F471647
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 639 | 333 | 618 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_001221|Ga0500643_001221_3059_4111 |
| Length | 350 |
| Sequence | MDVDRRLHHAPDDQFQDLTAMEHQVTPHFIQTLISIGLALATTIVILILGASLVRNMGRDPMARRVKALNDRREQLKAGVAASKTRRRAKQEKKSVSTVRMRKFLQALKMLQDSQLKVAQLNLSRAGIRTKDTAITVIFCRLVGPVLIGGTMVLGVYVLNWFPEAGPLKRYMIVAASLLLSYKGPDIFVKNLITKRQVAIRRGLPDALDLLVICAEAGLTVDMAFNRVSRELGKAYPELGDEFSLTAIELGFLTDRRMAFDNLAQRANIDAIRDVVTTMIQTEKYGTPLAAALRTLSADFRHTRMMKAEEKAARLPAIMTVPLILFILPVLFIVILGPAACSIKDHVLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 7 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 8 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 9 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 10 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 11 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 12 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 13 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 14 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 15 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 16 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 17 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 18 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 19 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 20 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 21 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 22 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 23 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 28 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 29 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 30 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 31 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 32 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 33 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 34 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 35 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 107 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 122 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 277 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 280 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 285 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 288 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 289 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 295 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 301 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 306 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 307 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 316 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 320 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 321 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 324 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 325 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 327 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 332 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 333 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.24 |
| Metatranscriptomes | 0.47 |
| Isolates | 3.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.47 |
| Bulb | 0 |
| Endosphere | 15.34 |
| Nodule | 0 |
| Rhizoplane | 2.35 |
| Rhizosphere | 73.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c001007 | 3300000041 | Bacteria | 3006 |
| 2 | JGI24736J21556_1000278 | 3300001904 | Bacteria | 9373 |
| 3 | JGI24736J21556_1000502 | 3300001904 | Bacteria | 7288 |
| 4 | JGI24741J21665_1000107 | 3300001915 | Bacteria | 22051 |
| 5 | JGI24741J21665_1001457 | 3300001915 | Bacteria | 6775 |
| 6 | JGI24741J21665_1009791 | 3300001915 | Bacteria | 1744 |
| 7 | JGI24740J21852_10001479 | 3300001979 | Bacteria | 10791 |
| 8 | JGI24740J21852_10009011 | 3300001979 | Bacteria | 3934 |
| 9 | JGI24740J21852_10009375 | 3300001979 | Bacteria | 3836 |
| 10 | JGI24740J21852_10037438 | 3300001979 | Bacteria | 1498 |
| 11 | JGI24739J22299_10005370 | 3300001989 | Bacteria | 4878 |
| 12 | JGI24739J22299_10007049 | 3300001989 | Bacteria | 4229 |
| 13 | JGI24737J22298_10002879 | 3300001990 | Bacteria | 6104 |
| 14 | JGI24737J22298_10004084 | 3300001990 | Bacteria | 5098 |
| 15 | JGI24737J22298_10034203 | 3300001990 | Bacteria | 1576 |
| 16 | JGI24737J22298_10058939 | 3300001990 | Bacteria | 1157 |
| 17 | JGI24735J21928_10003861 | 3300002067 | Bacteria | 5072 |
| 18 | JGI24735J21928_10004443 | 3300002067 | Bacteria | 4716 |
| 19 | JGI24735J21928_10020838 | 3300002067 | Bacteria | 2006 |
| 20 | JGI24735J21928_10042522 | 3300002067 | Bacteria | 1323 |
| 21 | JGI24750J21931_1000228 | 3300002070 | Bacteria | 9572 |
| 22 | JGI24748J21848_1000062 | 3300002074 | Bacteria | 40740 |
| 23 | JGI24738J21930_10000825 | 3300002075 | Bacteria | 8869 |
| 24 | JGI24738J21930_10001993 | 3300002075 | Bacteria | 5489 |
| 25 | JGI24749J21850_1001345 | 3300002076 | Bacteria | 3488 |
| 26 | JGI24034J26672_10000028 | 3300002239 | Bacteria | 105058 |
| 27 | JGI25150J39212_1000096 | 3300002774 | Bacteria | 50476 |
| 28 | JGI25151J46595_10014451 | 3300003187 | Bacteria | 3515 |
| 29 | JGI25165J46597_1000021 | 3300003214 | Bacteria | 359288 |
| 30 | JGI25165J46597_1000173 | 3300003214 | Bacteria | 100834 |
| 31 | JGI25153J46596_10000021 | 3300003215 | Bacteria | 252651 |
| 32 | JGI25153J46596_10000028 | 3300003215 | Bacteria | 209842 |
| 33 | Ga0055525_1000070 | 3300003759 | Bacteria | 183047 |
| 34 | Ga0055542_1000102 | 3300003762 | Bacteria | 115614 |
| 35 | Ga0055529_1000136 | 3300003763 | Bacteria | 104102 |
| 36 | Ga0055537_1001305 | 3300003773 | Bacteria | 10227 |
| 37 | Ga0055537_1001847 | 3300003773 | Bacteria | 7645 |
| 38 | Ga0055524_1000335 | 3300003775 | Bacteria | 43434 |
| 39 | Ga0055536_1002813 | 3300003781 | Bacteria | 9601 |
| 40 | Ga0055530_10000270 | 3300003791 | Bacteria | 46941 |
| 41 | Ga0055540_1002865 | 3300003792 | Bacteria | 8763 |
| 42 | Ga0055531_10000371 | 3300003794 | Bacteria | 43284 |
| 43 | Ga0055531_10004998 | 3300003794 | Bacteria | 7866 |
| 44 | Ga0065165_1001326 | 3300005262 | Bacteria | 27536 |
| 45 | Ga0065165_1003242 | 3300005262 | Bacteria | 11791 |
| 46 | Ga0065704_10086168 | 3300005289 | Bacteria | 3147 |
| 47 | Ga0065704_10122327 | 3300005289 | Bacteria | 1741 |
| 48 | Ga0065707_10116834 | 3300005295 | Bacteria | 2226 |
| 49 | Ga0065707_10120781 | 3300005295 | Bacteria | 2125 |
| 50 | Ga0065707_10158556 | 3300005295 | Bacteria | 1585 |
| 51 | Ga0070658_10000611 | 3300005327 | Bacteria | 30913 |
| 52 | Ga0070658_10000967 | 3300005327 | Bacteria | 24637 |
| 53 | Ga0070658_10068159 | 3300005327 | Bacteria | 2908 |
| 54 | Ga0070676_10000029 | 3300005328 | Bacteria | 43536 |
| 55 | Ga0070690_100000003 | 3300005330 | Bacteria | 144748 |
| 56 | Ga0070670_100000209 | 3300005331 | Bacteria | 54253 |
| 57 | Ga0070670_100008607 | 3300005331 | Bacteria | 8707 |
| 58 | Ga0068869_100001320 | 3300005334 | Bacteria | 14687 |
| 59 | Ga0070666_10000006 | 3300005335 | Bacteria | 319173 |
| 60 | Ga0068868_100000139 | 3300005338 | Bacteria | 46645 |
| 61 | Ga0068868_100027515 | 3300005338 | Bacteria | 4339 |
| 62 | Ga0070660_100000692 | 3300005339 | Bacteria | 22324 |
| 63 | Ga0070660_100002653 | 3300005339 | Bacteria | 12288 |
| 64 | Ga0070660_100017257 | 3300005339 | Bacteria | 5259 |
| 65 | Ga0070661_100072177 | 3300005344 | Bacteria | 2540 |
| 66 | Ga0070661_100072734 | 3300005344 | Bacteria | 2530 |
| 67 | Ga0070661_100159803 | 3300005344 | Bacteria | 1706 |
| 68 | Ga0070668_100000028 | 3300005347 | Bacteria | 89707 |
| 69 | Ga0070668_100000993 | 3300005347 | Bacteria | 19904 |
| 70 | Ga0070668_100043344 | 3300005347 | Bacteria | 3451 |
| 71 | Ga0070668_100081706 | 3300005347 | Bacteria | 2534 |
| 72 | Ga0070669_100001833 | 3300005353 | Bacteria | 15325 |
| 73 | Ga0070669_100037973 | 3300005353 | Bacteria | 3495 |
| 74 | Ga0070669_100059756 | 3300005353 | Bacteria | 2799 |
| 75 | Ga0070669_100157572 | 3300005353 | Bacteria | 1762 |
| 76 | Ga0070671_100000750 | 3300005355 | Bacteria | 23268 |
| 77 | Ga0070671_100136506 | 3300005355 | Bacteria | 2068 |
| 78 | Ga0070674_100002600 | 3300005356 | Bacteria | 9991 |
| 79 | Ga0070673_100000013 | 3300005364 | Bacteria | 137021 |
| 80 | Ga0070688_100002243 | 3300005365 | Bacteria | 9748 |
| 81 | Ga0070659_100092389 | 3300005366 | Bacteria | 2426 |
| 82 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 83 | Ga0070667_100000127 | 3300005367 | Bacteria | 95853 |
| 84 | Ga0070667_100000199 | 3300005367 | Bacteria | 71115 |
| 85 | Ga0070667_100012288 | 3300005367 | Bacteria | 7083 |
| 86 | Ga0070667_100082230 | 3300005367 | Bacteria | 2757 |
| 87 | Ga0070667_100281697 | 3300005367 | Bacteria | 1493 |
| 88 | Ga0070667_100381647 | 3300005367 | Bacteria | 1280 |
| 89 | Ga0070663_100001752 | 3300005455 | Bacteria | 12072 |
| 90 | Ga0070663_100057355 | 3300005455 | Bacteria | 2793 |
| 91 | Ga0070678_100000175 | 3300005456 | Bacteria | 27570 |
| 92 | Ga0070678_100003484 | 3300005456 | Bacteria | 8769 |
| 93 | Ga0070662_100198543 | 3300005457 | Bacteria | 1590 |
| 94 | Ga0070662_100240974 | 3300005457 | Bacteria | 1450 |
| 95 | Ga0068867_100000009 | 3300005459 | Bacteria | 137021 |
| 96 | Ga0068867_100013678 | 3300005459 | Bacteria | 5747 |
| 97 | Ga0070685_10000072 | 3300005466 | Bacteria | 59953 |
| 98 | Ga0068853_100000819 | 3300005539 | Bacteria | 21710 |
| 99 | Ga0068853_100141762 | 3300005539 | Bacteria | 2158 |
| 100 | Ga0070672_100117950 | 3300005543 | Bacteria | 2170 |
| 101 | Ga0070686_100000022 | 3300005544 | Bacteria | 131168 |
| 102 | Ga0070693_100154324 | 3300005547 | Bacteria | 1457 |
| 103 | Ga0070665_100000019 | 3300005548 | Bacteria | 413972 |
| 104 | Ga0070665_100000021 | 3300005548 | Bacteria | 389668 |
| 105 | Ga0070665_100104964 | 3300005548 | Bacteria | 2828 |
| 106 | Ga0070665_100416648 | 3300005548 | Bacteria | 1352 |
| 107 | Ga0068855_100178788 | 3300005563 | Bacteria | 2400 |
| 108 | Ga0068857_100019321 | 3300005577 | Bacteria | 5981 |
| 109 | Ga0068857_100218684 | 3300005577 | Bacteria | 1739 |
| 110 | Ga0068856_100028579 | 3300005614 | Bacteria | 5445 |
| 111 | Ga0068859_100020455 | 3300005617 | Bacteria | 6642 |
| 112 | Ga0068859_100062524 | 3300005617 | Bacteria | 3753 |
| 113 | Ga0068864_100000062 | 3300005618 | Bacteria | 121206 |
| 114 | Ga0068864_100001277 | 3300005618 | Bacteria | 20922 |
| 115 | Ga0068864_100022260 | 3300005618 | Bacteria | 5313 |
| 116 | Ga0068861_100000061 | 3300005719 | Bacteria | 51630 |
| 117 | Ga0068851_10015119 | 3300005834 | Bacteria | 3674 |
| 118 | Ga0068851_10015156 | 3300005834 | Bacteria | 3669 |
| 119 | Ga0068863_100000029 | 3300005841 | Bacteria | 177191 |
| 120 | Ga0068863_100000048 | 3300005841 | Bacteria | 135912 |
| 121 | Ga0068863_100000064 | 3300005841 | Bacteria | 118153 |
| 122 | Ga0068863_100000092 | 3300005841 | Bacteria | 97076 |
| 123 | Ga0068863_100008963 | 3300005841 | Bacteria | 9770 |
| 124 | Ga0068858_100000414 | 3300005842 | Bacteria | 44330 |
| 125 | Ga0068858_100003008 | 3300005842 | Bacteria | 16905 |
| 126 | Ga0068858_100007591 | 3300005842 | Bacteria | 10479 |
| 127 | Ga0068860_100000014 | 3300005843 | Bacteria | 319437 |
| 128 | Ga0068860_100000196 | 3300005843 | Bacteria | 97096 |
| 129 | Ga0068860_100002353 | 3300005843 | Bacteria | 19855 |
| 130 | Ga0068860_100012465 | 3300005843 | Bacteria | 8372 |
| 131 | Ga0068862_100000079 | 3300005844 | Bacteria | 113551 |
| 132 | Ga0068862_100000149 | 3300005844 | Bacteria | 79784 |
| 133 | Ga0068862_100000613 | 3300005844 | Bacteria | 37071 |
| 134 | Ga0068862_100053430 | 3300005844 | Bacteria | 3458 |
| 135 | Ga0081455_10000175 | 3300005937 | Bacteria | 80027 |
| 136 | Ga0081539_10019897 | 3300005985 | Bacteria | 4570 |
| 137 | Ga0075368_10001402 | 3300006042 | Bacteria | 7693 |
| 138 | Ga0075367_10000205 | 3300006178 | Bacteria | 19719 |
| 139 | Ga0075367_10162903 | 3300006178 | Bacteria | 1387 |
| 140 | Ga0075369_10021312 | 3300006186 | Bacteria | 2661 |
| 141 | Ga0068865_100000005 | 3300006881 | Bacteria | 213248 |
| 142 | Ga0097620_100020455 | 3300006931 | Bacteria | 6642 |
| 143 | Ga0097620_100045333 | 3300006931 | Bacteria | 4418 |
| 144 | Ga0097620_100062523 | 3300006931 | Bacteria | 3753 |
| 145 | Ga0105251_10000625 | 3300009011 | Bacteria | 32540 |
| 146 | Ga0105245_10000244 | 3300009098 | Bacteria | 52007 |
| 147 | Ga0105245_10013346 | 3300009098 | Bacteria | 7158 |
| 148 | Ga0105247_10007007 | 3300009101 | Bacteria | 6937 |
| 149 | Ga0105243_10000032 | 3300009148 | Bacteria | 183324 |
| 150 | Ga0105243_10000222 | 3300009148 | Bacteria | 65448 |
| 151 | Ga0105243_10080635 | 3300009148 | Bacteria | 2655 |
| 152 | Ga0105241_10002643 | 3300009174 | Bacteria | 13422 |
| 153 | Ga0105241_10003710 | 3300009174 | Bacteria | 11344 |
| 154 | Ga0105242_10000166 | 3300009176 | Bacteria | 49832 |
| 155 | Ga0105242_10506303 | 3300009176 | Bacteria | 1149 |
| 156 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 157 | Ga0105248_10006249 | 3300009177 | Bacteria | 13060 |
| 158 | Ga0105248_10095109 | 3300009177 | Bacteria | 3354 |
| 159 | Ga0105248_10099258 | 3300009177 | Bacteria | 3281 |
| 160 | Ga0105238_10043952 | 3300009551 | Bacteria | 4519 |
| 161 | Ga0105238_10257937 | 3300009551 | Bacteria | 1723 |
| 162 | Ga0105249_10000056 | 3300009553 | Bacteria | 160443 |
| 163 | Ga0105249_10000104 | 3300009553 | Bacteria | 118213 |
| 164 | Ga0105249_10001836 | 3300009553 | Bacteria | 18458 |
| 165 | Ga0105249_10002730 | 3300009553 | Bacteria | 15266 |
| 166 | Ga0105249_10016580 | 3300009553 | Bacteria | 6538 |
| 167 | Ga0105249_10100916 | 3300009553 | Bacteria | 2714 |
| 168 | Ga0105148_100043 | 3300009978 | Bacteria | 18692 |
| 169 | Ga0105239_10080033 | 3300010375 | Bacteria | 3595 |
| 170 | Ga0105246_10008273 | 3300011119 | Bacteria | 6389 |
| 171 | Ga0157327_1001315 | 3300012512 | Bacteria | 1533 |
| 172 | Ga0157326_1003975 | 3300012513 | Bacteria | 1554 |
| 173 | Ga0157373_10066776 | 3300013100 | Bacteria | 2543 |
| 174 | Ga0157373_10141361 | 3300013100 | Bacteria | 1693 |
| 175 | Ga0157373_10190886 | 3300013100 | Bacteria | 1444 |
| 176 | Ga0157371_10000066 | 3300013102 | Bacteria | 168406 |
| 177 | Ga0157371_10020886 | 3300013102 | Bacteria | 4815 |
| 178 | Ga0157371_10096344 | 3300013102 | Bacteria | 2097 |
| 179 | Ga0157370_10001083 | 3300013104 | Bacteria | 34095 |
| 180 | Ga0157370_10016012 | 3300013104 | Bacteria | 7606 |
| 181 | Ga0157370_10226994 | 3300013104 | Bacteria | 1729 |
| 182 | Ga0157370_10259886 | 3300013104 | Bacteria | 1605 |
| 183 | Ga0157369_10010603 | 3300013105 | Bacteria | 10489 |
| 184 | Ga0157369_10021033 | 3300013105 | Bacteria | 7294 |
| 185 | Ga0157369_10038117 | 3300013105 | Bacteria | 5258 |
| 186 | Ga0157369_10052174 | 3300013105 | Bacteria | 4426 |
| 187 | Ga0157369_10109922 | 3300013105 | Bacteria | 2930 |
| 188 | Ga0157369_10223889 | 3300013105 | Bacteria | 1968 |
| 189 | Ga0157374_10000134 | 3300013296 | Bacteria | 67433 |
| 190 | Ga0157378_10001179 | 3300013297 | Bacteria | 23765 |
| 191 | Ga0157378_10019764 | 3300013297 | Bacteria | 5923 |
| 192 | Ga0163162_10001705 | 3300013306 | Bacteria | 20605 |
| 193 | Ga0163162_10062080 | 3300013306 | Bacteria | 3776 |
| 194 | Ga0163162_10141442 | 3300013306 | Bacteria | 2520 |
| 195 | Ga0163162_10203112 | 3300013306 | Bacteria | 2111 |
| 196 | Ga0163162_10271226 | 3300013306 | Bacteria | 1828 |
| 197 | Ga0157372_10162906 | 3300013307 | Bacteria | 2578 |
| 198 | Ga0157372_10211356 | 3300013307 | Bacteria | 2248 |
| 199 | Ga0157372_10324574 | 3300013307 | Bacteria | 1792 |
| 200 | Ga0157372_10613967 | 3300013307 | Bacteria | 1267 |
| 201 | Ga0157372_10730494 | 3300013307 | Bacteria | 1151 |
| 202 | Ga0157375_10000242 | 3300013308 | Bacteria | 50251 |
| 203 | Ga0157375_10339182 | 3300013308 | Bacteria | 1668 |
| 204 | Ga0163163_10043130 | 3300014325 | Bacteria | 4421 |
| 205 | Ga0163163_10229418 | 3300014325 | Bacteria | 1906 |
| 206 | Ga0157380_10005135 | 3300014326 | Bacteria | 9148 |
| 207 | Ga0157380_10036797 | 3300014326 | Bacteria | 3789 |
| 208 | Ga0157377_10021784 | 3300014745 | Bacteria | 3376 |
| 209 | Ga0157376_10000111 | 3300014969 | Bacteria | 58460 |
| 210 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 211 | Ga0183361_10316 | 3300016635 | Bacteria | 1968 |
| 212 | Ga0163161_10000020 | 3300017792 | Bacteria | 214642 |
| 213 | Ga0163161_10024192 | 3300017792 | Bacteria | 4289 |
| 214 | Ga0206354_10830840 | 3300020081 | Bacteria | 1715 |
| 215 | Ga0206353_11220810 | 3300020082 | Bacteria | 6693 |
| 216 | Ga0213875_10000606 | 3300021388 | Bacteria | 29042 |
| 217 | Ga0209674_102934 | 3300025226 | Bacteria | 3353 |
| 218 | Ga0209147_103310 | 3300025229 | Bacteria | 3213 |
| 219 | Ga0209563_100053 | 3300025230 | Bacteria | 332370 |
| 220 | Ga0207427_100765 | 3300025231 | Bacteria | 14626 |
| 221 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 222 | Ga0207425_1019426 | 3300025245 | Bacteria | 1462 |
| 223 | Ga0209026_1006768 | 3300025250 | Bacteria | 2728 |
| 224 | Ga0209677_106246 | 3300025253 | Bacteria | 2869 |
| 225 | Ga0209148_1000159 | 3300025254 | Bacteria | 139560 |
| 226 | Ga0209129_1000649 | 3300025258 | Bacteria | 23347 |
| 227 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 228 | Ga0209233_1000065 | 3300025261 | Bacteria | 387195 |
| 229 | Ga0209565_1000030 | 3300025263 | Bacteria | 325058 |
| 230 | Ga0209565_1000056 | 3300025263 | Bacteria | 200189 |
| 231 | Ga0209455_1000045 | 3300025272 | Bacteria | 383329 |
| 232 | Ga0209455_1015249 | 3300025272 | Bacteria | 1698 |
| 233 | Ga0209673_1000768 | 3300025273 | Bacteria | 43336 |
| 234 | Ga0209675_1000275 | 3300025291 | Bacteria | 49474 |
| 235 | Ga0209675_1011380 | 3300025291 | Bacteria | 2955 |
| 236 | Ga0209676_1000085 | 3300025292 | Bacteria | 273425 |
| 237 | Ga0209676_1000349 | 3300025292 | Bacteria | 87517 |
| 238 | Ga0209676_1000648 | 3300025292 | Bacteria | 49941 |
| 239 | Ga0209676_1003919 | 3300025292 | Bacteria | 8634 |
| 240 | Ga0209676_1053111 | 3300025292 | Bacteria | 1053 |
| 241 | Ga0209025_1000464 | 3300025294 | Bacteria | 79341 |
| 242 | Ga0209564_1001019 | 3300025295 | Bacteria | 34584 |
| 243 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 244 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 245 | Ga0209758_1066035 | 3300025297 | Bacteria | 1164 |
| 246 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 247 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 248 | Ga0209050_1006583 | 3300025298 | Bacteria | 6823 |
| 249 | Ga0209050_1008927 | 3300025298 | Bacteria | 5235 |
| 250 | Ga0209256_1000046 | 3300025299 | Bacteria | 325040 |
| 251 | Ga0207426_1039161 | 3300025302 | Bacteria | 1487 |
| 252 | Ga0209051_1000153 | 3300025303 | Bacteria | 131166 |
| 253 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 254 | Ga0209257_1000482 | 3300025304 | Bacteria | 72375 |
| 255 | Ga0209257_1000533 | 3300025304 | Bacteria | 66037 |
| 256 | Ga0209257_1002082 | 3300025304 | Bacteria | 21069 |
| 257 | Ga0209257_1002135 | 3300025304 | Bacteria | 20606 |
| 258 | Ga0209257_1024529 | 3300025304 | Bacteria | 2086 |
| 259 | Ga0207656_10002317 | 3300025321 | Bacteria | 6390 |
| 260 | Ga0207656_10021344 | 3300025321 | Bacteria | 2586 |
| 261 | Ga0207656_10042917 | 3300025321 | Bacteria | 1927 |
| 262 | Ga0207713_1004428 | 3300025735 | Bacteria | 9106 |
| 263 | Ga0207710_10007599 | 3300025900 | Bacteria | 4585 |
| 264 | Ga0207680_10000011 | 3300025903 | Bacteria | 391225 |
| 265 | Ga0207647_10000312 | 3300025904 | Bacteria | 40325 |
| 266 | Ga0207647_10007098 | 3300025904 | Bacteria | 8124 |
| 267 | Ga0207647_10018586 | 3300025904 | Bacteria | 4696 |
| 268 | Ga0207647_10033652 | 3300025904 | Bacteria | 3280 |
| 269 | Ga0207645_10005071 | 3300025907 | Bacteria | 9644 |
| 270 | Ga0207705_10000456 | 3300025909 | Bacteria | 35093 |
| 271 | Ga0207705_10000875 | 3300025909 | Bacteria | 24669 |
| 272 | Ga0207705_10052970 | 3300025909 | Bacteria | 2923 |
| 273 | Ga0207705_10088799 | 3300025909 | Bacteria | 2261 |
| 274 | Ga0207654_10009333 | 3300025911 | Bacteria | 4980 |
| 275 | Ga0207654_10020536 | 3300025911 | Bacteria | 3503 |
| 276 | Ga0207695_10002974 | 3300025913 | Bacteria | 24437 |
| 277 | Ga0207695_10048674 | 3300025913 | Bacteria | 4475 |
| 278 | Ga0207695_10069656 | 3300025913 | Bacteria | 3599 |
| 279 | Ga0207671_10001453 | 3300025914 | Bacteria | 27348 |
| 280 | Ga0207671_10006388 | 3300025914 | Bacteria | 10508 |
| 281 | Ga0207657_10001940 | 3300025919 | Bacteria | 22345 |
| 282 | Ga0207657_10003878 | 3300025919 | Bacteria | 15869 |
| 283 | Ga0207657_10004639 | 3300025919 | Bacteria | 14521 |
| 284 | Ga0207657_10016196 | 3300025919 | Bacteria | 7197 |
| 285 | Ga0207649_10000069 | 3300025920 | Bacteria | 91425 |
| 286 | Ga0207649_10073759 | 3300025920 | Bacteria | 2187 |
| 287 | Ga0207681_10000045 | 3300025923 | Bacteria | 128454 |
| 288 | Ga0207681_10049545 | 3300025923 | Bacteria | 2839 |
| 289 | Ga0207681_10135236 | 3300025923 | Bacteria | 1828 |
| 290 | Ga0207681_10191261 | 3300025923 | Bacteria | 1566 |
| 291 | Ga0207694_10005782 | 3300025924 | Bacteria | 9472 |
| 292 | Ga0207694_10008940 | 3300025924 | Bacteria | 7563 |
| 293 | Ga0207694_10025396 | 3300025924 | Bacteria | 4504 |
| 294 | Ga0207694_10049392 | 3300025924 | Bacteria | 3257 |
| 295 | Ga0207650_10000367 | 3300025925 | Bacteria | 42933 |
| 296 | Ga0207650_10096956 | 3300025925 | Bacteria | 2263 |
| 297 | Ga0207650_10104402 | 3300025925 | Bacteria | 2186 |
| 298 | Ga0207687_10005555 | 3300025927 | Bacteria | 8332 |
| 299 | Ga0207687_10013629 | 3300025927 | Bacteria | 5307 |
| 300 | Ga0207644_10000094 | 3300025931 | Bacteria | 64592 |
| 301 | Ga0207644_10001102 | 3300025931 | Bacteria | 17341 |
| 302 | Ga0207644_10104327 | 3300025931 | Bacteria | 2134 |
| 303 | Ga0207690_10000846 | 3300025932 | Bacteria | 19607 |
| 304 | Ga0207706_10057717 | 3300025933 | Bacteria | 3419 |
| 305 | Ga0207686_10000250 | 3300025934 | Bacteria | 40936 |
| 306 | Ga0207686_10093872 | 3300025934 | Bacteria | 1988 |
| 307 | Ga0207709_10000047 | 3300025935 | Bacteria | 238649 |
| 308 | Ga0207709_10000051 | 3300025935 | Bacteria | 227968 |
| 309 | Ga0207709_10050177 | 3300025935 | Bacteria | 2550 |
| 310 | Ga0207669_10000508 | 3300025937 | Bacteria | 16974 |
| 311 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 312 | Ga0207711_10000021 | 3300025941 | Bacteria | 355952 |
| 313 | Ga0207711_10006119 | 3300025941 | Bacteria | 10165 |
| 314 | Ga0207711_10043015 | 3300025941 | Bacteria | 3851 |
| 315 | Ga0207689_10000059 | 3300025942 | Bacteria | 85713 |
| 316 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 317 | Ga0207667_10016642 | 3300025949 | Bacteria | 8302 |
| 318 | Ga0207667_10426821 | 3300025949 | Bacteria | 1348 |
| 319 | Ga0207651_10000006 | 3300025960 | Bacteria | 227893 |
| 320 | Ga0207651_10180758 | 3300025960 | Bacteria | 1673 |
| 321 | Ga0207712_10000013 | 3300025961 | Bacteria | 391208 |
| 322 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 323 | Ga0207712_10001145 | 3300025961 | Bacteria | 18468 |
| 324 | Ga0207712_10003624 | 3300025961 | Bacteria | 9735 |
| 325 | Ga0207712_10019149 | 3300025961 | Bacteria | 4466 |
| 326 | Ga0207668_10000313 | 3300025972 | Bacteria | 31786 |
| 327 | Ga0207668_10001023 | 3300025972 | Bacteria | 16730 |
| 328 | Ga0207668_10002891 | 3300025972 | Bacteria | 10075 |
| 329 | Ga0207668_10050054 | 3300025972 | Bacteria | 2876 |
| 330 | Ga0207668_10078823 | 3300025972 | Bacteria | 2380 |
| 331 | Ga0207640_10005337 | 3300025981 | Bacteria | 7005 |
| 332 | Ga0207640_10009764 | 3300025981 | Bacteria | 5380 |
| 333 | Ga0207640_10101329 | 3300025981 | Bacteria | 2020 |
| 334 | Ga0207658_10000159 | 3300025986 | Bacteria | 71280 |
| 335 | Ga0207658_10000424 | 3300025986 | Bacteria | 40038 |
| 336 | Ga0207658_10001075 | 3300025986 | Bacteria | 22159 |
| 337 | Ga0207658_10012317 | 3300025986 | Bacteria | 5838 |
| 338 | Ga0207658_10060590 | 3300025986 | Bacteria | 2825 |
| 339 | Ga0207658_10306400 | 3300025986 | Bacteria | 1370 |
| 340 | Ga0207677_10000251 | 3300026023 | Bacteria | 41529 |
| 341 | Ga0207677_10057934 | 3300026023 | Bacteria | 2664 |
| 342 | Ga0207703_10000634 | 3300026035 | Bacteria | 35367 |
| 343 | Ga0207703_10000888 | 3300026035 | Bacteria | 29349 |
| 344 | Ga0207703_10000927 | 3300026035 | Bacteria | 28560 |
| 345 | Ga0207639_10000379 | 3300026041 | Bacteria | 30706 |
| 346 | Ga0207639_10003124 | 3300026041 | Bacteria | 11134 |
| 347 | Ga0207639_10004254 | 3300026041 | Bacteria | 9652 |
| 348 | Ga0207639_10023343 | 3300026041 | Bacteria | 4466 |
| 349 | Ga0207678_10002708 | 3300026067 | Bacteria | 16071 |
| 350 | Ga0207678_10006156 | 3300026067 | Bacteria | 10673 |
| 351 | Ga0207678_10021653 | 3300026067 | Bacteria | 5637 |
| 352 | Ga0207702_10001108 | 3300026078 | Bacteria | 27539 |
| 353 | Ga0207702_10006148 | 3300026078 | Bacteria | 10394 |
| 354 | Ga0207702_10007410 | 3300026078 | Bacteria | 9366 |
| 355 | Ga0207702_10027313 | 3300026078 | Bacteria | 4739 |
| 356 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 357 | Ga0207641_10000049 | 3300026088 | Bacteria | 177222 |
| 358 | Ga0207641_10000101 | 3300026088 | Bacteria | 122493 |
| 359 | Ga0207641_10000107 | 3300026088 | Bacteria | 121220 |
| 360 | Ga0207641_10000973 | 3300026088 | Bacteria | 29317 |
| 361 | Ga0207641_10005433 | 3300026088 | Bacteria | 10876 |
| 362 | Ga0207648_10000022 | 3300026089 | Bacteria | 137000 |
| 363 | Ga0207648_10353481 | 3300026089 | Bacteria | 1325 |
| 364 | Ga0207676_10000057 | 3300026095 | Bacteria | 121220 |
| 365 | Ga0207676_10000877 | 3300026095 | Bacteria | 23341 |
| 366 | Ga0207676_10002582 | 3300026095 | Bacteria | 12910 |
| 367 | Ga0207674_10003490 | 3300026116 | Bacteria | 19200 |
| 368 | Ga0207674_10050177 | 3300026116 | Bacteria | 4264 |
| 369 | Ga0207674_10282219 | 3300026116 | Bacteria | 1609 |
| 370 | Ga0207675_100000011 | 3300026118 | Bacteria | 143162 |
| 371 | Ga0207675_100000640 | 3300026118 | Bacteria | 34358 |
| 372 | Ga0207675_100244282 | 3300026118 | Bacteria | 1735 |
| 373 | Ga0207683_10000882 | 3300026121 | Bacteria | 27546 |
| 374 | Ga0207683_10059531 | 3300026121 | Bacteria | 3355 |
| 375 | Ga0207698_10000220 | 3300026142 | Bacteria | 35458 |
| 376 | Ga0207698_10060351 | 3300026142 | Bacteria | 2949 |
| 377 | Ga0209813_10000456 | 3300027866 | Bacteria | 9927 |
| 378 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 379 | Ga0268266_10000025 | 3300028379 | Bacteria | 477143 |
| 380 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 381 | Ga0268265_10000080 | 3300028380 | Bacteria | 121220 |
| 382 | Ga0268265_10000345 | 3300028380 | Bacteria | 50171 |
| 383 | Ga0268264_10000037 | 3300028381 | Bacteria | 391116 |
| 384 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 385 | Ga0268264_10000330 | 3300028381 | Bacteria | 74311 |
| 386 | Ga0268264_10001925 | 3300028381 | Bacteria | 18720 |
| 387 | Ga0268264_10002475 | 3300028381 | Bacteria | 16228 |
| 388 | Ga0307517_10016221 | 3300028786 | Bacteria | 9809 |
| 389 | Ga0307513_10004798 | 3300031456 | Bacteria | 17959 |
| 390 | Ga0307513_10148823 | 3300031456 | Bacteria | 2255 |
| 391 | Ga0307508_10000810 | 3300031616 | Bacteria | 36605 |
| 392 | Ga0307410_10155866 | 3300031852 | Bacteria | 1705 |
| 393 | Ga0307406_10053216 | 3300031901 | Bacteria | 2578 |
| 394 | Ga0307407_10026585 | 3300031903 | Bacteria | 3067 |
| 395 | Ga0307412_10020035 | 3300031911 | Bacteria | 4063 |
| 396 | Ga0307412_10041222 | 3300031911 | Bacteria | 2991 |
| 397 | Ga0307409_100025655 | 3300031995 | Bacteria | 4139 |
| 398 | Ga0307416_100315910 | 3300032002 | Bacteria | 1561 |
| 399 | Ga0307416_100356616 | 3300032002 | Bacteria | 1482 |
| 400 | Ga0307414_10043107 | 3300032004 | Bacteria | 3071 |
| 401 | Ga0307411_10293418 | 3300032005 | Bacteria | 1300 |
| 402 | Ga0373937_0132943 | 3300036401 | Bacteria | 2325 |
| 403 | Ga0316582_0131893 | 3300036647 | Bacteria | 1679 |
| 404 | Ga0316584_0102695 | 3300036712 | Bacteria | 2141 |
| 405 | Ga0395899_0012157 | 3300037312 | Bacteria | 6592 |
| 406 | Ga0395899_0028173 | 3300037312 | Bacteria | 4230 |
| 407 | Ga0395900_0553670 | 3300037418 | Bacteria | 1094 |
| 408 | Ga0436364_0822555 | 3300037853 | Bacteria | 215682 |
| 409 | Ga0395901_0036154 | 3300038443 | Bacteria | 5103 |
| 410 | Ga0395901_0071415 | 3300038443 | Bacteria | 3618 |
| 411 | Ga0395901_0082745 | 3300038443 | Bacteria | 3354 |
| 412 | Ga0439431_0001796 | 3300041997 | Bacteria | 4742 |
| 413 | Ga0439442_013096 | 3300042002 | Bacteria | 1701 |
| 414 | Ga0439445_0002709 | 3300042004 | Bacteria | 3942 |
| 415 | Ga0439445_0005432 | 3300042004 | Bacteria | 2904 |
| 416 | Ga0439448_0000396 | 3300042005 | Bacteria | 9914 |
| 417 | Ga0439432_000061 | 3300042006 | Bacteria | 33172 |
| 418 | Ga0439455_0000160 | 3300042012 | Bacteria | 7529 |
| 419 | Ga0439462_0006232 | 3300042015 | Bacteria | 2959 |
| 420 | Ga0439462_0012507 | 3300042015 | Bacteria | 2168 |
| 421 | Ga0439458_0001403 | 3300042157 | Bacteria | 6077 |
| 422 | Ga0439434_0000912 | 3300042435 | Bacteria | 8504 |
| 423 | Ga0439434_0022240 | 3300042435 | Bacteria | 1906 |
| 424 | Ga0466961_0141986 | 3300044693 | Bacteria | 1503 |
| 425 | Ga0466963_0034956 | 3300044694 | Bacteria | 3272 |
| 426 | Ga0466971_0011717 | 3300044719 | Bacteria | 3840 |
| 427 | Ga0466967_0033834 | 3300045976 | Bacteria | 4331 |
| 428 | Ga0495617_013763 | 3300046452 | Bacteria | 2751 |
| 429 | Ga0495627_000494 | 3300046453 | Bacteria | 33081 |
| 430 | Ga0495627_004180 | 3300046453 | Bacteria | 6120 |
| 431 | Ga0495629_0131858 | 3300046459 | Bacteria | 1741 |
| 432 | Ga0495638_0000481 | 3300046460 | Bacteria | 47890 |
| 433 | Ga0495638_0012818 | 3300046460 | Bacteria | 5728 |
| 434 | Ga0495638_0039322 | 3300046460 | Bacteria | 3003 |
| 435 | Ga0495650_0000491 | 3300046471 | Bacteria | 60068 |
| 436 | Ga0495650_0012970 | 3300046471 | Bacteria | 4444 |
| 437 | Ga0495584_0024841 | 3300046491 | Bacteria | 3038 |
| 438 | Ga0495584_0053178 | 3300046491 | Bacteria | 2038 |
| 439 | Ga0495585_0005748 | 3300046492 | Bacteria | 7782 |
| 440 | Ga0495585_0111556 | 3300046492 | Bacteria | 1454 |
| 441 | Ga0495607_0042348 | 3300046501 | Bacteria | 2699 |
| 442 | Ga0495583_0001935 | 3300046506 | Bacteria | 19137 |
| 443 | Ga0495583_0029621 | 3300046506 | Bacteria | 2676 |
| 444 | Ga0495583_0036850 | 3300046506 | Bacteria | 2322 |
| 445 | Ga0495606_0000379 | 3300046507 | Bacteria | 75426 |
| 446 | Ga0495606_0019327 | 3300046507 | Bacteria | 5074 |
| 447 | Ga0495606_0048488 | 3300046507 | Bacteria | 2793 |
| 448 | Ga0495610_0002686 | 3300046512 | Bacteria | 14666 |
| 449 | Ga0495610_0013533 | 3300046512 | Bacteria | 4844 |
| 450 | Ga0495616_0000017 | 3300046513 | Bacteria | 167324 |
| 451 | Ga0495632_0000079 | 3300046519 | Bacteria | 100131 |
| 452 | Ga0495637_0004742 | 3300046520 | Bacteria | 7015 |
| 453 | Ga0495637_0006673 | 3300046520 | Bacteria | 5779 |
| 454 | Ga0495643_0000030 | 3300046522 | Bacteria | 260229 |
| 455 | Ga0495643_0001764 | 3300046522 | Bacteria | 18603 |
| 456 | Ga0495643_0002663 | 3300046522 | Bacteria | 13820 |
| 457 | Ga0495648_0000444 | 3300046524 | Bacteria | 44706 |
| 458 | Ga0495648_0012061 | 3300046524 | Bacteria | 6472 |
| 459 | Ga0495663_0000006 | 3300046525 | Bacteria | 306938 |
| 460 | Ga0495663_0000341 | 3300046525 | Bacteria | 17397 |
| 461 | Ga0495663_0012403 | 3300046525 | Bacteria | 2374 |
| 462 | Ga0495642_0054486 | 3300046528 | Bacteria | 1649 |
| 463 | Ga0495587_0113534 | 3300046536 | Bacteria | 1555 |
| 464 | Ga0495597_0065307 | 3300046542 | Bacteria | 1579 |
| 465 | Ga0495622_0002047 | 3300046557 | Bacteria | 9852 |
| 466 | Ga0495622_0006810 | 3300046557 | Bacteria | 5304 |
| 467 | Ga0495633_0000227 | 3300046558 | Bacteria | 69862 |
| 468 | Ga0495633_0004374 | 3300046558 | Bacteria | 9015 |
| 469 | Ga0495668_0000548 | 3300046616 | Bacteria | 46481 |
| 470 | Ga0495668_0007147 | 3300046616 | Bacteria | 7180 |
| 471 | Ga0495668_0057371 | 3300046616 | Bacteria | 2149 |
| 472 | Ga0495668_0109215 | 3300046616 | Bacteria | 1513 |
| 473 | Ga0495611_0005333 | 3300046648 | Bacteria | 5501 |
| 474 | Ga0495611_0102881 | 3300046648 | Bacteria | 1327 |
| 475 | Ga0495625_0000112 | 3300046660 | Bacteria | 124365 |
| 476 | Ga0495625_0000652 | 3300046660 | Bacteria | 49796 |
| 477 | Ga0495625_0000971 | 3300046660 | Bacteria | 38119 |
| 478 | Ga0495625_0018551 | 3300046660 | Bacteria | 5426 |
| 479 | Ga0495625_0093982 | 3300046660 | Bacteria | 2069 |
| 480 | Ga0495661_0151100 | 3300046665 | Bacteria | 1254 |
| 481 | Ga0495669_0000378 | 3300046684 | Bacteria | 22467 |
| 482 | Ga0495670_0001636 | 3300046691 | Bacteria | 10969 |
| 483 | Ga0495671_0000072 | 3300046692 | Bacteria | 97315 |
| 484 | Ga0495671_0003821 | 3300046692 | Bacteria | 9157 |
| 485 | Ga0495671_0015865 | 3300046692 | Bacteria | 4032 |
| 486 | Ga0495600_0029068 | 3300046809 | Bacteria | 3578 |
| 487 | Ga0495660_0027691 | 3300046810 | Bacteria | 3206 |
| 488 | Ga0495660_0120367 | 3300046810 | Bacteria | 1329 |
| 489 | Ga0495687_000192 | 3300047443 | Bacteria | 87877 |
| 490 | Ga0495687_012328 | 3300047443 | Bacteria | 4525 |
| 491 | Ga0495677_0048013 | 3300047445 | Bacteria | 1568 |
| 492 | Ga0495681_0000055 | 3300047470 | Bacteria | 104502 |
| 493 | Ga0495681_0005121 | 3300047470 | Bacteria | 8835 |
| 494 | Ga0495681_0016328 | 3300047470 | Bacteria | 4165 |
| 495 | Ga0495686_0000057 | 3300047472 | Bacteria | 250088 |
| 496 | Ga0495686_0001111 | 3300047472 | Bacteria | 31908 |
| 497 | Ga0495686_0005131 | 3300047472 | Bacteria | 10460 |
| 498 | Ga0495686_0025738 | 3300047472 | Bacteria | 3855 |
| 499 | Ga0495686_0069513 | 3300047472 | Bacteria | 2171 |
| 500 | Ga0495686_0099095 | 3300047472 | Bacteria | 1760 |
| 501 | Ga0495686_0142559 | 3300047472 | Bacteria | 1413 |
| 502 | Ga0496102_0000049 | 3300048905 | Bacteria | 179480 |
| 503 | Ga0496102_0001816 | 3300048905 | Bacteria | 18445 |
| 504 | Ga0496103_0000037 | 3300048906 | Bacteria | 179474 |
| 505 | Ga0496103_0000177 | 3300048906 | Bacteria | 65489 |
| 506 | Ga0496103_0005733 | 3300048906 | Bacteria | 7416 |
| 507 | Ga0496104_0003305 | 3300048907 | Bacteria | 13919 |
| 508 | Ga0496105_0005988 | 3300048908 | Bacteria | 9284 |
| 509 | Ga0496106_0076540 | 3300048909 | Bacteria | 2565 |
| 510 | Ga0496108_0260277 | 3300048911 | Bacteria | 1510 |
| 511 | Ga0496109_0212969 | 3300048912 | Bacteria | 1817 |
| 512 | Ga0496110_0032029 | 3300048913 | Bacteria | 4538 |
| 513 | Ga0496111_0127609 | 3300048914 | Bacteria | 1881 |
| 514 | Ga0496111_0245733 | 3300048914 | Bacteria | 1328 |
| 515 | Ga0496115_0000410 | 3300048918 | Bacteria | 35215 |
| 516 | Ga0496116_0003064 | 3300048919 | Bacteria | 16874 |
| 517 | Ga0496116_0007919 | 3300048919 | Bacteria | 9312 |
| 518 | Ga0496117_0000115 | 3300048920 | Bacteria | 179488 |
| 519 | Ga0496117_0001327 | 3300048920 | Bacteria | 36380 |
| 520 | Ga0496117_0003281 | 3300048920 | Bacteria | 18981 |
| 521 | Ga0496117_0010519 | 3300048920 | Bacteria | 8413 |
| 522 | Ga0496117_0016395 | 3300048920 | Bacteria | 6254 |
| 523 | Ga0496117_0028282 | 3300048920 | Bacteria | 4345 |
| 524 | Ga0496117_0030617 | 3300048920 | Bacteria | 4125 |
| 525 | Ga0496118_0000086 | 3300048921 | Bacteria | 179488 |
| 526 | Ga0496118_0000162 | 3300048921 | Bacteria | 119635 |
| 527 | Ga0496118_0000597 | 3300048921 | Bacteria | 59798 |
| 528 | Ga0496118_0004352 | 3300048921 | Bacteria | 16851 |
| 529 | Ga0496118_0008578 | 3300048921 | Bacteria | 10520 |
| 530 | Ga0496118_0033415 | 3300048921 | Bacteria | 4220 |
| 531 | Ga0496119_0025524 | 3300048922 | Bacteria | 4124 |
| 532 | Ga0496120_0073501 | 3300048923 | Bacteria | 1871 |
| 533 | Ga0496121_0015897 | 3300048924 | Bacteria | 7819 |
| 534 | Ga0496121_0023324 | 3300048924 | Bacteria | 5964 |
| 535 | Ga0496121_0074667 | 3300048924 | Bacteria | 2711 |
| 536 | Ga0496122_0008312 | 3300048925 | Bacteria | 11241 |
| 537 | Ga0496122_0015584 | 3300048925 | Bacteria | 7255 |
| 538 | Ga0496122_0018167 | 3300048925 | Bacteria | 6513 |
| 539 | Ga0496122_0250748 | 3300048925 | Bacteria | 990 |
| 540 | Ga0496123_0045632 | 3300048926 | Bacteria | 2983 |
| 541 | Ga0496123_0080726 | 3300048926 | Bacteria | 1980 |
| 542 | Ga0496123_0209367 | 3300048926 | Bacteria | 992 |
| 543 | Ga0496124_0000102 | 3300048927 | Bacteria | 179488 |
| 544 | Ga0496124_0003194 | 3300048927 | Bacteria | 20239 |
| 545 | Ga0496124_0025172 | 3300048927 | Bacteria | 5395 |
| 546 | Ga0496125_0003670 | 3300048928 | Bacteria | 18342 |
| 547 | Ga0496125_0018080 | 3300048928 | Bacteria | 6700 |
| 548 | Ga0496125_0062597 | 3300048928 | Bacteria | 2974 |
| 549 | Ga0496125_0097178 | 3300048928 | Bacteria | 2183 |
| 550 | Ga0496125_0160325 | 3300048928 | Bacteria | 1529 |
| 551 | Ga0496125_0164668 | 3300048928 | Bacteria | 1500 |
| 552 | Ga0496125_0333330 | 3300048928 | Bacteria | 914 |
| 553 | Ga0496126_0000467 | 3300048929 | Bacteria | 80295 |
| 554 | Ga0496126_0037594 | 3300048929 | Bacteria | 4516 |
| 555 | Ga0496126_0089420 | 3300048929 | Bacteria | 2711 |
| 556 | Ga0496126_0300304 | 3300048929 | Bacteria | 1325 |
| 557 | Ga0501290_002015 | 3300049513 | Bacteria | 2669 |
| 558 | Ga0501292_000015 | 3300049515 | Bacteria | 64087 |
| 559 | Ga0501293_001610 | 3300049516 | Bacteria | 1696 |
| 560 | Ga0501294_000034 | 3300049517 | Bacteria | 13717 |
| 561 | Ga0501300_000543 | 3300049523 | Bacteria | 5641 |
| 562 | Ga0501315_002062 | 3300049531 | Bacteria | 1838 |
| 563 | Ga0501047_0240125 | 3300049581 | Bacteria | 1663 |
| 564 | Ga0501047_0252223 | 3300049581 | Bacteria | 1613 |
| 565 | Ga0501069_0013786 | 3300049585 | Bacteria | 4313 |
| 566 | Ga0501070_0211297 | 3300049586 | Bacteria | 1592 |
| 567 | Ga0501211_000869 | 3300049658 | Bacteria | 3165 |
| 568 | Ga0501222_000470 | 3300049662 | Bacteria | 6017 |
| 569 | Ga0501223_000010 | 3300049663 | Bacteria | 106901 |
| 570 | Ga0501224_001100 | 3300049664 | Bacteria | 3521 |
| 571 | Ga0501233_001690 | 3300049668 | Bacteria | 3798 |
| 572 | Ga0501235_000937 | 3300049669 | Bacteria | 6031 |
| 573 | Ga0501235_012080 | 3300049669 | Bacteria | 1897 |
| 574 | Ga0501249_000649 | 3300049679 | Bacteria | 7950 |
| 575 | Ga0501257_000133 | 3300049686 | Bacteria | 16944 |
| 576 | Ga0501257_008979 | 3300049686 | Bacteria | 2253 |
| 577 | Ga0501259_001871 | 3300049688 | Bacteria | 3487 |
| 578 | Ga0501261_001713 | 3300049690 | Bacteria | 2695 |
| 579 | Ga0501225_0000008 | 3300049705 | Bacteria | 95521 |
| 580 | Ga0501225_0000376 | 3300049705 | Bacteria | 14073 |
| 581 | Ga0501225_0001874 | 3300049705 | Bacteria | 6603 |
| 582 | Ga0501241_007939 | 3300049758 | Bacteria | 1943 |
| 583 | Ga0501279_000015 | 3300049775 | Bacteria | 64426 |
| 584 | Ga0501280_000226 | 3300049776 | Bacteria | 14226 |
| 585 | Ga0501281_00176 | 3300049777 | Bacteria | 7350 |
| 586 | nmdc:mga06z11_52_c1 | 3300050494 | Bacteria | 49109 |
| 587 | nmdc:mga04h51_621_c1 | 3300050495 | Bacteria | 8335 |
| 588 | Ga0500610_0001803 | 3300053079 | Bacteria | 7543 |
| 589 | Ga0500643_000137 | 3300053087 | Bacteria | 74194 |
| 590 | Ga0500643_000166 | 3300053087 | Bacteria | 65586 |
| 591 | Ga0500643_001128 | 3300053087 | Bacteria | 15935 |
| 592 | Ga0500643_001221 | 3300053087 | Bacteria | 15319 |
| 593 | Ga0500651_0001233 | 3300053093 | Bacteria | 12727 |
| 594 | Ga0500566_0049106 | 3300053094 | Bacteria | 2417 |
| 595 | Ga0500562_008982 | 3300053108 | Bacteria | 2524 |
| 596 | Ga0500592_000996 | 3300053116 | Bacteria | 4622 |
| 597 | Ga0500592_006810 | 3300053116 | Bacteria | 1819 |
| 598 | Ga0500594_0002524 | 3300053118 | Bacteria | 3981 |
| 599 | Ga0500594_0002974 | 3300053118 | Bacteria | 3705 |
| 600 | Ga0500595_026446 | 3300053119 | Bacteria | 1999 |
| 601 | Ga0500618_007279 | 3300053125 | Bacteria | 3174 |
| 602 | Ga0500642_0000389 | 3300053130 | Bacteria | 14472 |
| 603 | Ga0500642_0001261 | 3300053130 | Bacteria | 7244 |
| 604 | Ga0500655_000048 | 3300053133 | Bacteria | 32768 |
| 605 | Ga0500658_0003044 | 3300053134 | Bacteria | 6416 |
| 606 | Ga0500568_0001915 | 3300053139 | Bacteria | 12764 |
| 607 | Ga0500573_0000086 | 3300053140 | Bacteria | 42361 |
| 608 | Ga0500590_014633 | 3300053148 | Bacteria | 4045 |
| 609 | Ga0500604_0004487 | 3300053151 | Bacteria | 3703 |
| 610 | Ga0500622_0011112 | 3300053156 | Bacteria | 4916 |
| 611 | Ga0500627_0000005 | 3300053158 | Bacteria | 167950 |
| 612 | Ga0500627_0007631 | 3300053158 | Bacteria | 3784 |
| 613 | Ga0500639_068118 | 3300053163 | Bacteria | 1819 |
| 614 | Ga0500636_0000568 | 3300053177 | Bacteria | 20153 |
| 615 | Ga0500645_000116 | 3300053730 | Bacteria | 63698 |
| 616 | Ga0500645_050436 | 3300053730 | Bacteria | 1215 |
| 617 | Ga0500587_003581 | 3300053739 | Bacteria | 2165 |
| 618 | Ga0500661_000842 | 3300055283 | Bacteria | 5730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10000967 | Ga0070658_1000096722 | 264 |
| 2 | 3300005339 | Ga0070660_100002653 | Ga0070660_10000265310 | 264 |
| 3 | 3300025909 | Ga0207705_10000875 | Ga0207705_1000087521 | 264 |
| 4 | 3300025919 | Ga0207657_10004639 | Ga0207657_1000463910 | 264 |
| 5 | 3300048928 | Ga0496125_0333330 | Ga0496125_0333330_11_901 | 296 |
| 6 | 3300053119 | Ga0500595_026446 | Ga0500595_026446_98_994 | 298 |
| 7 | 3300049658 | Ga0501211_000869 | Ga0501211_000869_442_1344 | 300 |
| 8 | 3300005719 | Ga0068861_100000061 | Ga0068861_10000006144 | 302 |
| 9 | 3300026118 | Ga0207675_100000011 | Ga0207675_100000011141 | 302 |
| 10 | 3300042005 | Ga0439448_0000396 | Ga0439448_0000396_7423_8373 | 302 |
| 11 | 3300042012 | Ga0439455_0000160 | Ga0439455_0000160_1648_2598 | 302 |
| 12 | 3300042157 | Ga0439458_0001403 | Ga0439458_0001403_2484_3434 | 302 |
| 13 | 3300013102 | Ga0157371_10096344 | Ga0157371_100963442 | 304 |
| 14 | 3300013105 | Ga0157369_10223889 | Ga0157369_102238891 | 305 |
| 15 | 3300013307 | Ga0157372_10211356 | Ga0157372_102113562 | 305 |
| 16 | 3300025933 | Ga0207706_10057717 | Ga0207706_100577172 | 305 |
| 17 | 3300053116 | Ga0500592_006810 | Ga0500592_006810_787_1743 | 305 |
| 18 | 3300046507 | Ga0495606_0019327 | Ga0495606_0019327_2802_3779 | 306 |
| 19 | 3300005262 | Ga0065165_1001326 | Ga0065165_100132627 | 307 |
| 20 | 3300005547 | Ga0070693_100154324 | Ga0070693_1001543241 | 308 |
| 21 | 3300006042 | Ga0075368_10001402 | Ga0075368_100014023 | 308 |
| 22 | 3300006178 | Ga0075367_10000205 | Ga0075367_100002057 | 308 |
| 23 | 3300027866 | Ga0209813_10000456 | Ga0209813_100004569 | 308 |
| 24 | 3300050494 | nmdc:mga06z11_52_c1 | nmdc:mga06z11_52_c1_40228_41217 | 308 |
| 25 | 3300050495 | nmdc:mga04h51_621_c1 | nmdc:mga04h51_621_c1_1360_2349 | 308 |
| 26 | 3300001904 | JGI24736J21556_1000502 | JGI24736J21556_10005025 | 309 |
| 27 | 3300001915 | JGI24741J21665_1000107 | JGI24741J21665_100010720 | 309 |
| 28 | 3300001979 | JGI24740J21852_10009011 | JGI24740J21852_100090114 | 309 |
| 29 | 3300001989 | JGI24739J22299_10005370 | JGI24739J22299_100053702 | 309 |
| 30 | 3300001990 | JGI24737J22298_10002879 | JGI24737J22298_100028795 | 309 |
| 31 | 3300002067 | JGI24735J21928_10003861 | JGI24735J21928_100038615 | 309 |
| 32 | 3300002075 | JGI24738J21930_10001993 | JGI24738J21930_100019935 | 309 |
| 33 | 3300005327 | Ga0070658_10068159 | Ga0070658_100681591 | 309 |
| 34 | 3300005344 | Ga0070661_100072734 | Ga0070661_1000727343 | 309 |
| 35 | 3300005366 | Ga0070659_100092389 | Ga0070659_1000923891 | 309 |
| 36 | 3300005455 | Ga0070663_100001752 | Ga0070663_10000175213 | 309 |
| 37 | 3300005614 | Ga0068856_100028579 | Ga0068856_1000285792 | 309 |
| 38 | 3300005834 | Ga0068851_10015119 | Ga0068851_100151194 | 309 |
| 39 | 3300009174 | Ga0105241_10003710 | Ga0105241_100037104 | 309 |
| 40 | 3300013100 | Ga0157373_10066776 | Ga0157373_100667762 | 309 |
| 41 | 3300025321 | Ga0207656_10021344 | Ga0207656_100213444 | 309 |
| 42 | 3300025904 | Ga0207647_10018586 | Ga0207647_100185866 | 309 |
| 43 | 3300025909 | Ga0207705_10052970 | Ga0207705_100529702 | 309 |
| 44 | 3300025911 | Ga0207654_10020536 | Ga0207654_100205363 | 309 |
| 45 | 3300025913 | Ga0207695_10069656 | Ga0207695_100696562 | 309 |
| 46 | 3300025919 | Ga0207657_10003878 | Ga0207657_100038789 | 309 |
| 47 | 3300025981 | Ga0207640_10005337 | Ga0207640_100053375 | 309 |
| 48 | 3300026041 | Ga0207639_10003124 | Ga0207639_100031245 | 309 |
| 49 | 3300026067 | Ga0207678_10006156 | Ga0207678_1000615610 | 309 |
| 50 | 3300026078 | Ga0207702_10007410 | Ga0207702_100074104 | 309 |
| 51 | 3300026142 | Ga0207698_10060351 | Ga0207698_100603512 | 309 |
| 52 | 3300031852 | Ga0307410_10155866 | Ga0307410_101558662 | 309 |
| 53 | 3300032002 | Ga0307416_100356616 | Ga0307416_1003566162 | 309 |
| 54 | 3300032005 | Ga0307411_10293418 | Ga0307411_102934181 | 309 |
| 55 | 3300046491 | Ga0495584_0024841 | Ga0495584_0024841_1606_2595 | 309 |
| 56 | 3300046519 | Ga0495632_0000079 | Ga0495632_0000079_67484_68473 | 309 |
| 57 | 3300046520 | Ga0495637_0004742 | Ga0495637_0004742_2859_3848 | 309 |
| 58 | 3300046522 | Ga0495643_0000030 | Ga0495643_0000030_256045_257034 | 309 |
| 59 | 3300046525 | Ga0495663_0000006 | Ga0495663_0000006_238466_239455 | 309 |
| 60 | 3300046558 | Ga0495633_0000227 | Ga0495633_0000227_41367_42356 | 309 |
| 61 | 3300046692 | Ga0495671_0000072 | Ga0495671_0000072_93131_94120 | 309 |
| 62 | 3300047470 | Ga0495681_0016328 | Ga0495681_0016328_2511_3500 | 309 |
| 63 | 3300047472 | Ga0495686_0069513 | Ga0495686_0069513_465_1454 | 309 |
| 64 | 3300003214 | JGI25165J46597_1000021 | JGI25165J46597_100002110 | 310 |
| 65 | 3300017792 | Ga0163161_10024192 | Ga0163161_100241922 | 310 |
| 66 | 3300020081 | Ga0206354_10830840 | Ga0206354_108308401 | 310 |
| 67 | 3300020082 | Ga0206353_11220810 | Ga0206353_112208103 | 310 |
| 68 | 3300025261 | Ga0209233_1000065 | Ga0209233_10000659 | 310 |
| 69 | 3300025972 | Ga0207668_10002891 | Ga0207668_100028919 | 310 |
| 70 | 3300046452 | Ga0495617_013763 | Ga0495617_013763_255_1244 | 310 |
| 71 | 3300046453 | Ga0495627_000494 | Ga0495627_000494_3400_4392 | 310 |
| 72 | 3300046453 | Ga0495627_004180 | Ga0495627_004180_3792_4781 | 310 |
| 73 | 3300046512 | Ga0495610_0002686 | Ga0495610_0002686_9245_10234 | 310 |
| 74 | 3300046520 | Ga0495637_0006673 | Ga0495637_0006673_3186_4175 | 310 |
| 75 | 3300046524 | Ga0495648_0012061 | Ga0495648_0012061_2251_3243 | 310 |
| 76 | 3300046691 | Ga0495670_0001636 | Ga0495670_0001636_2613_3608 | 310 |
| 77 | 3300047470 | Ga0495681_0000055 | Ga0495681_0000055_10703_11692 | 310 |
| 78 | 3300048928 | Ga0496125_0160325 | Ga0496125_0160325_514_1503 | 310 |
| 79 | 3300005289 | Ga0065704_10122327 | Ga0065704_101223271 | 311 |
| 80 | 3300026089 | Ga0207648_10353481 | Ga0207648_103534812 | 311 |
| 81 | 3300046512 | Ga0495610_0013533 | Ga0495610_0013533_1404_2393 | 311 |
| 82 | 3300047472 | Ga0495686_0025738 | Ga0495686_0025738_55_1044 | 311 |
| 83 | 3300047472 | Ga0495686_0099095 | Ga0495686_0099095_488_1474 | 311 |
| 84 | 3300048914 | Ga0496111_0127609 | Ga0496111_0127609_762_1754 | 311 |
| 85 | 3300048924 | Ga0496121_0074667 | Ga0496121_0074667_1700_2692 | 311 |
| 86 | 3300048925 | Ga0496122_0018167 | Ga0496122_0018167_4778_5770 | 311 |
| 87 | 3300048926 | Ga0496123_0080726 | Ga0496123_0080726_595_1587 | 311 |
| 88 | 3300048926 | Ga0496123_0209367 | Ga0496123_0209367_38_982 | 311 |
| 89 | 3300048927 | Ga0496124_0025172 | Ga0496124_0025172_701_1693 | 311 |
| 90 | 3300048928 | Ga0496125_0018080 | Ga0496125_0018080_5248_6240 | 311 |
| 91 | 3300048929 | Ga0496126_0089420 | Ga0496126_0089420_1071_2063 | 311 |
| 92 | 3300005353 | Ga0070669_100037973 | Ga0070669_1000379733 | 312 |
| 93 | 3300005355 | Ga0070671_100136506 | Ga0070671_1001365062 | 312 |
| 94 | 3300005367 | Ga0070667_100381647 | Ga0070667_1003816472 | 312 |
| 95 | 3300005548 | Ga0070665_100000021 | Ga0070665_100000021329 | 312 |
| 96 | 3300005842 | Ga0068858_100003008 | Ga0068858_10000300814 | 312 |
| 97 | 3300009098 | Ga0105245_10000244 | Ga0105245_1000024435 | 312 |
| 98 | 3300009148 | Ga0105243_10080635 | Ga0105243_100806353 | 312 |
| 99 | 3300009176 | Ga0105242_10506303 | Ga0105242_105063031 | 312 |
| 100 | 3300013297 | Ga0157378_10019764 | Ga0157378_100197642 | 312 |
| 101 | 3300025229 | Ga0209147_103310 | Ga0209147_1033105 | 312 |
| 102 | 3300025302 | Ga0207426_1039161 | Ga0207426_10391612 | 312 |
| 103 | 3300025923 | Ga0207681_10191261 | Ga0207681_101912612 | 312 |
| 104 | 3300025927 | Ga0207687_10005555 | Ga0207687_100055556 | 312 |
| 105 | 3300025931 | Ga0207644_10104327 | Ga0207644_101043273 | 312 |
| 106 | 3300025934 | Ga0207686_10093872 | Ga0207686_100938722 | 312 |
| 107 | 3300025935 | Ga0207709_10050177 | Ga0207709_100501772 | 312 |
| 108 | 3300025986 | Ga0207658_10060590 | Ga0207658_100605901 | 312 |
| 109 | 3300026035 | Ga0207703_10000927 | Ga0207703_1000092714 | 312 |
| 110 | 3300028379 | Ga0268266_10000015 | Ga0268266_10000015124 | 312 |
| 111 | 3300038443 | Ga0395901_0082745 | Ga0395901_0082745_1427_2425 | 312 |
| 112 | 3300048920 | Ga0496117_0003281 | Ga0496117_0003281_8508_9500 | 312 |
| 113 | 3300048921 | Ga0496118_0000162 | Ga0496118_0000162_77898_78890 | 312 |
| 114 | 3300003773 | Ga0055537_1001305 | Ga0055537_10013052 | 313 |
| 115 | 3300005844 | Ga0068862_100053430 | Ga0068862_1000534303 | 313 |
| 116 | 3300005937 | Ga0081455_10000175 | Ga0081455_1000017556 | 313 |
| 117 | 3300009551 | Ga0105238_10257937 | Ga0105238_102579372 | 313 |
| 118 | 3300015690 | Ga0183363_1007 | Ga0183363_1007194 | 313 |
| 119 | 3300016635 | Ga0183361_10316 | Ga0183361_103162 | 313 |
| 120 | 3300025263 | Ga0209565_1000056 | Ga0209565_100005652 | 313 |
| 121 | 3300025272 | Ga0209455_1015249 | Ga0209455_10152492 | 313 |
| 122 | 3300025924 | Ga0207694_10049392 | Ga0207694_100493924 | 313 |
| 123 | 3300031616 | Ga0307508_10000810 | Ga0307508_100008107 | 313 |
| 124 | 3300046460 | Ga0495638_0000481 | Ga0495638_0000481_4636_5631 | 313 |
| 125 | 3300046525 | Ga0495663_0012403 | Ga0495663_0012403_120_1115 | 313 |
| 126 | 3300046660 | Ga0495625_0000112 | Ga0495625_0000112_2827_3822 | 313 |
| 127 | 3300047472 | Ga0495686_0005131 | Ga0495686_0005131_111_1094 | 313 |
| 128 | 3300025295 | Ga0209564_1001019 | Ga0209564_10010195 | 314 |
| 129 | 3300031911 | Ga0307412_10020035 | Ga0307412_100200352 | 314 |
| 130 | 3300046492 | Ga0495585_0111556 | Ga0495585_0111556_191_1189 | 314 |
| 131 | 3300053116 | Ga0500592_000996 | Ga0500592_000996_1787_2818 | 314 |
| 132 | 3300053158 | Ga0500627_0000005 | Ga0500627_0000005_41960_42991 | 314 |
| 133 | 3300002067 | JGI24735J21928_10020838 | JGI24735J21928_100208381 | 315 |
| 134 | 3300005367 | Ga0070667_100281697 | Ga0070667_1002816971 | 315 |
| 135 | 3300005618 | Ga0068864_100001277 | Ga0068864_1000012776 | 315 |
| 136 | 3300005842 | Ga0068858_100000414 | Ga0068858_10000041432 | 315 |
| 137 | 3300009177 | Ga0105248_10006249 | Ga0105248_100062498 | 315 |
| 138 | 3300013306 | Ga0163162_10001705 | Ga0163162_1000170520 | 315 |
| 139 | 3300013306 | Ga0163162_10271226 | Ga0163162_102712262 | 315 |
| 140 | 3300013307 | Ga0157372_10730494 | Ga0157372_107304942 | 315 |
| 141 | 3300014325 | Ga0163163_10229418 | Ga0163163_102294182 | 315 |
| 142 | 3300025941 | Ga0207711_10043015 | Ga0207711_100430152 | 315 |
| 143 | 3300025986 | Ga0207658_10306400 | Ga0207658_103064001 | 315 |
| 144 | 3300026035 | Ga0207703_10000634 | Ga0207703_1000063423 | 315 |
| 145 | 3300026095 | Ga0207676_10000877 | Ga0207676_1000087722 | 315 |
| 146 | 3300031456 | Ga0307513_10148823 | Ga0307513_101488233 | 315 |
| 147 | 3300046460 | Ga0495638_0039322 | Ga0495638_0039322_202_1206 | 315 |
| 148 | 3300046660 | Ga0495625_0018551 | Ga0495625_0018551_617_1618 | 315 |
| 149 | 3300048906 | Ga0496103_0005733 | Ga0496103_0005733_6015_7004 | 315 |
| 150 | 3300048920 | Ga0496117_0016395 | Ga0496117_0016395_2997_3986 | 315 |
| 151 | 3300048921 | Ga0496118_0033415 | Ga0496118_0033415_650_1639 | 315 |
| 152 | 3300053087 | Ga0500643_001128 | Ga0500643_001128_11226_12227 | 315 |
| 153 | 3300053730 | Ga0500645_050436 | Ga0500645_050436_126_1127 | 315 |
| 154 | 3300009011 | Ga0105251_10000625 | Ga0105251_100006258 | 316 |
| 155 | 3300009101 | Ga0105247_10007007 | Ga0105247_100070075 | 316 |
| 156 | 3300009177 | Ga0105248_10000014 | Ga0105248_10000014269 | 316 |
| 157 | 3300009553 | Ga0105249_10001836 | Ga0105249_1000183613 | 316 |
| 158 | 3300013306 | Ga0163162_10141442 | Ga0163162_101414422 | 316 |
| 159 | 3300014325 | Ga0163163_10043130 | Ga0163163_100431302 | 316 |
| 160 | 3300025904 | Ga0207647_10007098 | Ga0207647_100070986 | 316 |
| 161 | 3300048920 | Ga0496117_0028282 | Ga0496117_0028282_2248_3204 | 316 |
| 162 | 3300048921 | Ga0496118_0000597 | Ga0496118_0000597_14516_15472 | 316 |
| 163 | 3300046460 | Ga0495638_0012818 | Ga0495638_0012818_461_1456 | 317 |
| 164 | 3300013105 | Ga0157369_10010603 | Ga0157369_1001060311 | 318 |
| 165 | 3300048925 | Ga0496122_0250748 | Ga0496122_0250748_22_978 | 318 |
| 166 | iso_pu_bacteria | 2582581305 | 2585262923 | 319 |
| 167 | 3300048912 | Ga0496109_0212969 | Ga0496109_0212969_20_982 | 320 |
| 168 | 3300049705 | Ga0501225_0000376 | Ga0501225_0000376_10891_11862 | 320 |
| 169 | 3300005295 | Ga0065707_10158556 | Ga0065707_101585562 | 321 |
| 170 | 3300005367 | Ga0070667_100000016 | Ga0070667_10000001684 | 321 |
| 171 | 3300005548 | Ga0070665_100416648 | Ga0070665_1004166481 | 321 |
| 172 | 3300005843 | Ga0068860_100000196 | Ga0068860_10000019623 | 321 |
| 173 | 3300009553 | Ga0105249_10002730 | Ga0105249_1000273012 | 321 |
| 174 | 3300025986 | Ga0207658_10012317 | Ga0207658_100123174 | 321 |
| 175 | 3300026088 | Ga0207641_10000973 | Ga0207641_1000097324 | 321 |
| 176 | 3300028381 | Ga0268264_10000087 | Ga0268264_1000008783 | 321 |
| 177 | 3300046536 | Ga0495587_0113534 | Ga0495587_0113534_421_1416 | 321 |
| 178 | 3300006178 | Ga0075367_10162903 | Ga0075367_101629031 | 322 |
| 179 | 3300009177 | Ga0105248_10099258 | Ga0105248_100992582 | 322 |
| 180 | 3300009553 | Ga0105249_10100916 | Ga0105249_101009162 | 322 |
| 181 | 3300013102 | Ga0157371_10020886 | Ga0157371_100208865 | 322 |
| 182 | 3300013105 | Ga0157369_10109922 | Ga0157369_101099222 | 322 |
| 183 | 3300026116 | Ga0207674_10050177 | Ga0207674_100501772 | 322 |
| 184 | 3300046616 | Ga0495668_0057371 | Ga0495668_0057371_294_1286 | 322 |
| 185 | 3300046616 | Ga0495668_0109215 | Ga0495668_0109215_192_1181 | 322 |
| 186 | 3300046810 | Ga0495660_0120367 | Ga0495660_0120367_320_1312 | 322 |
| 187 | 3300048928 | Ga0496125_0164668 | Ga0496125_0164668_122_1114 | 322 |
| 188 | 3300048929 | Ga0496126_0300304 | Ga0496126_0300304_271_1251 | 322 |
| 189 | 3300049679 | Ga0501249_000649 | Ga0501249_000649_2315_3307 | 322 |
| 190 | 3300053093 | Ga0500651_0001233 | Ga0500651_0001233_10430_11422 | 322 |
| 191 | 3300053125 | Ga0500618_007279 | Ga0500618_007279_63_1055 | 322 |
| 192 | 3300053130 | Ga0500642_0001261 | Ga0500642_0001261_3809_4801 | 322 |
| 193 | 3300053133 | Ga0500655_000048 | Ga0500655_000048_3917_4909 | 322 |
| 194 | 3300053148 | Ga0500590_014633 | Ga0500590_014633_2892_3884 | 322 |
| 195 | 3300053156 | Ga0500622_0011112 | Ga0500622_0011112_3861_4853 | 322 |
| 196 | 3300053163 | Ga0500639_068118 | Ga0500639_068118_659_1651 | 322 |
| 197 | 3300047472 | Ga0495686_0142559 | Ga0495686_0142559_45_1034 | 323 |
| 198 | 3300053087 | Ga0500643_001221 | Ga0500643_001221_3059_4111 | 323 |
| 199 | 3300036647 | Ga0316582_0131893 | Ga0316582_0131893_414_1403 | 324 |
| 200 | 3300036712 | Ga0316584_0102695 | Ga0316584_0102695_49_1038 | 324 |
| 201 | iso_pu_bacteria | 2512564014 | 2512644586 | 324 |
| 202 | iso_pu_bacteria | 2808606401 | 2809062338 | 324 |
| 203 | iso_pu_bacteria | 2808606404 | 2809078322 | 324 |
| 204 | iso_pu_bacteria | 2808606405 | 2809082727 | 324 |
| 205 | iso_pu_bacteria | 2880518877 | 2880522403 | 324 |
| 206 | iso_pu_bacteria | 2919709256 | 2919709653 | 324 |
| 207 | 3300003794 | Ga0055531_10004998 | Ga0055531_100049986 | 325 |
| 208 | 3300009551 | Ga0105238_10043952 | Ga0105238_100439523 | 325 |
| 209 | 3300025292 | Ga0209676_1000085 | Ga0209676_10000856 | 325 |
| 210 | 3300025304 | Ga0209257_1000482 | Ga0209257_10004826 | 325 |
| 211 | 3300025924 | Ga0207694_10025396 | Ga0207694_100253963 | 325 |
| 212 | 3300044693 | Ga0466961_0141986 | Ga0466961_0141986_234_1220 | 325 |
| 213 | 3300044694 | Ga0466963_0034956 | Ga0466963_0034956_249_1235 | 325 |
| 214 | 3300044719 | Ga0466971_0011717 | Ga0466971_0011717_2103_3089 | 325 |
| 215 | 3300045976 | Ga0466967_0033834 | Ga0466967_0033834_191_1177 | 325 |
| 216 | 3300047472 | Ga0495686_0000057 | Ga0495686_0000057_216435_217412 | 325 |
| 217 | 3300048920 | Ga0496117_0010519 | Ga0496117_0010519_893_1879 | 325 |
| 218 | 3300048924 | Ga0496121_0015897 | Ga0496121_0015897_840_1826 | 325 |
| 219 | 3300048925 | Ga0496122_0015584 | Ga0496122_0015584_859_1845 | 325 |
| 220 | 3300048926 | Ga0496123_0045632 | Ga0496123_0045632_867_1853 | 325 |
| 221 | iso_pu_bacteria | 2599185354 | 2600200375 | 325 |
| 222 | iso_pu_bacteria | 2751185897 | 2753763813 | 325 |
| 223 | iso_pu_bacteria | 2775507255 | 2778124690 | 325 |
| 224 | iso_pu_bacteria | 2830075706 | 2830078981 | 325 |
| 225 | iso_pu_bacteria | 2885429604 | 2885430272 | 325 |
| 226 | iso_pu_bacteria | 2928027323 | 2928028601 | 325 |
| 227 | iso_pu_bacteria | 2984555340 | 2984555822 | 325 |
| 228 | iso_pu_bacteria | 2984564862 | 2984566068 | 325 |
| 229 | iso_pu_bacteria | 2993356040 | 2993357080 | 325 |
| 230 | 3300005262 | Ga0065165_1003242 | Ga0065165_10032428 | 326 |
| 231 | 3300005289 | Ga0065704_10086168 | Ga0065704_100861682 | 326 |
| 232 | 3300005295 | Ga0065707_10116834 | Ga0065707_101168342 | 326 |
| 233 | 3300005353 | Ga0070669_100157572 | Ga0070669_1001575722 | 326 |
| 234 | 3300009978 | Ga0105148_100043 | Ga0105148_1000434 | 326 |
| 235 | 3300014326 | Ga0157380_10036797 | Ga0157380_100367971 | 326 |
| 236 | 3300025923 | Ga0207681_10135236 | Ga0207681_101352362 | 326 |
| 237 | 3300048911 | Ga0496108_0260277 | Ga0496108_0260277_261_1250 | 326 |
| 238 | 3300048928 | Ga0496125_0097178 | Ga0496125_0097178_372_1361 | 326 |
| 239 | 3300048929 | Ga0496126_0037594 | Ga0496126_0037594_276_1259 | 326 |
| 240 | 3300049669 | Ga0501235_012080 | Ga0501235_012080_336_1325 | 326 |
| 241 | iso_pu_bacteria | 8057101203 | 8057102858 | 326 |
| 242 | 3300046513 | Ga0495616_0000017 | Ga0495616_0000017_66718_67704 | 327 |
| 243 | 3300046557 | Ga0495622_0006810 | Ga0495622_0006810_2768_3754 | 327 |
| 244 | 3300046616 | Ga0495668_0007147 | Ga0495668_0007147_2033_3019 | 327 |
| 245 | 3300046692 | Ga0495671_0003821 | Ga0495671_0003821_7221_8207 | 327 |
| 246 | 3300049663 | Ga0501223_000010 | Ga0501223_000010_89516_90508 | 327 |
| 247 | 3300049705 | Ga0501225_0000008 | Ga0501225_0000008_77868_78860 | 327 |
| 248 | 3300053108 | Ga0500562_008982 | Ga0500562_008982_32_1024 | 327 |
| 249 | 3300053118 | Ga0500594_0002974 | Ga0500594_0002974_1897_2883 | 327 |
| 250 | 3300053151 | Ga0500604_0004487 | Ga0500604_0004487_964_1950 | 327 |
| 251 | 3300053158 | Ga0500627_0007631 | Ga0500627_0007631_315_1301 | 327 |
| 252 | iso_pu_bacteria | 2643221622 | 2644128341 | 327 |
| 253 | 3300001915 | JGI24741J21665_1009791 | JGI24741J21665_10097912 | 328 |
| 254 | 3300001979 | JGI24740J21852_10037438 | JGI24740J21852_100374381 | 328 |
| 255 | 3300001990 | JGI24737J22298_10058939 | JGI24737J22298_100589391 | 328 |
| 256 | 3300002067 | JGI24735J21928_10004443 | JGI24735J21928_100044433 | 328 |
| 257 | 3300002067 | JGI24735J21928_10042522 | JGI24735J21928_100425222 | 328 |
| 258 | 3300003214 | JGI25165J46597_1000173 | JGI25165J46597_100017373 | 328 |
| 259 | 3300005328 | Ga0070676_10000029 | Ga0070676_100000293 | 328 |
| 260 | 3300005334 | Ga0068869_100001320 | Ga0068869_1000013209 | 328 |
| 261 | 3300005338 | Ga0068868_100000139 | Ga0068868_10000013941 | 328 |
| 262 | 3300005339 | Ga0070660_100000692 | Ga0070660_1000006923 | 328 |
| 263 | 3300005347 | Ga0070668_100000993 | Ga0070668_1000009936 | 328 |
| 264 | 3300005353 | Ga0070669_100059756 | Ga0070669_1000597562 | 328 |
| 265 | 3300005364 | Ga0070673_100000013 | Ga0070673_10000001322 | 328 |
| 266 | 3300005367 | Ga0070667_100000199 | Ga0070667_10000019953 | 328 |
| 267 | 3300005459 | Ga0068867_100000009 | Ga0068867_100000009104 | 328 |
| 268 | 3300005539 | Ga0068853_100000819 | Ga0068853_1000008193 | 328 |
| 269 | 3300005539 | Ga0068853_100141762 | Ga0068853_1001417621 | 328 |
| 270 | 3300005543 | Ga0070672_100117950 | Ga0070672_1001179502 | 328 |
| 271 | 3300005563 | Ga0068855_100178788 | Ga0068855_1001787881 | 328 |
| 272 | 3300005577 | Ga0068857_100019321 | Ga0068857_1000193213 | 328 |
| 273 | 3300005841 | Ga0068863_100000029 | Ga0068863_10000002917 | 328 |
| 274 | 3300005843 | Ga0068860_100002353 | Ga0068860_1000023537 | 328 |
| 275 | 3300006881 | Ga0068865_100000005 | Ga0068865_1000000057 | 328 |
| 276 | 3300009098 | Ga0105245_10013346 | Ga0105245_100133464 | 328 |
| 277 | 3300009148 | Ga0105243_10000032 | Ga0105243_1000003222 | 328 |
| 278 | 3300009176 | Ga0105242_10000166 | Ga0105242_1000016630 | 328 |
| 279 | 3300009553 | Ga0105249_10016580 | Ga0105249_100165805 | 328 |
| 280 | 3300011119 | Ga0105246_10008273 | Ga0105246_100082734 | 328 |
| 281 | 3300013104 | Ga0157370_10001083 | Ga0157370_1000108319 | 328 |
| 282 | 3300013104 | Ga0157370_10226994 | Ga0157370_102269942 | 328 |
| 283 | 3300013105 | Ga0157369_10021033 | Ga0157369_100210333 | 328 |
| 284 | 3300013296 | Ga0157374_10000134 | Ga0157374_1000013457 | 328 |
| 285 | 3300013297 | Ga0157378_10001179 | Ga0157378_1000117921 | 328 |
| 286 | 3300013307 | Ga0157372_10162906 | Ga0157372_101629062 | 328 |
| 287 | 3300013308 | Ga0157375_10000242 | Ga0157375_1000024222 | 328 |
| 288 | 3300014745 | Ga0157377_10021784 | Ga0157377_100217843 | 328 |
| 289 | 3300014969 | Ga0157376_10000111 | Ga0157376_1000011118 | 328 |
| 290 | 3300025231 | Ga0207427_100765 | Ga0207427_1007658 | 328 |
| 291 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031262 | 328 |
| 292 | 3300025321 | Ga0207656_10042917 | Ga0207656_100429172 | 328 |
| 293 | 3300025904 | Ga0207647_10033652 | Ga0207647_100336523 | 328 |
| 294 | 3300025907 | Ga0207645_10005071 | Ga0207645_1000507110 | 328 |
| 295 | 3300025913 | Ga0207695_10048674 | Ga0207695_100486742 | 328 |
| 296 | 3300025919 | Ga0207657_10001940 | Ga0207657_1000194018 | 328 |
| 297 | 3300025923 | Ga0207681_10049545 | Ga0207681_100495452 | 328 |
| 298 | 3300025927 | Ga0207687_10013629 | Ga0207687_100136293 | 328 |
| 299 | 3300025934 | Ga0207686_10000250 | Ga0207686_1000025022 | 328 |
| 300 | 3300025935 | Ga0207709_10000051 | Ga0207709_10000051218 | 328 |
| 301 | 3300025938 | Ga0207704_10000001 | Ga0207704_1000000122 | 328 |
| 302 | 3300025942 | Ga0207689_10000059 | Ga0207689_1000005956 | 328 |
| 303 | 3300025949 | Ga0207667_10426821 | Ga0207667_104268211 | 328 |
| 304 | 3300025960 | Ga0207651_10000006 | Ga0207651_10000006217 | 328 |
| 305 | 3300025961 | Ga0207712_10003624 | Ga0207712_100036245 | 328 |
| 306 | 3300025972 | Ga0207668_10000313 | Ga0207668_100003135 | 328 |
| 307 | 3300025986 | Ga0207658_10000159 | Ga0207658_1000015954 | 328 |
| 308 | 3300026023 | Ga0207677_10000251 | Ga0207677_1000025120 | 328 |
| 309 | 3300026041 | Ga0207639_10004254 | Ga0207639_100042546 | 328 |
| 310 | 3300026041 | Ga0207639_10023343 | Ga0207639_100233433 | 328 |
| 311 | 3300026078 | Ga0207702_10006148 | Ga0207702_100061484 | 328 |
| 312 | 3300026088 | Ga0207641_10000049 | Ga0207641_1000004917 | 328 |
| 313 | 3300026089 | Ga0207648_10000022 | Ga0207648_10000022107 | 328 |
| 314 | 3300026116 | Ga0207674_10003490 | Ga0207674_1000349023 | 328 |
| 315 | 3300026118 | Ga0207675_100244282 | Ga0207675_1002442823 | 328 |
| 316 | 3300028381 | Ga0268264_10001925 | Ga0268264_1000192512 | 328 |
| 317 | 3300037312 | Ga0395899_0012157 | Ga0395899_0012157_59_1048 | 328 |
| 318 | 3300037418 | Ga0395900_0553670 | Ga0395900_0553670_40_1029 | 328 |
| 319 | 3300038443 | Ga0395901_0036154 | Ga0395901_0036154_3053_4039 | 328 |
| 320 | 3300038443 | Ga0395901_0071415 | Ga0395901_0071415_1632_2618 | 328 |
| 321 | 3300041997 | Ga0439431_0001796 | Ga0439431_0001796_801_1787 | 328 |
| 322 | 3300042002 | Ga0439442_013096 | Ga0439442_013096_178_1164 | 328 |
| 323 | 3300042004 | Ga0439445_0002709 | Ga0439445_0002709_1633_2619 | 328 |
| 324 | 3300042006 | Ga0439432_000061 | Ga0439432_000061_1763_2749 | 328 |
| 325 | 3300042015 | Ga0439462_0006232 | Ga0439462_0006232_400_1386 | 328 |
| 326 | 3300042435 | Ga0439434_0000912 | Ga0439434_0000912_3140_4126 | 328 |
| 327 | 3300046459 | Ga0495629_0131858 | Ga0495629_0131858_50_1045 | 328 |
| 328 | 3300046471 | Ga0495650_0012970 | Ga0495650_0012970_2234_3226 | 328 |
| 329 | 3300048920 | Ga0496117_0030617 | Ga0496117_0030617_535_1527 | 328 |
| 330 | 3300048921 | Ga0496118_0008578 | Ga0496118_0008578_8997_9989 | 328 |
| 331 | 3300048928 | Ga0496125_0062597 | Ga0496125_0062597_1547_2539 | 328 |
| 332 | 3300053087 | Ga0500643_000137 | Ga0500643_000137_3158_4150 | 328 |
| 333 | 3300055283 | Ga0500661_000842 | Ga0500661_000842_1719_2711 | 328 |
| 334 | 3300001904 | JGI24736J21556_1000278 | JGI24736J21556_10002789 | 329 |
| 335 | 3300001915 | JGI24741J21665_1001457 | JGI24741J21665_10014576 | 329 |
| 336 | 3300001979 | JGI24740J21852_10001479 | JGI24740J21852_100014795 | 329 |
| 337 | 3300001979 | JGI24740J21852_10009375 | JGI24740J21852_100093753 | 329 |
| 338 | 3300001989 | JGI24739J22299_10007049 | JGI24739J22299_100070494 | 329 |
| 339 | 3300001990 | JGI24737J22298_10004084 | JGI24737J22298_100040843 | 329 |
| 340 | 3300001990 | JGI24737J22298_10034203 | JGI24737J22298_100342032 | 329 |
| 341 | 3300002070 | JGI24750J21931_1000228 | JGI24750J21931_10002289 | 329 |
| 342 | 3300002074 | JGI24748J21848_1000062 | JGI24748J21848_10000624 | 329 |
| 343 | 3300002075 | JGI24738J21930_10000825 | JGI24738J21930_100008255 | 329 |
| 344 | 3300002076 | JGI24749J21850_1001345 | JGI24749J21850_10013455 | 329 |
| 345 | 3300002239 | JGI24034J26672_10000028 | JGI24034J26672_1000002883 | 329 |
| 346 | 3300003215 | JGI25153J46596_10000021 | JGI25153J46596_1000002121 | 329 |
| 347 | 3300003759 | Ga0055525_1000070 | Ga0055525_1000070126 | 329 |
| 348 | 3300003762 | Ga0055542_1000102 | Ga0055542_1000102100 | 329 |
| 349 | 3300003763 | Ga0055529_1000136 | Ga0055529_100013688 | 329 |
| 350 | 3300005327 | Ga0070658_10000611 | Ga0070658_100006118 | 329 |
| 351 | 3300005330 | Ga0070690_100000003 | Ga0070690_100000003113 | 329 |
| 352 | 3300005331 | Ga0070670_100008607 | Ga0070670_1000086078 | 329 |
| 353 | 3300005335 | Ga0070666_10000006 | Ga0070666_1000000678 | 329 |
| 354 | 3300005338 | Ga0068868_100027515 | Ga0068868_1000275154 | 329 |
| 355 | 3300005339 | Ga0070660_100017257 | Ga0070660_1000172573 | 329 |
| 356 | 3300005344 | Ga0070661_100072177 | Ga0070661_1000721772 | 329 |
| 357 | 3300005344 | Ga0070661_100159803 | Ga0070661_1001598032 | 329 |
| 358 | 3300005347 | Ga0070668_100043344 | Ga0070668_1000433442 | 329 |
| 359 | 3300005347 | Ga0070668_100081706 | Ga0070668_1000817062 | 329 |
| 360 | 3300005353 | Ga0070669_100001833 | Ga0070669_1000018338 | 329 |
| 361 | 3300005356 | Ga0070674_100002600 | Ga0070674_1000026001 | 329 |
| 362 | 3300005365 | Ga0070688_100002243 | Ga0070688_1000022433 | 329 |
| 363 | 3300005367 | Ga0070667_100012288 | Ga0070667_1000122886 | 329 |
| 364 | 3300005367 | Ga0070667_100082230 | Ga0070667_1000822304 | 329 |
| 365 | 3300005455 | Ga0070663_100057355 | Ga0070663_1000573552 | 329 |
| 366 | 3300005456 | Ga0070678_100000175 | Ga0070678_10000017531 | 329 |
| 367 | 3300005456 | Ga0070678_100003484 | Ga0070678_1000034844 | 329 |
| 368 | 3300005457 | Ga0070662_100198543 | Ga0070662_1001985431 | 329 |
| 369 | 3300005457 | Ga0070662_100240974 | Ga0070662_1002409742 | 329 |
| 370 | 3300005459 | Ga0068867_100013678 | Ga0068867_1000136786 | 329 |
| 371 | 3300005466 | Ga0070685_10000072 | Ga0070685_1000007210 | 329 |
| 372 | 3300005544 | Ga0070686_100000022 | Ga0070686_10000002251 | 329 |
| 373 | 3300005548 | Ga0070665_100000019 | Ga0070665_100000019310 | 329 |
| 374 | 3300005577 | Ga0068857_100218684 | Ga0068857_1002186841 | 329 |
| 375 | 3300005618 | Ga0068864_100022260 | Ga0068864_1000222605 | 329 |
| 376 | 3300005834 | Ga0068851_10015156 | Ga0068851_100151562 | 329 |
| 377 | 3300005841 | Ga0068863_100000048 | Ga0068863_10000004843 | 329 |
| 378 | 3300005842 | Ga0068858_100007591 | Ga0068858_1000075914 | 329 |
| 379 | 3300005843 | Ga0068860_100000014 | Ga0068860_10000001477 | 329 |
| 380 | 3300005844 | Ga0068862_100000613 | Ga0068862_10000061335 | 329 |
| 381 | 3300005985 | Ga0081539_10019897 | Ga0081539_100198973 | 329 |
| 382 | 3300006186 | Ga0075369_10021312 | Ga0075369_100213123 | 329 |
| 383 | 3300009148 | Ga0105243_10000222 | Ga0105243_1000022220 | 329 |
| 384 | 3300009174 | Ga0105241_10002643 | Ga0105241_100026436 | 329 |
| 385 | 3300009177 | Ga0105248_10095109 | Ga0105248_100951093 | 329 |
| 386 | 3300009553 | Ga0105249_10000104 | Ga0105249_1000010442 | 329 |
| 387 | 3300010375 | Ga0105239_10080033 | Ga0105239_100800333 | 329 |
| 388 | 3300012513 | Ga0157326_1003975 | Ga0157326_10039752 | 329 |
| 389 | 3300013100 | Ga0157373_10141361 | Ga0157373_101413611 | 329 |
| 390 | 3300013100 | Ga0157373_10190886 | Ga0157373_101908862 | 329 |
| 391 | 3300013102 | Ga0157371_10000066 | Ga0157371_1000006688 | 329 |
| 392 | 3300013104 | Ga0157370_10016012 | Ga0157370_100160125 | 329 |
| 393 | 3300013104 | Ga0157370_10259886 | Ga0157370_102598861 | 329 |
| 394 | 3300013105 | Ga0157369_10038117 | Ga0157369_100381173 | 329 |
| 395 | 3300013105 | Ga0157369_10052174 | Ga0157369_100521742 | 329 |
| 396 | 3300013306 | Ga0163162_10203112 | Ga0163162_102031122 | 329 |
| 397 | 3300013307 | Ga0157372_10324574 | Ga0157372_103245742 | 329 |
| 398 | 3300013307 | Ga0157372_10613967 | Ga0157372_106139671 | 329 |
| 399 | 3300014326 | Ga0157380_10005135 | Ga0157380_100051357 | 329 |
| 400 | 3300017792 | Ga0163161_10000020 | Ga0163161_1000002040 | 329 |
| 401 | 3300025226 | Ga0209674_102934 | Ga0209674_1029344 | 329 |
| 402 | 3300025230 | Ga0209563_100053 | Ga0209563_10005370 | 329 |
| 403 | 3300025250 | Ga0209026_1006768 | Ga0209026_10067684 | 329 |
| 404 | 3300025253 | Ga0209677_106246 | Ga0209677_1062464 | 329 |
| 405 | 3300025254 | Ga0209148_1000159 | Ga0209148_1000159122 | 329 |
| 406 | 3300025272 | Ga0209455_1000045 | Ga0209455_100004521 | 329 |
| 407 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023262 | 329 |
| 408 | 3300025321 | Ga0207656_10002317 | Ga0207656_100023175 | 329 |
| 409 | 3300025903 | Ga0207680_10000011 | Ga0207680_1000001176 | 329 |
| 410 | 3300025904 | Ga0207647_10000312 | Ga0207647_1000031218 | 329 |
| 411 | 3300025909 | Ga0207705_10000456 | Ga0207705_100004563 | 329 |
| 412 | 3300025909 | Ga0207705_10088799 | Ga0207705_100887992 | 329 |
| 413 | 3300025911 | Ga0207654_10009333 | Ga0207654_100093332 | 329 |
| 414 | 3300025913 | Ga0207695_10002974 | Ga0207695_1000297422 | 329 |
| 415 | 3300025914 | Ga0207671_10001453 | Ga0207671_100014533 | 329 |
| 416 | 3300025914 | Ga0207671_10006388 | Ga0207671_100063885 | 329 |
| 417 | 3300025919 | Ga0207657_10016196 | Ga0207657_100161966 | 329 |
| 418 | 3300025920 | Ga0207649_10000069 | Ga0207649_1000006969 | 329 |
| 419 | 3300025920 | Ga0207649_10073759 | Ga0207649_100737592 | 329 |
| 420 | 3300025923 | Ga0207681_10000045 | Ga0207681_10000045100 | 329 |
| 421 | 3300025924 | Ga0207694_10005782 | Ga0207694_100057829 | 329 |
| 422 | 3300025924 | Ga0207694_10008940 | Ga0207694_100089407 | 329 |
| 423 | 3300025925 | Ga0207650_10096956 | Ga0207650_100969562 | 329 |
| 424 | 3300025925 | Ga0207650_10104402 | Ga0207650_101044021 | 329 |
| 425 | 3300025931 | Ga0207644_10001102 | Ga0207644_1000110211 | 329 |
| 426 | 3300025932 | Ga0207690_10000846 | Ga0207690_1000084620 | 329 |
| 427 | 3300025935 | Ga0207709_10000047 | Ga0207709_10000047172 | 329 |
| 428 | 3300025937 | Ga0207669_10000508 | Ga0207669_100005086 | 329 |
| 429 | 3300025941 | Ga0207711_10006119 | Ga0207711_100061193 | 329 |
| 430 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001121 | 329 |
| 431 | 3300025949 | Ga0207667_10016642 | Ga0207667_100166422 | 329 |
| 432 | 3300025960 | Ga0207651_10180758 | Ga0207651_101807582 | 329 |
| 433 | 3300025961 | Ga0207712_10000013 | Ga0207712_1000001376 | 329 |
| 434 | 3300025972 | Ga0207668_10050054 | Ga0207668_100500544 | 329 |
| 435 | 3300025972 | Ga0207668_10078823 | Ga0207668_100788232 | 329 |
| 436 | 3300025981 | Ga0207640_10009764 | Ga0207640_100097642 | 329 |
| 437 | 3300025981 | Ga0207640_10101329 | Ga0207640_101013292 | 329 |
| 438 | 3300025986 | Ga0207658_10001075 | Ga0207658_1000107517 | 329 |
| 439 | 3300026023 | Ga0207677_10057934 | Ga0207677_100579343 | 329 |
| 440 | 3300026035 | Ga0207703_10000888 | Ga0207703_1000088832 | 329 |
| 441 | 3300026041 | Ga0207639_10000379 | Ga0207639_100003792 | 329 |
| 442 | 3300026067 | Ga0207678_10002708 | Ga0207678_100027084 | 329 |
| 443 | 3300026067 | Ga0207678_10021653 | Ga0207678_100216535 | 329 |
| 444 | 3300026078 | Ga0207702_10001108 | Ga0207702_1000110822 | 329 |
| 445 | 3300026078 | Ga0207702_10027313 | Ga0207702_100273132 | 329 |
| 446 | 3300026088 | Ga0207641_10000101 | Ga0207641_100001012 | 329 |
| 447 | 3300026095 | Ga0207676_10002582 | Ga0207676_100025827 | 329 |
| 448 | 3300026116 | Ga0207674_10282219 | Ga0207674_102822192 | 329 |
| 449 | 3300026118 | Ga0207675_100000640 | Ga0207675_1000006407 | 329 |
| 450 | 3300026121 | Ga0207683_10000882 | Ga0207683_100008821 | 329 |
| 451 | 3300026121 | Ga0207683_10059531 | Ga0207683_100595311 | 329 |
| 452 | 3300026142 | Ga0207698_10000220 | Ga0207698_1000022036 | 329 |
| 453 | 3300028379 | Ga0268266_10000025 | Ga0268266_10000025193 | 329 |
| 454 | 3300028380 | Ga0268265_10000345 | Ga0268265_1000034543 | 329 |
| 455 | 3300028381 | Ga0268264_10000037 | Ga0268264_1000003776 | 329 |
| 456 | 3300031456 | Ga0307513_10004798 | Ga0307513_100047986 | 329 |
| 457 | 3300037312 | Ga0395899_0028173 | Ga0395899_0028173_1185_2183 | 329 |
| 458 | 3300046471 | Ga0495650_0000491 | Ga0495650_0000491_14757_15755 | 329 |
| 459 | 3300046491 | Ga0495584_0053178 | Ga0495584_0053178_323_1321 | 329 |
| 460 | 3300046492 | Ga0495585_0005748 | Ga0495585_0005748_6301_7299 | 329 |
| 461 | 3300046501 | Ga0495607_0042348 | Ga0495607_0042348_105_1097 | 329 |
| 462 | 3300046506 | Ga0495583_0001935 | Ga0495583_0001935_14735_15733 | 329 |
| 463 | 3300046506 | Ga0495583_0029621 | Ga0495583_0029621_1231_2229 | 329 |
| 464 | 3300046506 | Ga0495583_0036850 | Ga0495583_0036850_757_1755 | 329 |
| 465 | 3300046507 | Ga0495606_0000379 | Ga0495606_0000379_12244_13242 | 329 |
| 466 | 3300046507 | Ga0495606_0048488 | Ga0495606_0048488_274_1272 | 329 |
| 467 | 3300046522 | Ga0495643_0001764 | Ga0495643_0001764_4609_5607 | 329 |
| 468 | 3300046522 | Ga0495643_0002663 | Ga0495643_0002663_1409_2407 | 329 |
| 469 | 3300046524 | Ga0495648_0000444 | Ga0495648_0000444_35121_36119 | 329 |
| 470 | 3300046525 | Ga0495663_0000341 | Ga0495663_0000341_12877_13875 | 329 |
| 471 | 3300046528 | Ga0495642_0054486 | Ga0495642_0054486_397_1395 | 329 |
| 472 | 3300046542 | Ga0495597_0065307 | Ga0495597_0065307_270_1268 | 329 |
| 473 | 3300046557 | Ga0495622_0002047 | Ga0495622_0002047_457_1455 | 329 |
| 474 | 3300046558 | Ga0495633_0004374 | Ga0495633_0004374_2980_3978 | 329 |
| 475 | 3300046616 | Ga0495668_0000548 | Ga0495668_0000548_549_1547 | 329 |
| 476 | 3300046648 | Ga0495611_0005333 | Ga0495611_0005333_3185_4183 | 329 |
| 477 | 3300046648 | Ga0495611_0102881 | Ga0495611_0102881_46_1044 | 329 |
| 478 | 3300046660 | Ga0495625_0000971 | Ga0495625_0000971_12388_13386 | 329 |
| 479 | 3300046660 | Ga0495625_0093982 | Ga0495625_0093982_459_1457 | 329 |
| 480 | 3300046665 | Ga0495661_0151100 | Ga0495661_0151100_35_1033 | 329 |
| 481 | 3300046684 | Ga0495669_0000378 | Ga0495669_0000378_14895_15893 | 329 |
| 482 | 3300046809 | Ga0495600_0029068 | Ga0495600_0029068_1968_2966 | 329 |
| 483 | 3300046810 | Ga0495660_0027691 | Ga0495660_0027691_1627_2625 | 329 |
| 484 | 3300047443 | Ga0495687_000192 | Ga0495687_000192_80502_81500 | 329 |
| 485 | 3300047443 | Ga0495687_012328 | Ga0495687_012328_459_1457 | 329 |
| 486 | 3300047445 | Ga0495677_0048013 | Ga0495677_0048013_434_1432 | 329 |
| 487 | 3300047470 | Ga0495681_0005121 | Ga0495681_0005121_7665_8663 | 329 |
| 488 | 3300047472 | Ga0495686_0001111 | Ga0495686_0001111_26725_27723 | 329 |
| 489 | 3300048905 | Ga0496102_0000049 | Ga0496102_0000049_126260_127252 | 329 |
| 490 | 3300048905 | Ga0496102_0001816 | Ga0496102_0001816_12807_13805 | 329 |
| 491 | 3300048906 | Ga0496103_0000037 | Ga0496103_0000037_52223_53215 | 329 |
| 492 | 3300048906 | Ga0496103_0000177 | Ga0496103_0000177_3061_4059 | 329 |
| 493 | 3300048907 | Ga0496104_0003305 | Ga0496104_0003305_3100_4098 | 329 |
| 494 | 3300048908 | Ga0496105_0005988 | Ga0496105_0005988_4553_5551 | 329 |
| 495 | 3300048909 | Ga0496106_0076540 | Ga0496106_0076540_1115_2104 | 329 |
| 496 | 3300048913 | Ga0496110_0032029 | Ga0496110_0032029_2618_3616 | 329 |
| 497 | 3300048914 | Ga0496111_0245733 | Ga0496111_0245733_220_1218 | 329 |
| 498 | 3300048918 | Ga0496115_0000410 | Ga0496115_0000410_29383_30381 | 329 |
| 499 | 3300048919 | Ga0496116_0003064 | Ga0496116_0003064_3045_4043 | 329 |
| 500 | 3300048919 | Ga0496116_0007919 | Ga0496116_0007919_7099_8091 | 329 |
| 501 | 3300048920 | Ga0496117_0000115 | Ga0496117_0000115_126260_127252 | 329 |
| 502 | 3300048920 | Ga0496117_0001327 | Ga0496117_0001327_12726_13724 | 329 |
| 503 | 3300048921 | Ga0496118_0000086 | Ga0496118_0000086_52237_53229 | 329 |
| 504 | 3300048921 | Ga0496118_0004352 | Ga0496118_0004352_2996_3994 | 329 |
| 505 | 3300048922 | Ga0496119_0025524 | Ga0496119_0025524_360_1358 | 329 |
| 506 | 3300048923 | Ga0496120_0073501 | Ga0496120_0073501_644_1636 | 329 |
| 507 | 3300048924 | Ga0496121_0023324 | Ga0496121_0023324_4027_5025 | 329 |
| 508 | 3300048925 | Ga0496122_0008312 | Ga0496122_0008312_9790_10788 | 329 |
| 509 | 3300048927 | Ga0496124_0000102 | Ga0496124_0000102_52237_53229 | 329 |
| 510 | 3300048927 | Ga0496124_0003194 | Ga0496124_0003194_12862_13860 | 329 |
| 511 | 3300048928 | Ga0496125_0003670 | Ga0496125_0003670_4449_5447 | 329 |
| 512 | 3300048929 | Ga0496126_0000467 | Ga0496126_0000467_12853_13851 | 329 |
| 513 | 3300049513 | Ga0501290_002015 | Ga0501290_002015_454_1446 | 329 |
| 514 | 3300049515 | Ga0501292_000015 | Ga0501292_000015_62175_63167 | 329 |
| 515 | 3300049517 | Ga0501294_000034 | Ga0501294_000034_12556_13548 | 329 |
| 516 | 3300049523 | Ga0501300_000543 | Ga0501300_000543_460_1452 | 329 |
| 517 | 3300049531 | Ga0501315_002062 | Ga0501315_002062_390_1382 | 329 |
| 518 | 3300049662 | Ga0501222_000470 | Ga0501222_000470_4882_5874 | 329 |
| 519 | 3300049664 | Ga0501224_001100 | Ga0501224_001100_515_1507 | 329 |
| 520 | 3300049668 | Ga0501233_001690 | Ga0501233_001690_2525_3517 | 329 |
| 521 | 3300049669 | Ga0501235_000937 | Ga0501235_000937_103_1095 | 329 |
| 522 | 3300049686 | Ga0501257_008979 | Ga0501257_008979_168_1160 | 329 |
| 523 | 3300049688 | Ga0501259_001871 | Ga0501259_001871_1372_2364 | 329 |
| 524 | 3300049690 | Ga0501261_001713 | Ga0501261_001713_834_1826 | 329 |
| 525 | 3300049705 | Ga0501225_0001874 | Ga0501225_0001874_1166_2158 | 329 |
| 526 | 3300049775 | Ga0501279_000015 | Ga0501279_000015_62231_63223 | 329 |
| 527 | 3300049776 | Ga0501280_000226 | Ga0501280_000226_11701_12693 | 329 |
| 528 | 3300049777 | Ga0501281_00176 | Ga0501281_00176_586_1578 | 329 |
| 529 | 3300053079 | Ga0500610_0001803 | Ga0500610_0001803_136_1134 | 329 |
| 530 | 3300053087 | Ga0500643_000166 | Ga0500643_000166_14355_15350 | 329 |
| 531 | 3300053130 | Ga0500642_0000389 | Ga0500642_0000389_12871_13869 | 329 |
| 532 | 3300053177 | Ga0500636_0000568 | Ga0500636_0000568_9846_10844 | 329 |
| 533 | 3300053730 | Ga0500645_000116 | Ga0500645_000116_57006_58004 | 329 |
| 534 | 3300005295 | Ga0065707_10120781 | Ga0065707_101207811 | 330 |
| 535 | 3300005331 | Ga0070670_100000209 | Ga0070670_10000020919 | 330 |
| 536 | 3300005347 | Ga0070668_100000028 | Ga0070668_10000002819 | 330 |
| 537 | 3300005355 | Ga0070671_100000750 | Ga0070671_1000007509 | 330 |
| 538 | 3300005367 | Ga0070667_100000127 | Ga0070667_10000012715 | 330 |
| 539 | 3300005548 | Ga0070665_100104964 | Ga0070665_1001049643 | 330 |
| 540 | 3300005617 | Ga0068859_100020455 | Ga0068859_1000204553 | 330 |
| 541 | 3300005617 | Ga0068859_100062524 | Ga0068859_1000625244 | 330 |
| 542 | 3300005618 | Ga0068864_100000062 | Ga0068864_10000006239 | 330 |
| 543 | 3300005841 | Ga0068863_100000064 | Ga0068863_10000006496 | 330 |
| 544 | 3300005841 | Ga0068863_100000092 | Ga0068863_10000009294 | 330 |
| 545 | 3300005841 | Ga0068863_100008963 | Ga0068863_1000089634 | 330 |
| 546 | 3300005843 | Ga0068860_100012465 | Ga0068860_1000124655 | 330 |
| 547 | 3300005844 | Ga0068862_100000079 | Ga0068862_10000007985 | 330 |
| 548 | 3300005844 | Ga0068862_100000149 | Ga0068862_1000001493 | 330 |
| 549 | 3300006931 | Ga0097620_100020455 | Ga0097620_1000204553 | 330 |
| 550 | 3300006931 | Ga0097620_100045333 | Ga0097620_1000453332 | 330 |
| 551 | 3300006931 | Ga0097620_100062523 | Ga0097620_1000625232 | 330 |
| 552 | 3300009553 | Ga0105249_10000056 | Ga0105249_10000056150 | 330 |
| 553 | 3300013306 | Ga0163162_10062080 | Ga0163162_100620804 | 330 |
| 554 | 3300013308 | Ga0157375_10339182 | Ga0157375_103391822 | 330 |
| 555 | 3300021388 | Ga0213875_10000606 | Ga0213875_100006066 | 330 |
| 556 | 3300025735 | Ga0207713_1004428 | Ga0207713_10044288 | 330 |
| 557 | 3300025900 | Ga0207710_10007599 | Ga0207710_100075994 | 330 |
| 558 | 3300025925 | Ga0207650_10000367 | Ga0207650_1000036734 | 330 |
| 559 | 3300025931 | Ga0207644_10000094 | Ga0207644_1000009449 | 330 |
| 560 | 3300025941 | Ga0207711_10000021 | Ga0207711_1000002160 | 330 |
| 561 | 3300025961 | Ga0207712_10000015 | Ga0207712_10000015145 | 330 |
| 562 | 3300025961 | Ga0207712_10001145 | Ga0207712_100011453 | 330 |
| 563 | 3300025961 | Ga0207712_10019149 | Ga0207712_100191494 | 330 |
| 564 | 3300025972 | Ga0207668_10001023 | Ga0207668_100010236 | 330 |
| 565 | 3300025986 | Ga0207658_10000424 | Ga0207658_1000042414 | 330 |
| 566 | 3300026088 | Ga0207641_10000004 | Ga0207641_10000004397 | 330 |
| 567 | 3300026088 | Ga0207641_10000107 | Ga0207641_10000107100 | 330 |
| 568 | 3300026088 | Ga0207641_10005433 | Ga0207641_100054332 | 330 |
| 569 | 3300026095 | Ga0207676_10000057 | Ga0207676_10000057100 | 330 |
| 570 | 3300028380 | Ga0268265_10000021 | Ga0268265_1000002195 | 330 |
| 571 | 3300028380 | Ga0268265_10000080 | Ga0268265_10000080100 | 330 |
| 572 | 3300028381 | Ga0268264_10000330 | Ga0268264_1000033041 | 330 |
| 573 | 3300028381 | Ga0268264_10002475 | Ga0268264_1000247512 | 330 |
| 574 | 3300028786 | Ga0307517_10016221 | Ga0307517_100162215 | 330 |
| 575 | 3300031901 | Ga0307406_10053216 | Ga0307406_100532162 | 330 |
| 576 | 3300031903 | Ga0307407_10026585 | Ga0307407_100265852 | 330 |
| 577 | 3300031995 | Ga0307409_100025655 | Ga0307409_1000256552 | 330 |
| 578 | 3300032002 | Ga0307416_100315910 | Ga0307416_1003159101 | 330 |
| 579 | 3300036401 | Ga0373937_0132943 | Ga0373937_0132943_307_1299 | 330 |
| 580 | 3300037853 | Ga0436364_0822555 | Ga0436364_0822555_166350_167351 | 330 |
| 581 | 3300042004 | Ga0439445_0005432 | Ga0439445_0005432_1709_2701 | 330 |
| 582 | 3300042015 | Ga0439462_0012507 | Ga0439462_0012507_590_1582 | 330 |
| 583 | 3300042435 | Ga0439434_0022240 | Ga0439434_0022240_90_1082 | 330 |
| 584 | 3300046692 | Ga0495671_0015865 | Ga0495671_0015865_925_1923 | 330 |
| 585 | 3300049516 | Ga0501293_001610 | Ga0501293_001610_678_1673 | 330 |
| 586 | 3300049581 | Ga0501047_0240125 | Ga0501047_0240125_431_1423 | 330 |
| 587 | 3300049581 | Ga0501047_0252223 | Ga0501047_0252223_256_1254 | 330 |
| 588 | 3300049585 | Ga0501069_0013786 | Ga0501069_0013786_2322_3320 | 330 |
| 589 | 3300049586 | Ga0501070_0211297 | Ga0501070_0211297_306_1304 | 330 |
| 590 | 3300049686 | Ga0501257_000133 | Ga0501257_000133_1156_2151 | 330 |
| 591 | 3300049758 | Ga0501241_007939 | Ga0501241_007939_115_1107 | 330 |
| 592 | 3300053118 | Ga0500594_0002524 | Ga0500594_0002524_899_1897 | 330 |
| 593 | 3300053134 | Ga0500658_0003044 | Ga0500658_0003044_2445_3437 | 330 |
| 594 | 3300053739 | Ga0500587_003581 | Ga0500587_003581_142_1143 | 330 |
| 595 | 3300000041 | ARcpr5oldR_c001007 | ARcpr5oldR_0010073 | 331 |
| 596 | 3300002774 | JGI25150J39212_1000096 | JGI25150J39212_100009651 | 331 |
| 597 | 3300003187 | JGI25151J46595_10014451 | JGI25151J46595_100144511 | 331 |
| 598 | 3300003215 | JGI25153J46596_10000028 | JGI25153J46596_1000002887 | 331 |
| 599 | 3300003773 | Ga0055537_1001847 | Ga0055537_10018475 | 331 |
| 600 | 3300003775 | Ga0055524_1000335 | Ga0055524_100033528 | 331 |
| 601 | 3300003781 | Ga0055536_1002813 | Ga0055536_10028136 | 331 |
| 602 | 3300003791 | Ga0055530_10000270 | Ga0055530_1000027028 | 331 |
| 603 | 3300003792 | Ga0055540_1002865 | Ga0055540_10028655 | 331 |
| 604 | 3300003794 | Ga0055531_10000371 | Ga0055531_1000037129 | 331 |
| 605 | 3300012512 | Ga0157327_1001315 | Ga0157327_10013152 | 331 |
| 606 | 3300025245 | Ga0207425_1000005 | Ga0207425_100000587 | 331 |
| 607 | 3300025245 | Ga0207425_1019426 | Ga0207425_10194262 | 331 |
| 608 | 3300025258 | Ga0209129_1000649 | Ga0209129_10006492 | 331 |
| 609 | 3300025263 | Ga0209565_1000030 | Ga0209565_1000030205 | 331 |
| 610 | 3300025273 | Ga0209673_1000768 | Ga0209673_100076835 | 331 |
| 611 | 3300025291 | Ga0209675_1000275 | Ga0209675_100027534 | 331 |
| 612 | 3300025291 | Ga0209675_1011380 | Ga0209675_10113801 | 331 |
| 613 | 3300025292 | Ga0209676_1000349 | Ga0209676_100034952 | 331 |
| 614 | 3300025292 | Ga0209676_1000648 | Ga0209676_100064836 | 331 |
| 615 | 3300025292 | Ga0209676_1003919 | Ga0209676_10039195 | 331 |
| 616 | 3300025292 | Ga0209676_1053111 | Ga0209676_10531111 | 331 |
| 617 | 3300025294 | Ga0209025_1000464 | Ga0209025_100046412 | 331 |
| 618 | 3300025297 | Ga0209758_1000002 | Ga0209758_10000021257 | 331 |
| 619 | 3300025297 | Ga0209758_1066035 | Ga0209758_10660351 | 331 |
| 620 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005171 | 331 |
| 621 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042232 | 331 |
| 622 | 3300025298 | Ga0209050_1006583 | Ga0209050_10065836 | 331 |
| 623 | 3300025298 | Ga0209050_1008927 | Ga0209050_10089275 | 331 |
| 624 | 3300025299 | Ga0209256_1000046 | Ga0209256_100004680 | 331 |
| 625 | 3300025303 | Ga0209051_1000153 | Ga0209051_1000153137 | 331 |
| 626 | 3300025304 | Ga0209257_1000135 | Ga0209257_1000135155 | 331 |
| 627 | 3300025304 | Ga0209257_1000533 | Ga0209257_100053318 | 331 |
| 628 | 3300025304 | Ga0209257_1002082 | Ga0209257_100208216 | 331 |
| 629 | 3300025304 | Ga0209257_1002135 | Ga0209257_10021356 | 331 |
| 630 | 3300025304 | Ga0209257_1024529 | Ga0209257_10245292 | 331 |
| 631 | 3300031911 | Ga0307412_10041222 | Ga0307412_100412223 | 331 |
| 632 | 3300032004 | Ga0307414_10043107 | Ga0307414_100431071 | 331 |
| 633 | 3300046660 | Ga0495625_0000652 | Ga0495625_0000652_47757_48797 | 331 |
| 634 | 3300053094 | Ga0500566_0049106 | Ga0500566_0049106_933_1928 | 331 |
| 635 | 3300053139 | Ga0500568_0001915 | Ga0500568_0001915_10313_11356 | 331 |
| 636 | 3300053140 | Ga0500573_0000086 | Ga0500573_0000086_4412_5410 | 331 |
| 637 | iso_pu_bacteria | 2643221563 | 2643835877 | 331 |
| 638 | iso_pu_bacteria | 2643221608 | 2644056802 | 331 |
| 639 | iso_pu_bacteria | 2852653556 | 2852655462 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3myf-assembly1.cif.gz_A | the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a | 0.3913 | 165 | 288 |
| 5ona-assembly1.cif.gz_A | drosophila bag-of-marbles cbm peptide bound to human caf40-cnot1 | 0.387 | 77 | 177 |
| 7ugw-assembly1.cif.gz_A | m. tuberculosis dna gyrase cleavage core bound to dna and evybactin | 0.3667 | 151 | 284 |
| 3myf-assembly1.cif.gz_A | the crystal structure of the hpt domain from the hpt sensor hybrid histidine kinase from shewanella to 1.80a | 0.3568 | 165 | 288 |
| 5bta-assembly1.cif.gz_A | crystal structure of a topoisomerase ii complex | 0.3557 | 151 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69625_45_175_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.8044 | 190 | 311 | 1.20.81.30 |
| af_I6Y479_96_222_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.7839 | 190 | 317 | 1.20.81.30 |
| af_I6Y479_96_222_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.7662 | 190 | 317 | 1.20.81.30 |
| af_O69625_45_175_1.20.81.30 | Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F | 0.7489 | 190 | 311 | 1.20.81.30 |
| af_O82178_465_589_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.4137 | 189 | 281 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2N1Y6-F1-model_v4 | Type II secretion system F family protein | 0.8825 | 169 | 308 |
GO:0005886
|
| AF-A0A532U2U0-F1-model_v4 | Secretion system protein F | 0.8749 | 81 | 294 |
GO:0005886
|
| AF-A0A5R2N1Y6-F1-model_v4 | Type II secretion system F family protein | 0.8652 | 169 | 308 |
GO:0005886
|
| AF-A0A7C6F4R4-F1-model_v4 | Type II secretion system protein GspF domain-containing protein | 0.8646 | 118 | 294 |
GO:0005886
|
| AF-A0A7J2Z1L9-F1-model_v4 | Type II secretion system F family protein | 0.86 | 91 | 295 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar