F471671

General Info

Members Datasets Scaffolds Average Seq Length
640 320 1280 297

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100059524|Ga0068859_1000595242
Length 334
Sequence MAYSLHSCHSMNEIGHGAPGQRLIPGQPSAKAAPVMTTPNAPLSFQDMILRLHAFWSEQGCLILQPYDMRMGAGTFHPATTLRALGPEPWSAAYVQPSRRPTDGRYGENPNRLQHYYQYQVILKPNPENLQELYLKSLAAIGVDPLAHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVTQFTYFQQVGGFDCKPVAGELTYGLERLAMYIQNVDNVYDLRFNDSVSYGQVFLENEKQMSKYNFEIADTAALFDGFAKAEAECQRCIAAEVPLAAYDQAIEASHLFNLLQARGVISVQERASYIGRVRDLAKGSCQSWIDVNKDAWAAKYPEWSL

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
179 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
180 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
181 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
182 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
259 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
264 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
281 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
282 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
283 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
284 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
285 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
286 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
290 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
293 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
294 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
299 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
300 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
301 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
302 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
303 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
304 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
305 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
306 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
307 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
308 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
309 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
310 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
311 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
312 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
313 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
314 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
315 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
316 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
317 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
318 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
319 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
320 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.25
Metatranscriptomes 0
Isolates 3.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.34
Nodule 0
Rhizoplane 1.72
Rhizosphere 77.03
Stem 0
Stem Tuber 0.16
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100059524 3300005617 Bacteria 3848
2 SwRhRL2b_contig_3273488 2162886007 Bacteria 68965
3 JGI24746J21847_1003612 3300001977 Bacteria 2436
4 JGI24034J26672_10013293 3300002239 Bacteria 1248
5 JGI24751J29686_10002278 3300002459 Bacteria 3890
6 JGI25165J46597_1000304 3300003214 Bacteria 61301
7 Ga0055526_1001142 3300003771 Bacteria 19221
8 Ga0055537_1001305 3300003773 Bacteria 10227
9 Ga0055536_1001561 3300003781 Bacteria 13717
10 Ga0055540_1004107 3300003792 Bacteria 6740
11 Ga0055540_1005162 3300003792 Bacteria 5609
12 Ga0065165_1003242 3300005262 Bacteria 11791
13 Ga0065704_10085034 3300005289 Bacteria 3269
14 Ga0065704_10103790 3300005289 Bacteria 2150
15 Ga0065715_10006877 3300005293 Bacteria 2790
16 Ga0065715_10209381 3300005293 Bacteria 1321
17 Ga0065707_10118449 3300005295 Bacteria 2185
18 Ga0070658_10000125 3300005327 Bacteria 68211
19 Ga0070658_10005530 3300005327 Bacteria 10257
20 Ga0070658_10012279 3300005327 Bacteria 6877
21 Ga0070658_10029617 3300005327 Bacteria 4398
22 Ga0070658_10257115 3300005327 Bacteria 1482
23 Ga0070676_10002711 3300005328 Bacteria 9126
24 Ga0070670_100000968 3300005331 Bacteria 22548
25 Ga0070670_100001411 3300005331 Bacteria 19302
26 Ga0070677_10000711 3300005333 Bacteria 11186
27 Ga0068869_100487237 3300005334 Bacteria 1027
28 Ga0070666_10039879 3300005335 Bacteria 3132
29 Ga0070680_100002665 3300005336 Bacteria 13221
30 Ga0070680_100086483 3300005336 Bacteria 2591
31 Ga0070680_100107474 3300005336 Bacteria 2321
32 Ga0070680_100194704 3300005336 Bacteria 1709
33 Ga0070660_100001230 3300005339 Bacteria 17386
34 Ga0070660_100023007 3300005339 Bacteria 4614
35 Ga0070660_100028512 3300005339 Bacteria 4178
36 Ga0070660_100039969 3300005339 Bacteria 3567
37 Ga0070661_100011424 3300005344 Bacteria 6186
38 Ga0070661_100175537 3300005344 Bacteria 1628
39 Ga0070692_10006901 3300005345 Bacteria 4963
40 Ga0070668_100144593 3300005347 Bacteria 1918
41 Ga0070668_100316533 3300005347 Bacteria 1312
42 Ga0070669_100000666 3300005353 Bacteria 25307
43 Ga0070675_100000229 3300005354 Bacteria 36015
44 Ga0070675_100010598 3300005354 Bacteria 7206
45 Ga0070671_100000052 3300005355 Bacteria 78614
46 Ga0070671_100020418 3300005355 Bacteria 5403
47 Ga0070671_100134797 3300005355 Bacteria 2082
48 Ga0070674_100003808 3300005356 Bacteria 8527
49 Ga0070674_100177142 3300005356 Bacteria 1630
50 Ga0070673_100070419 3300005364 Bacteria 2807
51 Ga0070673_100097164 3300005364 Bacteria 2418
52 Ga0070673_100160532 3300005364 Bacteria 1911
53 Ga0070673_100208935 3300005364 Bacteria 1685
54 Ga0070659_100013144 3300005366 Bacteria 6156
55 Ga0070659_100091496 3300005366 Bacteria 2438
56 Ga0070667_100000030 3300005367 Bacteria 178327
57 Ga0070667_100001382 3300005367 Bacteria 21733
58 Ga0070667_100025166 3300005367 Bacteria 4948
59 Ga0070700_100035701 3300005441 Bacteria 3010
60 Ga0070662_100001340 3300005457 Bacteria 15141
61 Ga0070662_100010302 3300005457 Bacteria 6129
62 Ga0070662_100080504 3300005457 Bacteria 2425
63 Ga0070681_10084678 3300005458 Bacteria 3123
64 Ga0070681_10466833 3300005458 Bacteria 1175
65 Ga0070679_100028637 3300005530 Bacteria 5493
66 Ga0070679_100241701 3300005530 Bacteria 1763
67 Ga0068853_100013468 3300005539 Bacteria 6678
68 Ga0068853_100153795 3300005539 Bacteria 2072
69 Ga0070672_100003890 3300005543 Bacteria 9732
70 Ga0070686_100339216 3300005544 Bacteria 1126
71 Ga0070665_100000076 3300005548 Bacteria 189228
72 Ga0070665_100000656 3300005548 Bacteria 46656
73 Ga0070665_100529802 3300005548 Bacteria 1190
74 Ga0068855_100000140 3300005563 Bacteria 92525
75 Ga0068855_100005980 3300005563 Bacteria 14846
76 Ga0068855_100007738 3300005563 Bacteria 12977
77 Ga0068855_100051216 3300005563 Bacteria 4864
78 Ga0068855_100097895 3300005563 Bacteria 3379
79 Ga0068855_100150692 3300005563 Bacteria 2645
80 Ga0070664_100012567 3300005564 Bacteria 6887
81 Ga0070664_100014362 3300005564 Bacteria 6456
82 Ga0068856_100029026 3300005614 Bacteria 5405
83 Ga0068856_100047311 3300005614 Bacteria 4238
84 Ga0068856_100288366 3300005614 Bacteria 1658
85 Ga0068852_100082473 3300005616 Bacteria 2857
86 Ga0068852_100394740 3300005616 Bacteria 1360
87 Ga0068852_100543310 3300005616 Bacteria 1161
88 Ga0068859_100503829 3300005617 Bacteria 1306
89 Ga0068864_100069633 3300005618 Bacteria 3059
90 Ga0068864_100150496 3300005618 Bacteria 2108
91 Ga0068863_100000093 3300005841 Bacteria 96862
92 Ga0068863_100010265 3300005841 Bacteria 9103
93 Ga0068863_100269896 3300005841 Bacteria 1647
94 Ga0068858_100002181 3300005842 Bacteria 19841
95 Ga0068858_100009589 3300005842 Bacteria 9233
96 Ga0068860_100051244 3300005843 Bacteria 3927
97 Ga0068860_100069638 3300005843 Bacteria 3344
98 Ga0068862_100001874 3300005844 Bacteria 19050
99 Ga0068862_100020685 3300005844 Bacteria 5497
100 Ga0075368_10005144 3300006042 Bacteria 4483
101 Ga0075368_10021811 3300006042 Bacteria 2434
102 Ga0075363_100009022 3300006048 Bacteria 4676
103 Ga0075363_100030701 3300006048 Bacteria 2783
104 Ga0075362_10000007 3300006177 Bacteria 116409
105 Ga0075367_10001665 3300006178 Bacteria 9690
106 Ga0075367_10002319 3300006178 Bacteria 8651
107 Ga0075369_10005245 3300006186 Bacteria 4832
108 Ga0075366_10000068 3300006195 Bacteria 39441
109 Ga0075366_10008584 3300006195 Bacteria 5687
110 Ga0075366_10178812 3300006195 Bacteria 1288
111 Ga0075366_10207631 3300006195 Bacteria 1192
112 Ga0075370_10003235 3300006353 Bacteria 7711
113 Ga0075370_10020758 3300006353 Bacteria 3593
114 Ga0075370_10040642 3300006353 Bacteria 2624
115 Ga0075370_10109905 3300006353 Bacteria 1600
116 Ga0075428_100300825 3300006844 Bacteria 1725
117 Ga0075431_100014301 3300006847 Bacteria 8027
118 Ga0097620_100059520 3300006931 Bacteria 3848
119 Ga0097620_100503876 3300006931 Bacteria 1306
120 Ga0105251_10000455 3300009011 Bacteria 39491
121 Ga0111539_10283736 3300009094 Bacteria 1927
122 Ga0111539_10370586 3300009094 Bacteria 1667
123 Ga0105245_10000244 3300009098 Bacteria 52007
124 Ga0105245_10099373 3300009098 Bacteria 2690
125 Ga0105243_10001141 3300009148 Bacteria 24108
126 Ga0105243_10156222 3300009148 Bacteria 1962
127 Ga0105248_10011520 3300009177 Bacteria 9745
128 Ga0105248_10028918 3300009177 Bacteria 6178
129 Ga0105248_10062971 3300009177 Bacteria 4163
130 Ga0105248_10164169 3300009177 Bacteria 2504
131 Ga0105248_10239890 3300009177 Bacteria 2041
132 Ga0105237_10178034 3300009545 Bacteria 2127
133 Ga0105238_10069749 3300009551 Bacteria 3515
134 Ga0105249_10128710 3300009553 Bacteria 2414
135 Ga0105249_10212281 3300009553 Bacteria 1900
136 Ga0105148_102570 3300009978 Bacteria 1280
137 Ga0105239_10862242 3300010375 Bacteria 1039
138 Ga0105246_10003808 3300011119 Bacteria 9144
139 Ga0105246_10163766 3300011119 Bacteria 1697
140 Ga0157373_10044861 3300013100 Bacteria 3156
141 Ga0157371_10000616 3300013102 Bacteria 42353
142 Ga0157371_10012976 3300013102 Bacteria 6343
143 Ga0157371_10025613 3300013102 Bacteria 4296
144 Ga0157370_10026519 3300013104 Bacteria 5720
145 Ga0157370_10038493 3300013104 Bacteria 4625
146 Ga0157370_10089702 3300013104 Bacteria 2888
147 Ga0157370_10163341 3300013104 Bacteria 2072
148 Ga0157370_10275950 3300013104 Bacteria 1553
149 Ga0157369_10001977 3300013105 Bacteria 24695
150 Ga0157369_10006865 3300013105 Bacteria 13133
151 Ga0157369_10144882 3300013105 Bacteria 2512
152 Ga0157369_10268581 3300013105 Bacteria 1778
153 Ga0157369_10305463 3300013105 Bacteria 1655
154 Ga0163162_10059549 3300013306 Bacteria 3851
155 Ga0163162_10527511 3300013306 Bacteria 1310
156 Ga0157372_10076425 3300013307 Bacteria 3781
157 Ga0157375_10070844 3300013308 Bacteria 3498
158 Ga0157380_10000410 3300014326 Bacteria 26058
159 Ga0157380_10038494 3300014326 Bacteria 3714
160 Ga0157380_10416956 3300014326 Bacteria 1279
161 Ga0157377_10187782 3300014745 Bacteria 1304
162 Ga0183363_1004 3300015690 Bacteria 416766
163 Ga0163161_10103946 3300017792 Bacteria 2117
164 Ga0213876_10048783 3300021384 Bacteria 2236
165 Ga0213875_10002509 3300021388 Bacteria 10966
166 Ga0209147_100518 3300025229 Bacteria 22374
167 Ga0209233_1000013 3300025261 Bacteria 1013785
168 Ga0209233_1006913 3300025261 Bacteria 3629
169 Ga0209565_1000056 3300025263 Bacteria 200189
170 Ga0209455_1002677 3300025272 Bacteria 6704
171 Ga0209455_1012370 3300025272 Bacteria 2045
172 Ga0209673_1007255 3300025273 Bacteria 5150
173 Ga0209676_1000322 3300025292 Bacteria 92241
174 Ga0209676_1004013 3300025292 Bacteria 8476
175 Ga0209564_1005674 3300025295 Bacteria 6999
176 Ga0209050_1000005 3300025298 Bacteria 1557793
177 Ga0209050_1000215 3300025298 Bacteria 129179
178 Ga0209051_1000153 3300025303 Bacteria 131166
179 Ga0209257_1000363 3300025304 Bacteria 91820
180 Ga0209257_1002082 3300025304 Bacteria 21069
181 Ga0209257_1011133 3300025304 Bacteria 4389
182 Ga0207697_10087260 3300025315 Bacteria 1320
183 Ga0207713_1020111 3300025735 Bacteria 3245
184 Ga0207682_10001851 3300025893 Bacteria 9641
185 Ga0207682_10088982 3300025893 Bacteria 1336
186 Ga0207680_10001677 3300025903 Bacteria 10460
187 Ga0207647_10078333 3300025904 Bacteria 1985
188 Ga0207705_10000004 3300025909 Bacteria 705756
189 Ga0207705_10000061 3300025909 Bacteria 150179
190 Ga0207705_10013013 3300025909 Bacteria 6005
191 Ga0207705_10060907 3300025909 Bacteria 2726
192 Ga0207695_10000018 3300025913 Bacteria 766611
193 Ga0207671_10009521 3300025914 Bacteria 8112
194 Ga0207657_10001004 3300025919 Bacteria 30014
195 Ga0207657_10003376 3300025919 Bacteria 17072
196 Ga0207657_10008093 3300025919 Bacteria 10720
197 Ga0207657_10010092 3300025919 Bacteria 9441
198 Ga0207657_10257712 3300025919 Bacteria 1389
199 Ga0207652_10018704 3300025921 Bacteria 5685
200 Ga0207652_10231383 3300025921 Bacteria 1666
201 Ga0207681_10001698 3300025923 Bacteria 14165
202 Ga0207681_10046298 3300025923 Bacteria 2925
203 Ga0207681_10053023 3300025923 Bacteria 2752
204 Ga0207694_10041526 3300025924 Bacteria 3545
205 Ga0207650_10004103 3300025925 Bacteria 9948
206 Ga0207659_10023891 3300025926 Bacteria 4087
207 Ga0207659_10206796 3300025926 Bacteria 1571
208 Ga0207687_10002943 3300025927 Bacteria 11554
209 Ga0207687_10106660 3300025927 Bacteria 2071
210 Ga0207687_10348925 3300025927 Bacteria 1205
211 Ga0207644_10000003 3300025931 Bacteria 585905
212 Ga0207644_10007734 3300025931 Bacteria 7015
213 Ga0207690_10004307 3300025932 Bacteria 8399
214 Ga0207706_10000112 3300025933 Bacteria 87100
215 Ga0207706_10003464 3300025933 Bacteria 15067
216 Ga0207706_10025410 3300025933 Bacteria 5307
217 Ga0207706_10041674 3300025933 Bacteria 4069
218 Ga0207686_10040960 3300025934 Bacteria 2821
219 Ga0207669_10003863 3300025937 Bacteria 6531
220 Ga0207691_10008630 3300025940 Bacteria 9781
221 Ga0207691_10167824 3300025940 Bacteria 1923
222 Ga0207711_10003573 3300025941 Bacteria 13449
223 Ga0207689_10014684 3300025942 Bacteria 6650
224 Ga0207679_10006328 3300025945 Bacteria 7479
225 Ga0207679_10030327 3300025945 Bacteria 3775
226 Ga0207667_10000282 3300025949 Bacteria 69790
227 Ga0207667_10005106 3300025949 Bacteria 16035
228 Ga0207667_10006926 3300025949 Bacteria 13698
229 Ga0207667_10085593 3300025949 Bacteria 3263
230 Ga0207667_10313001 3300025949 Bacteria 1604
231 Ga0207651_10024270 3300025960 Bacteria 3747
232 Ga0207651_10038479 3300025960 Bacteria 3145
233 Ga0207651_10049733 3300025960 Bacteria 2842
234 Ga0207712_10077113 3300025961 Bacteria 2414
235 Ga0207668_10009324 3300025972 Bacteria 5876
236 Ga0207668_10016838 3300025972 Bacteria 4571
237 Ga0207668_10030602 3300025972 Bacteria 3538
238 Ga0207668_10096474 3300025972 Bacteria 2185
239 Ga0207640_10017022 3300025981 Bacteria 4244
240 Ga0207658_10000019 3300025986 Bacteria 206335
241 Ga0207658_10001095 3300025986 Bacteria 21870
242 Ga0207658_10005783 3300025986 Bacteria 8461
243 Ga0207658_10018663 3300025986 Bacteria 4795
244 Ga0207658_10071917 3300025986 Bacteria 2620
245 Ga0207677_10309632 3300026023 Bacteria 1308
246 Ga0207703_10000927 3300026035 Bacteria 28560
247 Ga0207703_10005836 3300026035 Bacteria 9862
248 Ga0207639_10000439 3300026041 Bacteria 28780
249 Ga0207639_10069719 3300026041 Bacteria 2744
250 Ga0207678_10004354 3300026067 Bacteria 12714
251 Ga0207678_10156500 3300026067 Bacteria 1946
252 Ga0207702_10012444 3300026078 Bacteria 7083
253 Ga0207702_10027828 3300026078 Bacteria 4696
254 Ga0207641_10000029 3300026088 Bacteria 229383
255 Ga0207641_10008648 3300026088 Bacteria 8405
256 Ga0207641_10218639 3300026088 Bacteria 1765
257 Ga0207648_10003475 3300026089 Bacteria 16520
258 Ga0207648_10118603 3300026089 Bacteria 2326
259 Ga0207676_10023062 3300026095 Bacteria 4585
260 Ga0207676_10063022 3300026095 Bacteria 2943
261 Ga0207674_10045418 3300026116 Bacteria 4519
262 Ga0207674_10099570 3300026116 Bacteria 2889
263 Ga0207675_100004741 3300026118 Bacteria 13094
264 Ga0207698_10000192 3300026142 Bacteria 38082
265 Ga0207698_10064042 3300026142 Bacteria 2880
266 Ga0209967_1012396 3300027364 Bacteria 1205
267 Ga0209983_1018374 3300027665 Bacteria 1452
268 Ga0209998_10036078 3300027717 Bacteria 1110
269 Ga0209813_10000024 3300027866 Bacteria 72716
270 Ga0209813_10000318 3300027866 Bacteria 12750
271 Ga0209974_10001606 3300027876 Bacteria 8169
272 Ga0209974_10003541 3300027876 Bacteria 5617
273 Ga0209974_10006024 3300027876 Bacteria 4242
274 Ga0209974_10015375 3300027876 Bacteria 2541
275 Ga0207428_10175562 3300027907 Bacteria 1621
276 Ga0268266_10000347 3300028379 Bacteria 72151
277 Ga0268266_10001101 3300028379 Bacteria 33869
278 Ga0268266_10340667 3300028379 Bacteria 1407
279 Ga0268265_10012165 3300028380 Bacteria 5829
280 Ga0268265_10057409 3300028380 Bacteria 2966
281 Ga0268265_10276908 3300028380 Bacteria 1499
282 Ga0268264_10061399 3300028381 Bacteria 3152
283 Ga0268264_10100794 3300028381 Bacteria 2509
284 Ga0265318_10053123 3300028577 Bacteria 1520
285 Ga0265318_10059089 3300028577 Bacteria 1430
286 Ga0265338_10041563 3300028800 Bacteria 4298
287 Ga0265324_10001559 3300029957 Bacteria 12837
288 Ga0265328_10013943 3300031239 Bacteria 3172
289 Ga0265320_10005253 3300031240 Bacteria 8348
290 Ga0265331_10000132 3300031250 Bacteria 97353
291 Ga0307509_10233252 3300031507 Bacteria 1641
292 Ga0307408_100019660 3300031548 Bacteria 4549
293 Ga0307408_100061811 3300031548 Bacteria 2735
294 Ga0307408_100067608 3300031548 Bacteria 2628
295 Ga0307408_100116255 3300031548 Bacteria 2064
296 Ga0307408_100286657 3300031548 Bacteria 1373
297 Ga0265313_10001125 3300031595 Bacteria 25548
298 Ga0265313_10004263 3300031595 Bacteria 11080
299 Ga0265313_10040123 3300031595 Bacteria 2317
300 Ga0307508_10033831 3300031616 Bacteria 4610
301 Ga0316579_10099184 3300031691 Bacteria 1394
302 Ga0265314_10008509 3300031711 Bacteria 8772
303 Ga0265314_10230206 3300031711 Bacteria 1075
304 Ga0316576_10304909 3300031727 Bacteria 1190
305 Ga0307516_10050578 3300031730 Bacteria 4077
306 Ga0307405_10001461 3300031731 Bacteria 9956
307 Ga0307405_10013083 3300031731 Bacteria 4416
308 Ga0307405_10013678 3300031731 Bacteria 4335
309 Ga0307405_10022276 3300031731 Bacteria 3579
310 Ga0307405_10146095 3300031731 Bacteria 1656
311 Ga0307413_10002890 3300031824 Bacteria 7092
312 Ga0307413_10004395 3300031824 Bacteria 6128
313 Ga0307413_10005924 3300031824 Bacteria 5523
314 Ga0307413_10007662 3300031824 Bacteria 5037
315 Ga0307413_10023945 3300031824 Bacteria 3318
316 Ga0307413_10074970 3300031824 Bacteria 2145
317 Ga0307413_10083041 3300031824 Bacteria 2060
318 Ga0307413_10128872 3300031824 Bacteria 1728
319 Ga0307413_10143944 3300031824 Bacteria 1651
320 Ga0307413_10158877 3300031824 Bacteria 1585
321 Ga0307413_10187869 3300031824 Bacteria 1480
322 Ga0307413_10200324 3300031824 Bacteria 1441
323 Ga0307413_10252835 3300031824 Bacteria 1308
324 Ga0307413_10292341 3300031824 Bacteria 1231
325 Ga0307410_10029607 3300031852 Bacteria 3488
326 Ga0307410_10039374 3300031852 Bacteria 3103
327 Ga0307410_10062812 3300031852 Bacteria 2546
328 Ga0307410_10098795 3300031852 Bacteria 2088
329 Ga0307410_10133636 3300031852 Bacteria 1826
330 Ga0307410_10292445 3300031852 Bacteria 1282
331 Ga0307406_10001368 3300031901 Bacteria 13620
332 Ga0307406_10008314 3300031901 Bacteria 5783
333 Ga0307406_10027348 3300031901 Bacteria 3436
334 Ga0307407_10000814 3300031903 Bacteria 10352
335 Ga0307407_10016572 3300031903 Bacteria 3672
336 Ga0307407_10020219 3300031903 Bacteria 3406
337 Ga0307407_10163187 3300031903 Bacteria 1460
338 Ga0307407_10295452 3300031903 Bacteria 1127
339 Ga0307412_10000296 3300031911 Bacteria 31554
340 Ga0307412_10015183 3300031911 Bacteria 4558
341 Ga0307412_10022335 3300031911 Bacteria 3877
342 Ga0307412_10053926 3300031911 Bacteria 2667
343 Ga0307412_10113777 3300031911 Bacteria 1936
344 Ga0307412_10152188 3300031911 Bacteria 1708
345 Ga0307412_10251736 3300031911 Bacteria 1372
346 Ga0307409_100012206 3300031995 Bacteria 5463
347 Ga0307409_100030095 3300031995 Bacteria 3895
348 Ga0307409_100048359 3300031995 Bacteria 3236
349 Ga0307409_100051364 3300031995 Bacteria 3154
350 Ga0307409_100083097 3300031995 Bacteria 2595
351 Ga0307409_100125022 3300031995 Bacteria 2186
352 Ga0307409_100137004 3300031995 Bacteria 2102
353 Ga0307409_100483433 3300031995 Bacteria 1202
354 Ga0307409_100498155 3300031995 Bacteria 1186
355 Ga0307409_100607573 3300031995 Bacteria 1081
356 Ga0307416_100011735 3300032002 Bacteria 5867
357 Ga0307416_100014618 3300032002 Bacteria 5389
358 Ga0307416_100104814 3300032002 Bacteria 2473
359 Ga0307416_100112715 3300032002 Bacteria 2401
360 Ga0307416_100119502 3300032002 Bacteria 2344
361 Ga0307416_100131089 3300032002 Bacteria 2257
362 Ga0307416_100173822 3300032002 Bacteria 2009
363 Ga0307416_100368754 3300032002 Bacteria 1461
364 Ga0307416_100458158 3300032002 Bacteria 1329
365 Ga0307414_10000093 3300032004 Bacteria 71795
366 Ga0307414_10017382 3300032004 Bacteria 4399
367 Ga0307414_10025534 3300032004 Bacteria 3786
368 Ga0307414_10026676 3300032004 Bacteria 3721
369 Ga0307414_10032460 3300032004 Bacteria 3438
370 Ga0307414_10034706 3300032004 Bacteria 3348
371 Ga0307414_10035506 3300032004 Bacteria 3318
372 Ga0307414_10046452 3300032004 Bacteria 2981
373 Ga0307414_10059170 3300032004 Bacteria 2704
374 Ga0307414_10129363 3300032004 Bacteria 1957
375 Ga0307414_10285310 3300032004 Bacteria 1389
376 Ga0307414_10317039 3300032004 Bacteria 1325
377 Ga0307414_10397739 3300032004 Bacteria 1196
378 Ga0307414_10397874 3300032004 Bacteria 1195
379 Ga0307414_10537908 3300032004 Bacteria 1039
380 Ga0307414_10627829 3300032004 Bacteria 966
381 Ga0307411_10001442 3300032005 Bacteria 9717
382 Ga0307411_10004657 3300032005 Bacteria 6609
383 Ga0307411_10036927 3300032005 Bacteria 3066
384 Ga0307411_10042459 3300032005 Bacteria 2901
385 Ga0307411_10062988 3300032005 Bacteria 2476
386 Ga0307411_10088253 3300032005 Bacteria 2156
387 Ga0307411_10165813 3300032005 Bacteria 1660
388 Ga0307411_10192820 3300032005 Bacteria 1557
389 Ga0307411_10415929 3300032005 Bacteria 1115
390 Ga0307415_100005523 3300032126 Bacteria 6723
391 Ga0307415_100020020 3300032126 Bacteria 4075
392 Ga0307415_100058736 3300032126 Bacteria 2649
393 Ga0307415_100084999 3300032126 Bacteria 2272
394 Ga0307415_100114407 3300032126 Bacteria 2008
395 Ga0307415_100201851 3300032126 Bacteria 1578
396 Ga0307415_100270805 3300032126 Bacteria 1391
397 Ga0307415_100371049 3300032126 Bacteria 1212
398 Ga0316574_0283067 3300035398 Bacteria 1056
399 Ga0316582_0017686 3300036647 Bacteria 4131
400 Ga0316584_0185041 3300036712 Bacteria 1541
401 Ga0395899_0005191 3300037312 Bacteria 10133
402 Ga0395899_0013322 3300037312 Bacteria 6290
403 Ga0395900_0000036 3300037418 Bacteria 250619
404 Ga0395900_0000537 3300037418 Bacteria 53200
405 Ga0395900_0029932 3300037418 Bacteria 5587
406 Ga0395900_0091695 3300037418 Bacteria 3122
407 Ga0395900_0162006 3300037418 Bacteria 2281
408 Ga0395900_0258725 3300037418 Bacteria 1739
409 Ga0395900_0523302 3300037418 Bacteria 1133
410 Ga0395898_0018298 3300037466 Bacteria 7144
411 Ga0395898_0027493 3300037466 Bacteria 5709
412 Ga0395898_0155015 3300037466 Bacteria 2191
413 Ga0395898_0177247 3300037466 Bacteria 2037
414 Ga0395898_0202645 3300037466 Bacteria 1894
415 Ga0395905_0000264 3300037471 Bacteria 78482
416 Ga0395905_0233548 3300037471 Bacteria 1719
417 Ga0436364_1508843 3300037853 Bacteria 5035
418 Ga0395901_0000036 3300038443 Bacteria 214274
419 Ga0395901_0029368 3300038443 Bacteria 5660
420 Ga0395901_0034741 3300038443 Bacteria 5207
421 Ga0395901_0058716 3300038443 Bacteria 4002
422 Ga0395901_0356580 3300038443 Bacteria 1509
423 Ga0395901_0623158 3300038443 Bacteria 1085
424 Ga0400491_13144 3300038727 Bacteria 1309
425 Ga0400486_01641 3300038742 Bacteria 5974
426 Ga0400483_070915 3300039062 Bacteria 21331
427 Ga0400483_162525 3300039062 Bacteria 15366
428 Ga0400489_86148 3300039093 Bacteria 33757
429 Ga0237816_03186 3300039145 Bacteria 1211
430 Ga0436365_0284005 3300039437 Bacteria 1590
431 Ga0436365_0314538 3300039437 Bacteria 1765
432 Ga0436365_0383682 3300039437 Bacteria 8505
433 Ga0436360_0471211 3300039438 Bacteria 1057
434 Ga0436362_0022603 3300039453 Bacteria 1286
435 Ga0439445_0000033 3300042004 Bacteria 18479
436 Ga0439462_0004601 3300042015 Bacteria 3377
437 Ga0439464_0010519 3300042439 Bacteria 2443
438 Ga0466966_0017268 3300044684 Bacteria 4768
439 Ga0466961_0004036 3300044693 Bacteria 9199
440 Ga0453684_0069031 3300044712 Bacteria 4485
441 Ga0466971_0003200 3300044719 Bacteria 6981
442 Ga0466970_0065360 3300044765 Bacteria 1951
443 Ga0466957_0001319 3300044842 Bacteria 12971
444 Ga0466959_0014191 3300045049 Bacteria 5781
445 Ga0451576_0000007 3300045051 Bacteria 782228
446 Ga0451576_0871530 3300045051 Bacteria 945
447 Ga0466958_0000180 3300045836 Bacteria 22832
448 Ga0495617_013757 3300046452 Bacteria 2752
449 Ga0495627_000153 3300046453 Bacteria 80825
450 Ga0495627_000211 3300046453 Bacteria 63274
451 Ga0495638_0000033 3300046460 Bacteria 288195
452 Ga0495650_0000729 3300046471 Bacteria 41232
453 Ga0495650_0018566 3300046471 Bacteria 3450
454 Ga0495584_0073716 3300046491 Bacteria 1715
455 Ga0495596_0000053 3300046500 Bacteria 84061
456 Ga0495596_0029810 3300046500 Bacteria 2186
457 Ga0495607_0009057 3300046501 Bacteria 6767
458 Ga0495607_0073156 3300046501 Bacteria 1906
459 Ga0495583_0000391 3300046506 Bacteria 66874
460 Ga0495583_0016613 3300046506 Bacteria 3948
461 Ga0495606_0029114 3300046507 Bacteria 3883
462 Ga0495610_0000030 3300046512 Bacteria 265950
463 Ga0495610_0000095 3300046512 Bacteria 104629
464 Ga0495610_0003946 3300046512 Bacteria 11235
465 Ga0495616_0000032 3300046513 Bacteria 130692
466 Ga0495630_0028326 3300046517 Bacteria 4163
467 Ga0495631_0127332 3300046518 Bacteria 1095
468 Ga0495632_0000211 3300046519 Bacteria 59066
469 Ga0495632_0009668 3300046519 Bacteria 5790
470 Ga0495637_0000725 3300046520 Bacteria 22513
471 Ga0495637_0010240 3300046520 Bacteria 4541
472 Ga0495643_0000053 3300046522 Bacteria 202031
473 Ga0495643_0000199 3300046522 Bacteria 93741
474 Ga0495643_0080406 3300046522 Bacteria 1696
475 Ga0495648_0000014 3300046524 Bacteria 288365
476 Ga0495648_0010602 3300046524 Bacteria 7006
477 Ga0495663_0000020 3300046525 Bacteria 124560
478 Ga0495663_0001849 3300046525 Bacteria 6526
479 Ga0495663_0058639 3300046525 Bacteria 1207
480 Ga0495663_0119621 3300046525 Bacteria 881
481 Ga0495642_0014726 3300046528 Bacteria 3034
482 Ga0495654_0065764 3300046530 Bacteria 1730
483 Ga0495598_0016410 3300046537 Bacteria 1889
484 Ga0495621_0029564 3300046539 Bacteria 1868
485 Ga0495633_0000320 3300046558 Bacteria 54350
486 Ga0495633_0001684 3300046558 Bacteria 16614
487 Ga0495633_0002169 3300046558 Bacteria 14083
488 Ga0495633_0029309 3300046558 Bacteria 2678
489 Ga0495633_0029492 3300046558 Bacteria 2669
490 Ga0495625_0001923 3300046660 Bacteria 23484
491 Ga0495625_0039238 3300046660 Bacteria 3459
492 Ga0495625_0074549 3300046660 Bacteria 2377
493 Ga0495669_0038563 3300046684 Bacteria 2116
494 Ga0495669_0067702 3300046684 Bacteria 1623
495 Ga0495670_0000012 3300046691 Bacteria 170426
496 Ga0495670_0005882 3300046691 Bacteria 6013
497 Ga0495670_0032817 3300046691 Bacteria 2582
498 Ga0495670_0110339 3300046691 Bacteria 1423
499 Ga0495671_0000019 3300046692 Bacteria 288186
500 Ga0495671_0000031 3300046692 Bacteria 202030
501 Ga0495673_0000042 3300047469 Bacteria 288018
502 Ga0495681_0000008 3300047470 Bacteria 215295
503 Ga0495681_0000139 3300047470 Bacteria 62403
504 Ga0495681_0006384 3300047470 Bacteria 7758
505 Ga0495686_0032090 3300047472 Bacteria 3401
506 Ga0495686_0097760 3300047472 Bacteria 1774
507 Ga0495615_0000079 3300048090 Bacteria 29318
508 Ga0495626_0004009 3300048091 Bacteria 9196
509 Ga0496100_0087652 3300048903 Bacteria 2117
510 Ga0496102_0126170 3300048905 Bacteria 2392
511 Ga0496102_0139282 3300048905 Bacteria 2274
512 Ga0496104_0046412 3300048907 Bacteria 4091
513 Ga0496105_0263426 3300048908 Bacteria 1393
514 Ga0496106_0002981 3300048909 Bacteria 12607
515 Ga0496107_0014932 3300048910 Bacteria 5438
516 Ga0496110_0182757 3300048913 Bacteria 1904
517 Ga0496110_0193939 3300048913 Bacteria 1844
518 Ga0496113_0010429 3300048916 Bacteria 6144
519 Ga0496116_0000039 3300048919 Bacteria 349134
520 Ga0496116_0055374 3300048919 Bacteria 2606
521 Ga0496116_0081019 3300048919 Bacteria 2014
522 Ga0496117_0014807 3300048920 Bacteria 6692
523 Ga0496117_0018967 3300048920 Bacteria 5670
524 Ga0496117_0025644 3300048920 Bacteria 4630
525 Ga0496118_0021254 3300048921 Bacteria 5721
526 Ga0496118_0025757 3300048921 Bacteria 5032
527 Ga0496118_0114184 3300048921 Bacteria 1781
528 Ga0496118_0141984 3300048921 Bacteria 1520
529 Ga0496121_0000168 3300048924 Bacteria 144896
530 Ga0496121_0013654 3300048924 Bacteria 8708
531 Ga0496121_0031354 3300048924 Bacteria 4858
532 Ga0496122_0003146 3300048925 Bacteria 22091
533 Ga0496122_0009030 3300048925 Bacteria 10583
534 Ga0496122_0116510 3300048925 Bacteria 1737
535 Ga0496123_0000773 3300048926 Bacteria 51808
536 Ga0496123_0001419 3300048926 Bacteria 33502
537 Ga0496123_0001757 3300048926 Bacteria 28598
538 Ga0496123_0180075 3300048926 Bacteria 1105
539 Ga0496124_0002209 3300048927 Bacteria 25905
540 Ga0496124_0002938 3300048927 Bacteria 21440
541 Ga0496124_0008932 3300048927 Bacteria 10383
542 Ga0496124_0042838 3300048927 Bacteria 3894
543 Ga0496124_0138422 3300048927 Bacteria 1924
544 Ga0496125_0001052 3300048928 Bacteria 42645
545 Ga0496125_0003407 3300048928 Bacteria 19329
546 Ga0496125_0009082 3300048928 Bacteria 10283
547 Ga0496126_0000041 3300048929 Bacteria 340389
548 Ga0496126_0003145 3300048929 Bacteria 21275
549 Ga0496126_0154830 3300048929 Bacteria 1962
550 Ga0501034_0018915 3300049571 Bacteria 7056
551 Ga0501036_0113113 3300049572 Bacteria 2294
552 Ga0501047_0033955 3300049581 Bacteria 4925
553 Ga0501071_0280851 3300049587 Bacteria 1260
554 Ga0501073_0138970 3300049589 Bacteria 1683
555 Ga0501207_005540 3300049654 Bacteria 1751
556 Ga0501223_000011 3300049663 Bacteria 100919
557 Ga0501224_000013 3300049664 Bacteria 92254
558 Ga0501224_005131 3300049664 Bacteria 1870
559 Ga0501233_003999 3300049668 Bacteria 2676
560 Ga0501233_027114 3300049668 Bacteria 1270
561 Ga0501235_002029 3300049669 Bacteria 4341
562 Ga0501249_003971 3300049679 Bacteria 2993
563 Ga0501249_018162 3300049679 Bacteria 1519
564 Ga0501258_003066 3300049687 Bacteria 1509
565 Ga0501259_007360 3300049688 Bacteria 1761
566 Ga0501225_0003647 3300049705 Bacteria 4638
567 Ga0501234_000717 3300049707 Bacteria 5103
568 Ga0501083_0045908 3300049744 Bacteria 2954
569 Ga0501262_002330 3300049759 Bacteria 2148
570 Ga0501268_010489 3300049765 Bacteria 1444
571 Ga0501268_011338 3300049765 Bacteria 1405
572 Ga0501044_0002955 3300049823 Bacteria 19340
573 Ga0501226_000087 3300049853 Bacteria 25728
574 nmdc:mga03683_18_c1 3300050489 Bacteria 86681
575 nmdc:mga03n38_4694_c1 3300050490 Bacteria 4561
576 nmdc:mga00v17_115403_c1 3300050491 Bacteria 1707
577 nmdc:mga00v17_17636_c1 3300050491 Bacteria 4045
578 nmdc:mga00v17_84236_c1 3300050491 Bacteria 1990
579 nmdc:mga0k408_145_c1 3300050493 Bacteria 36258
580 nmdc:mga0k408_34526_c1 3300050493 Bacteria 2896
581 nmdc:mga06z11_219_c1 3300050494 Bacteria 22852
582 nmdc:mga06z11_50_c1 3300050494 Bacteria 50140
583 nmdc:mga04h51_1209_c1 3300050495 Bacteria 5963
584 nmdc:mga04h51_64_c1 3300050495 Bacteria 33433
585 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
586 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
587 nmdc:mga06r32_3260_c1 3300050510 Bacteria 14523
588 nmdc:mga08y16_238753_c1 3300050511 Bacteria 1879
589 nmdc:mga08y16_343803_c1 3300050511 Bacteria 1533
590 nmdc:mga0sz30_25296_c1 3300050516 Bacteria 2427
591 nmdc:mga0sz30_38_c1 3300050516 Bacteria 47836
592 nmdc:mga0sz30_742_c1 3300050516 Bacteria 11923
593 Ga0500643_001872 3300053087 Bacteria 11453
594 Ga0500644_0025966 3300053088 Bacteria 1808
595 Ga0500647_0014188 3300053091 Bacteria 3619
596 Ga0500566_0001165 3300053094 Bacteria 15291
597 Ga0500641_0141428 3300053096 Bacteria 1040
598 Ga0500594_0006241 3300053118 Bacteria 2673
599 Ga0500607_000705 3300053121 Bacteria 32100
600 Ga0500607_002241 3300053121 Bacteria 15971
601 Ga0500608_005101 3300053122 Bacteria 5173
602 Ga0500626_079768 3300053128 Bacteria 1448
603 Ga0500559_0001244 3300053136 Bacteria 15002
604 Ga0500559_0003563 3300053136 Bacteria 7616
605 Ga0500559_0005801 3300053136 Bacteria 5631
606 Ga0500577_0018707 3300053142 Bacteria 2232
607 Ga0500616_0000140 3300053153 Bacteria 122250
608 Ga0500622_0000495 3300053156 Bacteria 36800
609 Ga0500624_000052 3300053157 Bacteria 74126
610 Ga0500627_0007931 3300053158 Bacteria 3737
611 Ga0500567_001145 3300053723 Bacteria 10396
612 Ga0500625_000018 3300053729 Bacteria 94860
613 Ga0500596_011483 3300053735 Bacteria 1355
614 Ga0501084_0107265 3300054114 Bacteria 2346
615 Ga0500661_000319 3300055283 Bacteria 8817
616 Ga0466962_0002094 3300061719 Bacteria 9442
617 2511128733 2510917021 Bacteria 5705459
618 2512643602 2512564014 Bacteria 4639632
619 2600225526 2599185359 Bacteria 4772316
620 2643882910 2643221574 Bacteria 2789653
621 2643949202 2643221588 Bacteria 3692460
622 2644550165 2643221699 Bacteria 5731501
623 2644552673 2643221699 Bacteria 5731501
624 2739650156 2739367664 Bacteria 4114334
625 2740028629 2739367865 Bacteria 4114482
626 2809063738 2808606401 Bacteria 4586670
627 2809079644 2808606404 Bacteria 4652788
628 2809084009 2808606405 Bacteria 4586632
629 2819550504 2818991438 Bacteria 5793701
630 2830077301 2830075706 Bacteria 3855215
631 2848299720 2848297114 Bacteria 3608511
632 2880519332 2880518877 Bacteria 5012590
633 2882807825 2882806704 Bacteria 3007728
634 2885427957 2885427238 Bacteria 2291351
635 2919139869 2919138771 Bacteria 5281312
636 2919711084 2919709256 Bacteria 4318106
637 2928528525 2928526807 Bacteria 4760224
638 2928972938 2928972540 Bacteria 3058286
639 2977242718 2977240413 Bacteria 3191065
640 8054306036 8054302542 Bacteria 5698134
641 Ga0068859_100059524
642 SwRhRL2b_contig_3273488
643 JGI24746J21847_1003612
644 JGI24034J26672_10013293
645 JGI24751J29686_10002278
646 JGI25165J46597_1000304
647 Ga0055526_1001142
648 Ga0055537_1001305
649 Ga0055536_1001561
650 Ga0055540_1004107
651 Ga0055540_1005162
652 Ga0065165_1003242
653 Ga0065704_10085034
654 Ga0065704_10103790
655 Ga0065715_10006877
656 Ga0065715_10209381
657 Ga0065707_10118449
658 Ga0070658_10000125
659 Ga0070658_10005530
660 Ga0070658_10012279
661 Ga0070658_10029617
662 Ga0070658_10257115
663 Ga0070676_10002711
664 Ga0070670_100000968
665 Ga0070670_100001411
666 Ga0070677_10000711
667 Ga0068869_100487237
668 Ga0070666_10039879
669 Ga0070680_100002665
670 Ga0070680_100086483
671 Ga0070680_100107474
672 Ga0070680_100194704
673 Ga0070660_100001230
674 Ga0070660_100023007
675 Ga0070660_100028512
676 Ga0070660_100039969
677 Ga0070661_100011424
678 Ga0070661_100175537
679 Ga0070692_10006901
680 Ga0070668_100144593
681 Ga0070668_100316533
682 Ga0070669_100000666
683 Ga0070675_100000229
684 Ga0070675_100010598
685 Ga0070671_100000052
686 Ga0070671_100020418
687 Ga0070671_100134797
688 Ga0070674_100003808
689 Ga0070674_100177142
690 Ga0070673_100070419
691 Ga0070673_100097164
692 Ga0070673_100160532
693 Ga0070673_100208935
694 Ga0070659_100013144
695 Ga0070659_100091496
696 Ga0070667_100000030
697 Ga0070667_100001382
698 Ga0070667_100025166
699 Ga0070700_100035701
700 Ga0070662_100001340
701 Ga0070662_100010302
702 Ga0070662_100080504
703 Ga0070681_10084678
704 Ga0070681_10466833
705 Ga0070679_100028637
706 Ga0070679_100241701
707 Ga0068853_100013468
708 Ga0068853_100153795
709 Ga0070672_100003890
710 Ga0070686_100339216
711 Ga0070665_100000076
712 Ga0070665_100000656
713 Ga0070665_100529802
714 Ga0068855_100000140
715 Ga0068855_100005980
716 Ga0068855_100007738
717 Ga0068855_100051216
718 Ga0068855_100097895
719 Ga0068855_100150692
720 Ga0070664_100012567
721 Ga0070664_100014362
722 Ga0068856_100029026
723 Ga0068856_100047311
724 Ga0068856_100288366
725 Ga0068852_100082473
726 Ga0068852_100394740
727 Ga0068852_100543310
728 Ga0068859_100503829
729 Ga0068864_100069633
730 Ga0068864_100150496
731 Ga0068863_100000093
732 Ga0068863_100010265
733 Ga0068863_100269896
734 Ga0068858_100002181
735 Ga0068858_100009589
736 Ga0068860_100051244
737 Ga0068860_100069638
738 Ga0068862_100001874
739 Ga0068862_100020685
740 Ga0075368_10005144
741 Ga0075368_10021811
742 Ga0075363_100009022
743 Ga0075363_100030701
744 Ga0075362_10000007
745 Ga0075367_10001665
746 Ga0075367_10002319
747 Ga0075369_10005245
748 Ga0075366_10000068
749 Ga0075366_10008584
750 Ga0075366_10178812
751 Ga0075366_10207631
752 Ga0075370_10003235
753 Ga0075370_10020758
754 Ga0075370_10040642
755 Ga0075370_10109905
756 Ga0075428_100300825
757 Ga0075431_100014301
758 Ga0097620_100059520
759 Ga0097620_100503876
760 Ga0105251_10000455
761 Ga0111539_10283736
762 Ga0111539_10370586
763 Ga0105245_10000244
764 Ga0105245_10099373
765 Ga0105243_10001141
766 Ga0105243_10156222
767 Ga0105248_10011520
768 Ga0105248_10028918
769 Ga0105248_10062971
770 Ga0105248_10164169
771 Ga0105248_10239890
772 Ga0105237_10178034
773 Ga0105238_10069749
774 Ga0105249_10128710
775 Ga0105249_10212281
776 Ga0105148_102570
777 Ga0105239_10862242
778 Ga0105246_10003808
779 Ga0105246_10163766
780 Ga0157373_10044861
781 Ga0157371_10000616
782 Ga0157371_10012976
783 Ga0157371_10025613
784 Ga0157370_10026519
785 Ga0157370_10038493
786 Ga0157370_10089702
787 Ga0157370_10163341
788 Ga0157370_10275950
789 Ga0157369_10001977
790 Ga0157369_10006865
791 Ga0157369_10144882
792 Ga0157369_10268581
793 Ga0157369_10305463
794 Ga0163162_10059549
795 Ga0163162_10527511
796 Ga0157372_10076425
797 Ga0157375_10070844
798 Ga0157380_10000410
799 Ga0157380_10038494
800 Ga0157380_10416956
801 Ga0157377_10187782
802 Ga0183363_1004
803 Ga0163161_10103946
804 Ga0213876_10048783
805 Ga0213875_10002509
806 Ga0209147_100518
807 Ga0209233_1000013
808 Ga0209233_1006913
809 Ga0209565_1000056
810 Ga0209455_1002677
811 Ga0209455_1012370
812 Ga0209673_1007255
813 Ga0209676_1000322
814 Ga0209676_1004013
815 Ga0209564_1005674
816 Ga0209050_1000005
817 Ga0209050_1000215
818 Ga0209051_1000153
819 Ga0209257_1000363
820 Ga0209257_1002082
821 Ga0209257_1011133
822 Ga0207697_10087260
823 Ga0207713_1020111
824 Ga0207682_10001851
825 Ga0207682_10088982
826 Ga0207680_10001677
827 Ga0207647_10078333
828 Ga0207705_10000004
829 Ga0207705_10000061
830 Ga0207705_10013013
831 Ga0207705_10060907
832 Ga0207695_10000018
833 Ga0207671_10009521
834 Ga0207657_10001004
835 Ga0207657_10003376
836 Ga0207657_10008093
837 Ga0207657_10010092
838 Ga0207657_10257712
839 Ga0207652_10018704
840 Ga0207652_10231383
841 Ga0207681_10001698
842 Ga0207681_10046298
843 Ga0207681_10053023
844 Ga0207694_10041526
845 Ga0207650_10004103
846 Ga0207659_10023891
847 Ga0207659_10206796
848 Ga0207687_10002943
849 Ga0207687_10106660
850 Ga0207687_10348925
851 Ga0207644_10000003
852 Ga0207644_10007734
853 Ga0207690_10004307
854 Ga0207706_10000112
855 Ga0207706_10003464
856 Ga0207706_10025410
857 Ga0207706_10041674
858 Ga0207686_10040960
859 Ga0207669_10003863
860 Ga0207691_10008630
861 Ga0207691_10167824
862 Ga0207711_10003573
863 Ga0207689_10014684
864 Ga0207679_10006328
865 Ga0207679_10030327
866 Ga0207667_10000282
867 Ga0207667_10005106
868 Ga0207667_10006926
869 Ga0207667_10085593
870 Ga0207667_10313001
871 Ga0207651_10024270
872 Ga0207651_10038479
873 Ga0207651_10049733
874 Ga0207712_10077113
875 Ga0207668_10009324
876 Ga0207668_10016838
877 Ga0207668_10030602
878 Ga0207668_10096474
879 Ga0207640_10017022
880 Ga0207658_10000019
881 Ga0207658_10001095
882 Ga0207658_10005783
883 Ga0207658_10018663
884 Ga0207658_10071917
885 Ga0207677_10309632
886 Ga0207703_10000927
887 Ga0207703_10005836
888 Ga0207639_10000439
889 Ga0207639_10069719
890 Ga0207678_10004354
891 Ga0207678_10156500
892 Ga0207702_10012444
893 Ga0207702_10027828
894 Ga0207641_10000029
895 Ga0207641_10008648
896 Ga0207641_10218639
897 Ga0207648_10003475
898 Ga0207648_10118603
899 Ga0207676_10023062
900 Ga0207676_10063022
901 Ga0207674_10045418
902 Ga0207674_10099570
903 Ga0207675_100004741
904 Ga0207698_10000192
905 Ga0207698_10064042
906 Ga0209967_1012396
907 Ga0209983_1018374
908 Ga0209998_10036078
909 Ga0209813_10000024
910 Ga0209813_10000318
911 Ga0209974_10001606
912 Ga0209974_10003541
913 Ga0209974_10006024
914 Ga0209974_10015375
915 Ga0207428_10175562
916 Ga0268266_10000347
917 Ga0268266_10001101
918 Ga0268266_10340667
919 Ga0268265_10012165
920 Ga0268265_10057409
921 Ga0268265_10276908
922 Ga0268264_10061399
923 Ga0268264_10100794
924 Ga0265318_10053123
925 Ga0265318_10059089
926 Ga0265338_10041563
927 Ga0265324_10001559
928 Ga0265328_10013943
929 Ga0265320_10005253
930 Ga0265331_10000132
931 Ga0307509_10233252
932 Ga0307408_100019660
933 Ga0307408_100061811
934 Ga0307408_100067608
935 Ga0307408_100116255
936 Ga0307408_100286657
937 Ga0265313_10001125
938 Ga0265313_10004263
939 Ga0265313_10040123
940 Ga0307508_10033831
941 Ga0316579_10099184
942 Ga0265314_10008509
943 Ga0265314_10230206
944 Ga0316576_10304909
945 Ga0307516_10050578
946 Ga0307405_10001461
947 Ga0307405_10013083
948 Ga0307405_10013678
949 Ga0307405_10022276
950 Ga0307405_10146095
951 Ga0307413_10002890
952 Ga0307413_10004395
953 Ga0307413_10005924
954 Ga0307413_10007662
955 Ga0307413_10023945
956 Ga0307413_10074970
957 Ga0307413_10083041
958 Ga0307413_10128872
959 Ga0307413_10143944
960 Ga0307413_10158877
961 Ga0307413_10187869
962 Ga0307413_10200324
963 Ga0307413_10252835
964 Ga0307413_10292341
965 Ga0307410_10029607
966 Ga0307410_10039374
967 Ga0307410_10062812
968 Ga0307410_10098795
969 Ga0307410_10133636
970 Ga0307410_10292445
971 Ga0307406_10001368
972 Ga0307406_10008314
973 Ga0307406_10027348
974 Ga0307407_10000814
975 Ga0307407_10016572
976 Ga0307407_10020219
977 Ga0307407_10163187
978 Ga0307407_10295452
979 Ga0307412_10000296
980 Ga0307412_10015183
981 Ga0307412_10022335
982 Ga0307412_10053926
983 Ga0307412_10113777
984 Ga0307412_10152188
985 Ga0307412_10251736
986 Ga0307409_100012206
987 Ga0307409_100030095
988 Ga0307409_100048359
989 Ga0307409_100051364
990 Ga0307409_100083097
991 Ga0307409_100125022
992 Ga0307409_100137004
993 Ga0307409_100483433
994 Ga0307409_100498155
995 Ga0307409_100607573
996 Ga0307416_100011735
997 Ga0307416_100014618
998 Ga0307416_100104814
999 Ga0307416_100112715
1000 Ga0307416_100119502
1001 Ga0307416_100131089
1002 Ga0307416_100173822
1003 Ga0307416_100368754
1004 Ga0307416_100458158
1005 Ga0307414_10000093
1006 Ga0307414_10017382
1007 Ga0307414_10025534
1008 Ga0307414_10026676
1009 Ga0307414_10032460
1010 Ga0307414_10034706
1011 Ga0307414_10035506
1012 Ga0307414_10046452
1013 Ga0307414_10059170
1014 Ga0307414_10129363
1015 Ga0307414_10285310
1016 Ga0307414_10317039
1017 Ga0307414_10397739
1018 Ga0307414_10397874
1019 Ga0307414_10537908
1020 Ga0307414_10627829
1021 Ga0307411_10001442
1022 Ga0307411_10004657
1023 Ga0307411_10036927
1024 Ga0307411_10042459
1025 Ga0307411_10062988
1026 Ga0307411_10088253
1027 Ga0307411_10165813
1028 Ga0307411_10192820
1029 Ga0307411_10415929
1030 Ga0307415_100005523
1031 Ga0307415_100020020
1032 Ga0307415_100058736
1033 Ga0307415_100084999
1034 Ga0307415_100114407
1035 Ga0307415_100201851
1036 Ga0307415_100270805
1037 Ga0307415_100371049
1038 Ga0316574_0283067
1039 Ga0316582_0017686
1040 Ga0316584_0185041
1041 Ga0395899_0005191
1042 Ga0395899_0013322
1043 Ga0395900_0000036
1044 Ga0395900_0000537
1045 Ga0395900_0029932
1046 Ga0395900_0091695
1047 Ga0395900_0162006
1048 Ga0395900_0258725
1049 Ga0395900_0523302
1050 Ga0395898_0018298
1051 Ga0395898_0027493
1052 Ga0395898_0155015
1053 Ga0395898_0177247
1054 Ga0395898_0202645
1055 Ga0395905_0000264
1056 Ga0395905_0233548
1057 Ga0436364_1508843
1058 Ga0395901_0000036
1059 Ga0395901_0029368
1060 Ga0395901_0034741
1061 Ga0395901_0058716
1062 Ga0395901_0356580
1063 Ga0395901_0623158
1064 Ga0400491_13144
1065 Ga0400486_01641
1066 Ga0400483_070915
1067 Ga0400483_162525
1068 Ga0400489_86148
1069 Ga0237816_03186
1070 Ga0436365_0284005
1071 Ga0436365_0314538
1072 Ga0436365_0383682
1073 Ga0436360_0471211
1074 Ga0436362_0022603
1075 Ga0439445_0000033
1076 Ga0439462_0004601
1077 Ga0439464_0010519
1078 Ga0466966_0017268
1079 Ga0466961_0004036
1080 Ga0453684_0069031
1081 Ga0466971_0003200
1082 Ga0466970_0065360
1083 Ga0466957_0001319
1084 Ga0466959_0014191
1085 Ga0451576_0000007
1086 Ga0451576_0871530
1087 Ga0466958_0000180
1088 Ga0495617_013757
1089 Ga0495627_000153
1090 Ga0495627_000211
1091 Ga0495638_0000033
1092 Ga0495650_0000729
1093 Ga0495650_0018566
1094 Ga0495584_0073716
1095 Ga0495596_0000053
1096 Ga0495596_0029810
1097 Ga0495607_0009057
1098 Ga0495607_0073156
1099 Ga0495583_0000391
1100 Ga0495583_0016613
1101 Ga0495606_0029114
1102 Ga0495610_0000030
1103 Ga0495610_0000095
1104 Ga0495610_0003946
1105 Ga0495616_0000032
1106 Ga0495630_0028326
1107 Ga0495631_0127332
1108 Ga0495632_0000211
1109 Ga0495632_0009668
1110 Ga0495637_0000725
1111 Ga0495637_0010240
1112 Ga0495643_0000053
1113 Ga0495643_0000199
1114 Ga0495643_0080406
1115 Ga0495648_0000014
1116 Ga0495648_0010602
1117 Ga0495663_0000020
1118 Ga0495663_0001849
1119 Ga0495663_0058639
1120 Ga0495663_0119621
1121 Ga0495642_0014726
1122 Ga0495654_0065764
1123 Ga0495598_0016410
1124 Ga0495621_0029564
1125 Ga0495633_0000320
1126 Ga0495633_0001684
1127 Ga0495633_0002169
1128 Ga0495633_0029309
1129 Ga0495633_0029492
1130 Ga0495625_0001923
1131 Ga0495625_0039238
1132 Ga0495625_0074549
1133 Ga0495669_0038563
1134 Ga0495669_0067702
1135 Ga0495670_0000012
1136 Ga0495670_0005882
1137 Ga0495670_0032817
1138 Ga0495670_0110339
1139 Ga0495671_0000019
1140 Ga0495671_0000031
1141 Ga0495673_0000042
1142 Ga0495681_0000008
1143 Ga0495681_0000139
1144 Ga0495681_0006384
1145 Ga0495686_0032090
1146 Ga0495686_0097760
1147 Ga0495615_0000079
1148 Ga0495626_0004009
1149 Ga0496100_0087652
1150 Ga0496102_0126170
1151 Ga0496102_0139282
1152 Ga0496104_0046412
1153 Ga0496105_0263426
1154 Ga0496106_0002981
1155 Ga0496107_0014932
1156 Ga0496110_0182757
1157 Ga0496110_0193939
1158 Ga0496113_0010429
1159 Ga0496116_0000039
1160 Ga0496116_0055374
1161 Ga0496116_0081019
1162 Ga0496117_0014807
1163 Ga0496117_0018967
1164 Ga0496117_0025644
1165 Ga0496118_0021254
1166 Ga0496118_0025757
1167 Ga0496118_0114184
1168 Ga0496118_0141984
1169 Ga0496121_0000168
1170 Ga0496121_0013654
1171 Ga0496121_0031354
1172 Ga0496122_0003146
1173 Ga0496122_0009030
1174 Ga0496122_0116510
1175 Ga0496123_0000773
1176 Ga0496123_0001419
1177 Ga0496123_0001757
1178 Ga0496123_0180075
1179 Ga0496124_0002209
1180 Ga0496124_0002938
1181 Ga0496124_0008932
1182 Ga0496124_0042838
1183 Ga0496124_0138422
1184 Ga0496125_0001052
1185 Ga0496125_0003407
1186 Ga0496125_0009082
1187 Ga0496126_0000041
1188 Ga0496126_0003145
1189 Ga0496126_0154830
1190 Ga0501034_0018915
1191 Ga0501036_0113113
1192 Ga0501047_0033955
1193 Ga0501071_0280851
1194 Ga0501073_0138970
1195 Ga0501207_005540
1196 Ga0501223_000011
1197 Ga0501224_000013
1198 Ga0501224_005131
1199 Ga0501233_003999
1200 Ga0501233_027114
1201 Ga0501235_002029
1202 Ga0501249_003971
1203 Ga0501249_018162
1204 Ga0501258_003066
1205 Ga0501259_007360
1206 Ga0501225_0003647
1207 Ga0501234_000717
1208 Ga0501083_0045908
1209 Ga0501262_002330
1210 Ga0501268_010489
1211 Ga0501268_011338
1212 Ga0501044_0002955
1213 Ga0501226_000087
1214 nmdc:mga03683_18_c1
1215 nmdc:mga03n38_4694_c1
1216 nmdc:mga00v17_115403_c1
1217 nmdc:mga00v17_17636_c1
1218 nmdc:mga00v17_84236_c1
1219 nmdc:mga0k408_145_c1
1220 nmdc:mga0k408_34526_c1
1221 nmdc:mga06z11_219_c1
1222 nmdc:mga06z11_50_c1
1223 nmdc:mga04h51_1209_c1
1224 nmdc:mga04h51_64_c1
1225 nmdc:mga07m45_4_c1
1226 nmdc:mga07m45_8_c1
1227 nmdc:mga06r32_3260_c1
1228 nmdc:mga08y16_238753_c1
1229 nmdc:mga08y16_343803_c1
1230 nmdc:mga0sz30_25296_c1
1231 nmdc:mga0sz30_38_c1
1232 nmdc:mga0sz30_742_c1
1233 Ga0500643_001872
1234 Ga0500644_0025966
1235 Ga0500647_0014188
1236 Ga0500566_0001165
1237 Ga0500641_0141428
1238 Ga0500594_0006241
1239 Ga0500607_000705
1240 Ga0500607_002241
1241 Ga0500608_005101
1242 Ga0500626_079768
1243 Ga0500559_0001244
1244 Ga0500559_0003563
1245 Ga0500559_0005801
1246 Ga0500577_0018707
1247 Ga0500616_0000140
1248 Ga0500622_0000495
1249 Ga0500624_000052
1250 Ga0500627_0007931
1251 Ga0500567_001145
1252 Ga0500625_000018
1253 Ga0500596_011483
1254 Ga0501084_0107265
1255 Ga0500661_000319
1256 Ga0466962_0002094
1257 2511128733
1258 2512643602
1259 2600225526
1260 2643882910
1261 2643949202
1262 2644550165
1263 2644552673
1264 2739650156
1265 2740028629
1266 2809063738
1267 2809079644
1268 2809084009
1269 2819550504
1270 2830077301
1271 2848299720
1272 2880519332
1273 2882807825
1274 2885427957
1275 2919139869
1276 2919711084
1277 2928528525
1278 2928972938
1279 2977242718
1280 8054306036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02091

tRNA-synt_2e

Glycyl-tRNA synthetase alpha subunit

45

322

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j5w-assembly1.cif.gz_A crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution 0.9816 9 288
1j5w-assembly1.cif.gz_B crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution 0.9814 9 288
5f5w-assembly1.cif.gz_A crystal structure of the alpha subunit of glycyl trna synthetase (glyrs) from aquifex aeolicus in complex with an analog of glycyl adenylate (gly-sa) 0.9796 9 287
8ie2-assembly2.cif.gz_C crystal structure of lactiplantibacillus plantarum glyrs 0.9788 6 291
3rf1-assembly1.cif.gz_B the crystal structure of glycyl-trna synthetase subunit alpha from campylobacter jejuni subsp. jejuni nctc 11168 0.9787 9 287
ID Description Score Start End Superfamily
1j5wB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9752 214 288 1.20.58.180
af_A0A1D6NXM7_295_374_1.20.58.180 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9699 214 291 1.20.58.180
af_P00960_1_214_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9695 6 213 3.30.930.10
5f5wA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Class II aaRS and biotin synthetases; domain 2 0.9692 214 287 1.20.58.180
af_A0A1D6NXM7_66_257_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9682 34 199 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A845S859-F1-model_v4 deleted 0.9988 167 288
AF-B0L8W9-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9985 80 185 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A3D3IVH8-F1-model_v4 Glycine--tRNA ligase alpha subunit (EC 6.1.1.14) (Glycyl-tRNA synthetase alpha subunit) 0.9965 167 276 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A381ZST8-F1-model_v4 glycine--tRNA ligase (EC 6.1.1.14) 0.9959 114 286 GO:0004820
GO:0005524
GO:0005829
GO:0006426
AF-A0A257PU44-F1-model_v4 Glycine--tRNA ligase alpha subunit (EC 6.1.1.14) (Glycyl-tRNA synthetase alpha subunit) 0.9957 211 286 GO:0004820
GO:0005524
GO:0005829
GO:0006426

Map