190 311 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7839 190 317 1.20.81.30
af_I6Y479_96_222_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7662 190 317 1.20.81.30
af_O69625_45_175_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7489 190 311 1.20.81.30
af_O82178_465_589_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4137 189 281 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.8825 169 308 GO:0005886
AF-A0A532U2U0-F1-model_v4 Secretion system protein F 0.8749 81 294 GO:0005886
AF-A0A5R2N1Y6-F1-model_v4 Type II secretion system F family protein 0.8652 169 308 GO:0005886
AF-A0A7C6F4R4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.8646 118 294 GO:0005886
AF-A0A7J2Z1L9-F1-model_v4 Type II secretion system F family protein 0.86 91 295 GO:0005886

Feature Viewer

pLDDT pTM Quality
74.4 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map