F471672

General Info

Members Datasets Scaffolds Average Seq Length
640 273 1280 84

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100145658|Ga0068863_1001456582
Length 97
Sequence MSDPKYLSEGPAVQRVEIYTKTFCGFCWRAKQLLDSKGIEYREISVDFGGEAKQEMLQRSNGKTTVPQIFVNGRHIGGCNELIALDRDGRLDELLAA

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 3.28
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100145658 3300005841 Bacteria 2265
2 JGI24736J21556_1007326 3300001904 Bacteria 1855
3 JGI24740J21852_10018972 3300001979 Bacteria 2430
4 JGI24739J22299_10004656 3300001989 Bacteria 5245
5 JGI24737J22298_10000387 3300001990 Bacteria 15049
6 JGI24737J22298_10016831 3300001990 Bacteria 2359
7 JGI24737J22298_10242756 3300001990 Bacteria 532
8 JGI24735J21928_10170622 3300002067 Bacteria 629
9 JGI24738J21930_10010451 3300002075 Bacteria 2066
10 Ga0065715_10035206 3300005293 Bacteria 1815
11 Ga0070658_10046454 3300005327 Bacteria 3513
12 Ga0070658_10115415 3300005327 Bacteria 2227
13 Ga0070658_10926345 3300005327 Unclassified 758
14 Ga0070676_10020603 3300005328 Bacteria 3684
15 Ga0070676_10215639 3300005328 Bacteria 1265
16 Ga0070683_100013151 3300005329 Bacteria 7206
17 Ga0070683_100055119 3300005329 Unclassified 3688
18 Ga0070683_100084522 3300005329 Bacteria 2973
19 Ga0070683_100098698 3300005329 Bacteria 2748
20 Ga0070683_100300372 3300005329 Bacteria 1527
21 Ga0070690_100024405 3300005330 Bacteria 3717
22 Ga0070690_100979667 3300005330 Unclassified 665
23 Ga0070670_100006442 3300005331 Bacteria 9938
24 Ga0070670_101737840 3300005331 Bacteria 574
25 Ga0070677_10129976 3300005333 Bacteria 1148
26 Ga0068869_100007282 3300005334 Bacteria 7051
27 Ga0068869_100061478 3300005334 Bacteria 2755
28 Ga0068869_100386913 3300005334 Bacteria 1147
29 Ga0070666_10068945 3300005335 Bacteria 2404
30 Ga0070666_10371718 3300005335 Bacteria 1025
31 Ga0070666_11358491 3300005335 Bacteria 531
32 Ga0070680_100313700 3300005336 Bacteria 1331
33 Ga0070680_100350039 3300005336 Unclassified 1256
34 Ga0068868_100000214 3300005338 Bacteria 39101
35 Ga0068868_100202105 3300005338 Bacteria 1657
36 Ga0068868_100307071 3300005338 Bacteria 1349
37 Ga0070660_100002970 3300005339 Bacteria 11669
38 Ga0070660_100008192 3300005339 Bacteria 7306
39 Ga0070660_100084881 3300005339 Bacteria 2489
40 Ga0070660_100224875 3300005339 Bacteria 1526
41 Ga0070660_100836226 3300005339 Bacteria 775
42 Ga0070689_100936182 3300005340 Bacteria 768
43 Ga0070687_100828001 3300005343 Bacteria 658
44 Ga0070692_10013017 3300005345 Bacteria 3868
45 Ga0070668_100050254 3300005347 Bacteria 3210
46 Ga0070668_100268827 3300005347 Bacteria 1420
47 Ga0070668_100410701 3300005347 Bacteria 1157
48 Ga0070668_101011663 3300005347 Bacteria 747
49 Ga0070669_100001233 3300005353 Bacteria 18559
50 Ga0070669_100026170 3300005353 Bacteria 4197
51 Ga0070669_100246378 3300005353 Bacteria 1421
52 Ga0070669_100518284 3300005353 Bacteria 991
53 Ga0070675_100084250 3300005354 Bacteria 2655
54 Ga0070675_100091666 3300005354 Bacteria 2546
55 Ga0070675_100137199 3300005354 Bacteria 2088
56 Ga0070675_100532331 3300005354 Bacteria 1061
57 Ga0070675_100677703 3300005354 Bacteria 938
58 Ga0070671_100002731 3300005355 Bacteria 13704
59 Ga0070671_102053134 3300005355 Unclassified 509
60 Ga0070674_100002539 3300005356 Bacteria 10111
61 Ga0070674_100008308 3300005356 Bacteria 6176
62 Ga0070674_100438201 3300005356 Bacteria 1076
63 Ga0070673_100000537 3300005364 Bacteria 20426
64 Ga0070673_100008673 3300005364 Bacteria 6775
65 Ga0070673_100127510 3300005364 Bacteria 2131
66 Ga0070659_100001927 3300005366 Bacteria 14828
67 Ga0070659_100003141 3300005366 Bacteria 11763
68 Ga0070659_100084258 3300005366 Bacteria 2542
69 Ga0070659_100279722 3300005366 Bacteria 1388
70 Ga0070659_101287455 3300005366 Unclassified 648
71 Ga0070667_100000045 3300005367 Bacteria 164821
72 Ga0070667_100322434 3300005367 Bacteria 1394
73 Ga0070667_101733502 3300005367 Bacteria 588
74 Ga0070703_10404471 3300005406 Bacteria 595
75 Ga0070709_11043475 3300005434 Bacteria 652
76 Ga0070714_100015057 3300005435 Bacteria 6218
77 Ga0070714_100033835 3300005435 Bacteria 4276
78 Ga0070714_100258500 3300005435 Bacteria 1612
79 Ga0070714_100428525 3300005435 Bacteria 1254
80 Ga0070714_102178025 3300005435 Bacteria 540
81 Ga0070714_102458320 3300005435 Unclassified 506
82 Ga0070701_11374033 3300005438 Bacteria 507
83 Ga0070711_101208738 3300005439 Bacteria 654
84 Ga0070700_100275364 3300005441 Unclassified 1218
85 Ga0070700_101141061 3300005441 Bacteria 648
86 Ga0070694_100006839 3300005444 Bacteria 6928
87 Ga0070694_100291480 3300005444 Bacteria 1247
88 Ga0070694_101437594 3300005444 Bacteria 582
89 Ga0070663_100795029 3300005455 Bacteria 811
90 Ga0070678_100052668 3300005456 Bacteria 2957
91 Ga0070662_100000242 3300005457 Bacteria 32222
92 Ga0070662_100005912 3300005457 Bacteria 7850
93 Ga0070662_100659530 3300005457 Unclassified 883
94 Ga0070662_100805337 3300005457 Bacteria 799
95 Ga0070662_101026937 3300005457 Bacteria 706
96 Ga0070662_101065376 3300005457 Bacteria 693
97 Ga0070681_10375747 3300005458 Bacteria 1332
98 Ga0070681_11172010 3300005458 Bacteria 690
99 Ga0068867_100001284 3300005459 Bacteria 17297
100 Ga0068867_100001964 3300005459 Bacteria 14339
101 Ga0070685_10151464 3300005466 Bacteria 1470
102 Ga0070707_100009588 3300005468 Bacteria 8994
103 Ga0070707_100434116 3300005468 Unclassified 1274
104 Ga0070698_101058532 3300005471 Bacteria 759
105 Ga0070699_101075876 3300005518 Archaea 738
106 Ga0070679_100063689 3300005530 Bacteria 3675
107 Ga0070679_100105058 3300005530 Bacteria 2811
108 Ga0070684_100026244 3300005535 Bacteria 4905
109 Ga0070684_100087207 3300005535 Bacteria 2771
110 Ga0070684_100090236 3300005535 Bacteria 2725
111 Ga0070684_100977522 3300005535 Bacteria 794
112 Ga0070684_101117600 3300005535 Bacteria 741
113 Ga0070697_100146768 3300005536 Bacteria 1986
114 Ga0070697_100452499 3300005536 Bacteria 1118
115 Ga0068853_100036829 3300005539 Bacteria 4161
116 Ga0068853_100057809 3300005539 Bacteria 3348
117 Ga0068853_100226503 3300005539 Bacteria 1709
118 Ga0068853_100288142 3300005539 Bacteria 1515
119 Ga0068853_100516874 3300005539 Bacteria 1128
120 Ga0070672_100000341 3300005543 Bacteria 26875
121 Ga0070672_100034018 3300005543 Bacteria 3864
122 Ga0070672_100127095 3300005543 Bacteria 2092
123 Ga0070686_100455725 3300005544 Bacteria 984
124 Ga0070695_100048298 3300005545 Bacteria 2721
125 Ga0070695_100193914 3300005545 Bacteria 1448
126 Ga0070693_100118605 3300005547 Bacteria 1638
127 Ga0070693_101065603 3300005547 Bacteria 615
128 Ga0070665_100003779 3300005548 Bacteria 16019
129 Ga0070665_100049284 3300005548 Bacteria 4227
130 Ga0070665_101342812 3300005548 Unclassified 724
131 Ga0070704_100321260 3300005549 Bacteria 1297
132 Ga0068855_100019784 3300005563 Bacteria 8086
133 Ga0068855_100026582 3300005563 Bacteria 6924
134 Ga0068855_100077995 3300005563 Bacteria 3843
135 Ga0070664_100106720 3300005564 Bacteria 2440
136 Ga0070664_100118842 3300005564 Bacteria 2313
137 Ga0070664_100434833 3300005564 Bacteria 1203
138 Ga0070664_101295591 3300005564 Bacteria 688
139 Ga0068857_100017699 3300005577 Bacteria 6249
140 Ga0068857_100038214 3300005577 Bacteria 4251
141 Ga0068854_100022455 3300005578 Bacteria 4299
142 Ga0068856_100416710 3300005614 Bacteria 1363
143 Ga0068856_100451753 3300005614 Bacteria 1306
144 Ga0070702_100685163 3300005615 Bacteria 779
145 Ga0068852_100003856 3300005616 Bacteria 10531
146 Ga0068852_100070864 3300005616 Bacteria 3059
147 Ga0068852_100248615 3300005616 Bacteria 1703
148 Ga0068859_100010811 3300005617 Bacteria 9188
149 Ga0068859_100436541 3300005617 Bacteria 1405
150 Ga0068859_101178412 3300005617 Bacteria 843
151 Ga0068864_100000729 3300005618 Bacteria 27510
152 Ga0068866_10117870 3300005718 Bacteria 1491
153 Ga0068866_10332626 3300005718 Bacteria 959
154 Ga0068861_100174472 3300005719 Bacteria 1784
155 Ga0068861_100398360 3300005719 Bacteria 1221
156 Ga0068851_10027972 3300005834 Bacteria 2783
157 Ga0068851_10345150 3300005834 Bacteria 865
158 Ga0068851_10807890 3300005834 Bacteria 583
159 Ga0068870_10435481 3300005840 Unclassified 861
160 Ga0068863_100039526 3300005841 Bacteria 4488
161 Ga0068863_100584527 3300005841 Bacteria 1104
162 Ga0068863_101600009 3300005841 Unclassified 661
163 Ga0068858_100003387 3300005842 Bacteria 15866
164 Ga0068858_100048146 3300005842 Bacteria 3951
165 Ga0068858_100145275 3300005842 Bacteria 2227
166 Ga0068860_100000073 3300005843 Bacteria 173235
167 Ga0068860_100011771 3300005843 Bacteria 8622
168 Ga0068860_100101780 3300005843 Bacteria 2741
169 Ga0068860_100275376 3300005843 Bacteria 1643
170 Ga0068862_100043468 3300005844 Bacteria 3831
171 Ga0068862_100058378 3300005844 Bacteria 3309
172 Ga0068862_100121925 3300005844 Bacteria 2298
173 Ga0070717_10044417 3300006028 Bacteria 3628
174 Ga0070717_10057601 3300006028 Bacteria 3213
175 Ga0070715_10337141 3300006163 Bacteria 819
176 Ga0070712_100001126 3300006175 Bacteria 16084
177 Ga0070712_100356152 3300006175 Unclassified 1199
178 Ga0097621_100054948 3300006237 Bacteria 3250
179 Ga0097621_100087568 3300006237 Bacteria 2601
180 Ga0097621_100312221 3300006237 Bacteria 1391
181 Ga0075370_10344114 3300006353 Bacteria 890
182 Ga0075370_11025667 3300006353 Bacteria 506
183 Ga0068871_100105626 3300006358 Bacteria 2363
184 Ga0068871_100129723 3300006358 Bacteria 2137
185 Ga0068871_100295242 3300006358 Bacteria 1421
186 Ga0075428_100387472 3300006844 Bacteria 1498
187 Ga0075428_100447466 3300006844 Bacteria 1384
188 Ga0075431_100139217 3300006847 Bacteria 2502
189 Ga0075433_10005238 3300006852 Bacteria 10166
190 Ga0075433_11803631 3300006852 Bacteria 526
191 Ga0075434_100835701 3300006871 Bacteria 937
192 Ga0075434_101268840 3300006871 Bacteria 748
193 Ga0075434_101834640 3300006871 Unclassified 613
194 Ga0075429_100843326 3300006880 Bacteria 802
195 Ga0068865_100000731 3300006881 Bacteria 18482
196 Ga0068865_100061312 3300006881 Bacteria 2636
197 Ga0068865_100368050 3300006881 Bacteria 1169
198 Ga0097620_100010811 3300006931 Bacteria 9188
199 Ga0097620_100436572 3300006931 Bacteria 1405
200 Ga0097620_101178470 3300006931 Bacteria 843
201 Ga0075435_100184579 3300007076 Bacteria 1764
202 Ga0105244_10073667 3300009036 Bacteria 1700
203 Ga0105240_10632161 3300009093 Bacteria 1175
204 Ga0105240_10719171 3300009093 Bacteria 1088
205 Ga0105240_12267000 3300009093 Bacteria 563
206 Ga0105245_10000928 3300009098 Bacteria 26607
207 Ga0105245_10035092 3300009098 Bacteria 4450
208 Ga0105245_10239844 3300009098 Unclassified 1757
209 Ga0105245_10388380 3300009098 Bacteria 1392
210 Ga0105245_10854070 3300009098 Bacteria 950
211 Ga0105247_11246308 3300009101 Bacteria 594
212 Ga0114129_10199767 3300009147 Unclassified 2709
213 Ga0114129_10436518 3300009147 Bacteria 1720
214 Ga0114129_10519120 3300009147 Bacteria 1553
215 Ga0105243_10009114 3300009148 Bacteria 7578
216 Ga0105243_10053600 3300009148 Bacteria 3200
217 Ga0105243_10270548 3300009148 Bacteria 1525
218 Ga0105243_10735479 3300009148 Bacteria 966
219 Ga0105243_10878153 3300009148 Bacteria 890
220 Ga0105241_10034740 3300009174 Bacteria 3790
221 Ga0105241_10164755 3300009174 Bacteria 1825
222 Ga0105242_10008972 3300009176 Bacteria 7679
223 Ga0105242_10454952 3300009176 Bacteria 1208
224 Ga0105242_12239573 3300009176 Bacteria 592
225 Ga0105242_12281210 3300009176 Unclassified 587
226 Ga0105248_10105566 3300009177 Bacteria 3176
227 Ga0105248_11324275 3300009177 Bacteria 815
228 Ga0105248_12355629 3300009177 Unclassified 606
229 Ga0105237_10628491 3300009545 Bacteria 1081
230 Ga0105238_10065561 3300009551 Bacteria 3633
231 Ga0105238_10268511 3300009551 Bacteria 1686
232 Ga0105238_11721637 3300009551 Unclassified 658
233 Ga0105249_10077212 3300009553 Bacteria 3088
234 Ga0105249_10176304 3300009553 Bacteria 2076
235 Ga0105249_10687333 3300009553 Bacteria 1083
236 Ga0105239_10312035 3300010375 Bacteria 1773
237 Ga0105239_10384537 3300010375 Bacteria 1587
238 Ga0105239_11069420 3300010375 Bacteria 928
239 Ga0105239_11715231 3300010375 Unclassified 727
240 Ga0105246_10002010 3300011119 Bacteria 12283
241 Ga0105246_10130005 3300011119 Unclassified 1879
242 Ga0105246_11021988 3300011119 Bacteria 750
243 Ga0157373_10025642 3300013100 Bacteria 4262
244 Ga0157373_10589135 3300013100 Bacteria 809
245 Ga0157371_10004597 3300013102 Bacteria 11982
246 Ga0157371_10269195 3300013102 Bacteria 1229
247 Ga0157371_10474413 3300013102 Bacteria 922
248 Ga0157369_10060288 3300013105 Bacteria 4092
249 Ga0157369_10575969 3300013105 Bacteria 1163
250 Ga0157369_10826121 3300013105 Unclassified 951
251 Ga0157374_10169937 3300013296 Unclassified 2126
252 Ga0157378_10010504 3300013297 Bacteria 8090
253 Ga0157378_10555184 3300013297 Bacteria 1154
254 Ga0163162_10025879 3300013306 Bacteria 5799
255 Ga0163162_10052932 3300013306 Bacteria 4079
256 Ga0163162_10101175 3300013306 Bacteria 2974
257 Ga0163162_12805348 3300013306 Unclassified 561
258 Ga0157372_10055134 3300013307 Bacteria 4438
259 Ga0157372_10638746 3300013307 Unclassified 1240
260 Ga0157375_10161563 3300013308 Bacteria 2382
261 Ga0157375_10327218 3300013308 Bacteria 1697
262 Ga0157375_10663244 3300013308 Bacteria 1199
263 Ga0157380_10766305 3300014326 Bacteria 978
264 Ga0157380_11346133 3300014326 Bacteria 763
265 Ga0182008_10015877 3300014497 Bacteria 3921
266 Ga0182008_10251689 3300014497 Bacteria 911
267 Ga0157377_10021555 3300014745 Bacteria 3391
268 Ga0157377_10393499 3300014745 Bacteria 942
269 Ga0157379_10496639 3300014968 Bacteria 1131
270 Ga0157379_11025678 3300014968 Bacteria 787
271 Ga0157376_13110508 3300014969 Unclassified 503
272 Ga0182006_1059102 3300015261 Unclassified 1452
273 Ga0182007_10076963 3300015262 Bacteria 1094
274 Ga0163161_10520346 3300017792 Bacteria 971
275 Ga0163161_10621001 3300017792 Bacteria 893
276 Ga0206356_10915110 3300020070 Bacteria 3059
277 Ga0206356_11277488 3300020070 Bacteria 693
278 Ga0206354_10544670 3300020081 Bacteria 2524
279 Ga0206354_11516569 3300020081 Bacteria 603
280 Ga0206353_10360986 3300020082 Bacteria 1809
281 Ga0213875_10009862 3300021388 Bacteria 4814
282 Ga0213871_10013977 3300021441 Bacteria 1896
283 Ga0207697_10000249 3300025315 Bacteria 29649
284 Ga0207697_10052553 3300025315 Bacteria 1686
285 Ga0207697_10136034 3300025315 Bacteria 1064
286 Ga0207656_10099503 3300025321 Bacteria 1331
287 Ga0207653_10228442 3300025885 Bacteria 708
288 Ga0207642_10123861 3300025899 Bacteria 1338
289 Ga0207688_10015087 3300025901 Bacteria 4191
290 Ga0207688_10062753 3300025901 Bacteria 2095
291 Ga0207688_10095338 3300025901 Bacteria 1713
292 Ga0207688_10170179 3300025901 Bacteria 1295
293 Ga0207680_10027828 3300025903 Bacteria 3155
294 Ga0207680_10150331 3300025903 Bacteria 1552
295 Ga0207680_10293803 3300025903 Bacteria 1131
296 Ga0207647_10000365 3300025904 Bacteria 36940
297 Ga0207647_10000661 3300025904 Bacteria 26938
298 Ga0207699_10089348 3300025906 Bacteria 1931
299 Ga0207699_10383536 3300025906 Bacteria 998
300 Ga0207645_10018458 3300025907 Bacteria 4588
301 Ga0207645_10079277 3300025907 Bacteria 2105
302 Ga0207645_10101209 3300025907 Bacteria 1859
303 Ga0207645_10226807 3300025907 Bacteria 1232
304 Ga0207645_10418735 3300025907 Bacteria 902
305 Ga0207643_10651143 3300025908 Bacteria 680
306 Ga0207705_10232580 3300025909 Bacteria 1402
307 Ga0207705_10293727 3300025909 Bacteria 1245
308 Ga0207707_10023183 3300025912 Bacteria 5431
309 Ga0207695_10150458 3300025913 Bacteria 2267
310 Ga0207695_10858370 3300025913 Bacteria 788
311 Ga0207695_11081629 3300025913 Bacteria 682
312 Ga0207693_10001583 3300025915 Bacteria 20132
313 Ga0207660_11076420 3300025917 Bacteria 655
314 Ga0207662_10317827 3300025918 Bacteria 1039
315 Ga0207657_10003268 3300025919 Bacteria 17348
316 Ga0207657_10010808 3300025919 Bacteria 9083
317 Ga0207657_10237672 3300025919 Bacteria 1455
318 Ga0207657_10323357 3300025919 Bacteria 1219
319 Ga0207657_10544633 3300025919 Unclassified 907
320 Ga0207657_10682688 3300025919 Bacteria 798
321 Ga0207657_11406955 3300025919 Bacteria 524
322 Ga0207649_10115483 3300025920 Bacteria 1801
323 Ga0207649_10301354 3300025920 Bacteria 1172
324 Ga0207649_10543256 3300025920 Bacteria 888
325 Ga0207652_10110342 3300025921 Bacteria 2439
326 Ga0207652_10721941 3300025921 Bacteria 888
327 Ga0207652_10887456 3300025921 Bacteria 788
328 Ga0207646_10002409 3300025922 Bacteria 22070
329 Ga0207681_10019777 3300025923 Bacteria 4260
330 Ga0207681_10071487 3300025923 Bacteria 2420
331 Ga0207681_10102621 3300025923 Bacteria 2065
332 Ga0207681_10376187 3300025923 Bacteria 1142
333 Ga0207681_11233613 3300025923 Unclassified 628
334 Ga0207694_10046885 3300025924 Bacteria 3341
335 Ga0207694_10535638 3300025924 Bacteria 982
336 Ga0207694_10910803 3300025924 Bacteria 744
337 Ga0207650_10880139 3300025925 Bacteria 760
338 Ga0207650_11378059 3300025925 Bacteria 600
339 Ga0207659_10107584 3300025926 Bacteria 2114
340 Ga0207659_10595110 3300025926 Bacteria 942
341 Ga0207659_10616892 3300025926 Bacteria 925
342 Ga0207659_10967294 3300025926 Bacteria 732
343 Ga0207687_10058863 3300025927 Bacteria 2704
344 Ga0207687_10156949 3300025927 Bacteria 1742
345 Ga0207687_10181819 3300025927 Bacteria 1630
346 Ga0207687_10755463 3300025927 Bacteria 828
347 Ga0207687_11493179 3300025927 Bacteria 581
348 Ga0207664_10010350 3300025929 Bacteria 6586
349 Ga0207664_10015538 3300025929 Bacteria 5529
350 Ga0207664_10192821 3300025929 Bacteria 1755
351 Ga0207664_11242689 3300025929 Unclassified 663
352 Ga0207664_11372606 3300025929 Unclassified 627
353 Ga0207644_10008001 3300025931 Bacteria 6915
354 Ga0207690_10003218 3300025932 Bacteria 9799
355 Ga0207690_10029898 3300025932 Bacteria 3468
356 Ga0207690_10092005 3300025932 Bacteria 2145
357 Ga0207690_10773555 3300025932 Bacteria 792
358 Ga0207690_10920551 3300025932 Unclassified 726
359 Ga0207706_10000661 3300025933 Bacteria 36281
360 Ga0207706_10007863 3300025933 Bacteria 9841
361 Ga0207706_10031528 3300025933 Bacteria 4722
362 Ga0207706_10333675 3300025933 Bacteria 1319
363 Ga0207706_10762020 3300025933 Bacteria 824
364 Ga0207686_10143500 3300025934 Bacteria 1653
365 Ga0207709_10463672 3300025935 Bacteria 982
366 Ga0207709_11349611 3300025935 Bacteria 590
367 Ga0207669_10015926 3300025937 Bacteria 3805
368 Ga0207669_10255049 3300025937 Bacteria 1308
369 Ga0207669_10594340 3300025937 Bacteria 899
370 Ga0207704_10006622 3300025938 Bacteria 5421
371 Ga0207704_10050728 3300025938 Bacteria 2504
372 Ga0207704_10622343 3300025938 Bacteria 886
373 Ga0207691_10001406 3300025940 Bacteria 24040
374 Ga0207691_10010260 3300025940 Bacteria 8987
375 Ga0207691_10039133 3300025940 Bacteria 4388
376 Ga0207711_10140724 3300025941 Bacteria 2171
377 Ga0207711_10575087 3300025941 Bacteria 1051
378 Ga0207689_10000580 3300025942 Bacteria 34954
379 Ga0207689_10106531 3300025942 Bacteria 2303
380 Ga0207689_10425885 3300025942 Bacteria 1108
381 Ga0207689_11187784 3300025942 Bacteria 642
382 Ga0207689_11672834 3300025942 Unclassified 528
383 Ga0207661_10003070 3300025944 Bacteria 11557
384 Ga0207661_10217676 3300025944 Bacteria 1686
385 Ga0207679_10070490 3300025945 Bacteria 2634
386 Ga0207679_10106248 3300025945 Bacteria 2206
387 Ga0207667_10034122 3300025949 Bacteria 5467
388 Ga0207667_12051705 3300025949 Bacteria 531
389 Ga0207651_10003806 3300025960 Bacteria 7476
390 Ga0207651_10109695 3300025960 Bacteria 2068
391 Ga0207651_11268797 3300025960 Bacteria 662
392 Ga0207712_10000309 3300025961 Bacteria 44746
393 Ga0207712_10069986 3300025961 Bacteria 2519
394 Ga0207668_10000129 3300025972 Bacteria 53619
395 Ga0207668_10051448 3300025972 Bacteria 2845
396 Ga0207668_10120862 3300025972 Bacteria 1983
397 Ga0207668_11038717 3300025972 Bacteria 733
398 Ga0207640_10030058 3300025981 Bacteria 3342
399 Ga0207640_10151230 3300025981 Bacteria 1705
400 Ga0207640_11274456 3300025981 Bacteria 655
401 Ga0207658_10000025 3300025986 Bacteria 182470
402 Ga0207658_10027796 3300025986 Bacteria 3978
403 Ga0207658_10115900 3300025986 Bacteria 2127
404 Ga0207658_10394814 3300025986 Bacteria 1214
405 Ga0207677_10140519 3300026023 Bacteria 1848
406 Ga0207677_10340449 3300026023 Bacteria 1253
407 Ga0207677_10444803 3300026023 Bacteria 1109
408 Ga0207703_10015871 3300026035 Bacteria 5876
409 Ga0207703_10122365 3300026035 Bacteria 2235
410 Ga0207703_10297203 3300026035 Bacteria 1471
411 Ga0207639_10015409 3300026041 Bacteria 5395
412 Ga0207639_10062382 3300026041 Bacteria 2882
413 Ga0207639_10064242 3300026041 Bacteria 2845
414 Ga0207639_10909426 3300026041 Bacteria 823
415 Ga0207678_10343464 3300026067 Bacteria 1286
416 Ga0207678_10480925 3300026067 Bacteria 1081
417 Ga0207708_10149010 3300026075 Unclassified 1840
418 Ga0207702_10475876 3300026078 Bacteria 1215
419 Ga0207702_11626530 3300026078 Bacteria 639
420 Ga0207641_10013253 3300026088 Bacteria 6761
421 Ga0207641_10043167 3300026088 Bacteria 3785
422 Ga0207641_10096529 3300026088 Bacteria 2596
423 Ga0207641_10132190 3300026088 Bacteria 2242
424 Ga0207648_10000800 3300026089 Bacteria 35460
425 Ga0207648_10000838 3300026089 Bacteria 34648
426 Ga0207648_11831806 3300026089 Bacteria 568
427 Ga0207676_10000550 3300026095 Bacteria 31298
428 Ga0207674_10000283 3300026116 Bacteria 64153
429 Ga0207674_10060615 3300026116 Bacteria 3825
430 Ga0207675_100093679 3300026118 Bacteria 2826
431 Ga0207675_100127299 3300026118 Bacteria 2413
432 Ga0207675_100532723 3300026118 Bacteria 1172
433 Ga0207675_100995368 3300026118 Unclassified 857
434 Ga0207683_10071636 3300026121 Bacteria 3064
435 Ga0207698_10004067 3300026142 Bacteria 8878
436 Ga0207698_10021348 3300026142 Bacteria 4476
437 Ga0207698_10146872 3300026142 Bacteria 2040
438 Ga0207698_10340076 3300026142 Bacteria 1413
439 Ga0207698_10386757 3300026142 Bacteria 1333
440 Ga0209969_1019286 3300027360 Bacteria 1011
441 Ga0209970_1001822 3300027614 Bacteria 3690
442 Ga0209974_10001776 3300027876 Bacteria 7869
443 Ga0207428_10179504 3300027907 Bacteria 1600
444 Ga0207428_10368892 3300027907 Bacteria 1054
445 Ga0268266_10003459 3300028379 Bacteria 15752
446 Ga0268266_10051807 3300028379 Bacteria 3524
447 Ga0268265_10003811 3300028380 Bacteria 10685
448 Ga0268265_10018467 3300028380 Bacteria 4833
449 Ga0268265_10071307 3300028380 Bacteria 2705
450 Ga0268265_10179817 3300028380 Bacteria 1816
451 Ga0268264_10000120 3300028381 Bacteria 191138
452 Ga0268264_10020592 3300028381 Bacteria 5388
453 Ga0268264_10026302 3300028381 Bacteria 4753
454 Ga0268264_10093242 3300028381 Bacteria 2601
455 Ga0265337_1152859 3300028556 Bacteria 625
456 Ga0265340_10472933 3300031247 Bacteria 552
457 Ga0307408_100864527 3300031548 Bacteria 825
458 Ga0265342_10610604 3300031712 Bacteria 550
459 Ga0307405_10191053 3300031731 Bacteria 1479
460 Ga0307405_10676798 3300031731 Bacteria 852
461 Ga0307405_11114732 3300031731 Bacteria 679
462 Ga0307413_10049712 3300031824 Bacteria 2514
463 Ga0307410_10435317 3300031852 Bacteria 1067
464 Ga0307406_10024672 3300031901 Bacteria 3594
465 Ga0307406_10436555 3300031901 Bacteria 1047
466 Ga0307407_10149883 3300031903 Bacteria 1514
467 Ga0307407_10679616 3300031903 Bacteria 774
468 Ga0307407_11632507 3300031903 Bacteria 512
469 Ga0307412_10079259 3300031911 Bacteria 2265
470 Ga0307412_10186826 3300031911 Bacteria 1564
471 Ga0307412_11204536 3300031911 Bacteria 678
472 Ga0307409_100131426 3300031995 Bacteria 2140
473 Ga0307409_100481471 3300031995 Bacteria 1204
474 Ga0307416_100306016 3300032002 Bacteria 1583
475 Ga0307416_100666760 3300032002 Bacteria 1126
476 Ga0307416_102757458 3300032002 Bacteria 587
477 Ga0307414_10444111 3300032004 Bacteria 1136
478 Ga0307414_11454302 3300032004 Bacteria 637
479 Ga0307411_10231099 3300032005 Bacteria 1441
480 Ga0307411_10346568 3300032005 Bacteria 1209
481 Ga0307415_100191646 3300032126 Bacteria 1614
482 Ga0307415_100658903 3300032126 Bacteria 939
483 Ga0373925_0960032 3300037068 Bacteria 704
484 Ga0395899_0057408 3300037312 Unclassified 2873
485 Ga0395899_0072640 3300037312 Bacteria 2517
486 Ga0395899_0105238 3300037312 Bacteria 2033
487 Ga0395899_0419320 3300037312 Bacteria 882
488 Ga0395900_0017274 3300037418 Bacteria 7363
489 Ga0395900_0032801 3300037418 Bacteria 5342
490 Ga0395900_0061180 3300037418 Bacteria 3872
491 Ga0395900_0061807 3300037418 Bacteria 3850
492 Ga0395900_0557743 3300037418 Bacteria 1089
493 Ga0395900_0563099 3300037418 Archaea 1083
494 Ga0395900_0655911 3300037418 Bacteria 986
495 Ga0395900_0797652 3300037418 Bacteria 872
496 Ga0395900_1777895 3300037418 Bacteria 527
497 Ga0395900_1851742 3300037418 Bacteria 514
498 Ga0395898_0008340 3300037466 Bacteria 10953
499 Ga0395898_0050073 3300037466 Bacteria 4089
500 Ga0395898_0073858 3300037466 Bacteria 3294
501 Ga0395898_0247424 3300037466 Bacteria 1700
502 Ga0395898_0775269 3300037466 Bacteria 900
503 Ga0395898_0894688 3300037466 Bacteria 826
504 Ga0395905_0002564 3300037471 Bacteria 20014
505 Ga0395905_0204711 3300037471 Bacteria 1850
506 Ga0395905_0285897 3300037471 Bacteria 1536
507 Ga0395905_0500302 3300037471 Bacteria 1115
508 Ga0395905_0506478 3300037471 Bacteria 1107
509 Ga0395905_0530776 3300037471 Unclassified 1077
510 Ga0395905_0543876 3300037471 Bacteria 1062
511 Ga0395905_0691299 3300037471 Unclassified 922
512 Ga0395905_1063709 3300037471 Bacteria 712
513 Ga0395905_1567583 3300037471 Bacteria 563
514 Ga0395901_0014921 3300038443 Bacteria 7894
515 Ga0395901_0026915 3300038443 Bacteria 5904
516 Ga0395901_0064408 3300038443 Bacteria 3816
517 Ga0395901_0598106 3300038443 Bacteria 1112
518 Ga0395901_0643196 3300038443 Bacteria 1065
519 Ga0395901_0713800 3300038443 Bacteria 999
520 Ga0395901_0877667 3300038443 Bacteria 880
521 Ga0395901_1036756 3300038443 Unclassified 794
522 Ga0395901_1095072 3300038443 Bacteria 767
523 Ga0400483_006218 3300039062 Unclassified 2641
524 Ga0436360_0266890 3300039438 Bacteria 1896
525 Ga0451853_3191148 3300041512 Bacteria 701
526 Ga0439432_081733 3300042006 Bacteria 978
527 Ga0450898_048810 3300042134 Bacteria 814
528 Ga0466969_0532930 3300044656 Bacteria 537
529 Ga0466972_0022006 3300044658 Bacteria 3175
530 Ga0466972_0114906 3300044658 Bacteria 1271
531 Ga0466966_0007472 3300044684 Bacteria 7244
532 Ga0466966_0010374 3300044684 Bacteria 6185
533 Ga0466966_0120609 3300044684 Unclassified 1611
534 Ga0466966_0300450 3300044684 Unclassified 965
535 Ga0466966_0390070 3300044684 Bacteria 837
536 Ga0466961_0024552 3300044693 Bacteria 3878
537 Ga0466961_0178272 3300044693 Bacteria 1320
538 Ga0466961_0481805 3300044693 Bacteria 750
539 Ga0466963_0021993 3300044694 Bacteria 4033
540 Ga0466963_0038233 3300044694 Bacteria 3137
541 Ga0466963_0222096 3300044694 Bacteria 1323
542 Ga0466963_0393684 3300044694 Unclassified 977
543 Ga0466963_0950825 3300044694 Bacteria 605
544 Ga0466963_1053697 3300044694 Bacteria 572
545 Ga0466964_0015373 3300044706 Bacteria 2912
546 Ga0466964_0119979 3300044706 Bacteria 1184
547 Ga0466964_0125764 3300044706 Bacteria 1161
548 Ga0466968_0383495 3300044735 Unclassified 687
549 Ga0466970_0036151 3300044765 Bacteria 2616
550 Ga0466957_0005536 3300044842 Bacteria 7092
551 Ga0466957_0015995 3300044842 Bacteria 4384
552 Ga0466957_0154363 3300044842 Unclassified 1487
553 Ga0466957_0322949 3300044842 Bacteria 1042
554 Ga0466957_0351360 3300044842 Bacteria 1000
555 Ga0466957_0396990 3300044842 Bacteria 943
556 Ga0466957_1404902 3300044842 Unclassified 508
557 Ga0466959_0002872 3300045049 Bacteria 11108
558 Ga0466959_0295208 3300045049 Bacteria 1110
559 Ga0466958_0002810 3300045836 Bacteria 8861
560 Ga0466958_0015426 3300045836 Bacteria 4379
561 Ga0466958_0084093 3300045836 Archaea 1962
562 Ga0466958_0582619 3300045836 Bacteria 727
563 Ga0466967_0033184 3300045976 Bacteria 4368
564 Ga0466967_0043227 3300045976 Bacteria 3900
565 Ga0466967_0070326 3300045976 Bacteria 3131
566 Ga0466967_0168273 3300045976 Bacteria 2060
567 Ga0466967_0861404 3300045976 Bacteria 900
568 Ga0466967_1219506 3300045976 Bacteria 749
569 Ga0466967_1679624 3300045976 Bacteria 632
570 Ga0466967_1980144 3300045976 Bacteria 579
571 Ga0495629_0108676 3300046459 Bacteria 1934
572 Ga0495664_0055279 3300046477 Bacteria 2362
573 Ga0495664_0157790 3300046477 Bacteria 1376
574 Ga0495584_0109593 3300046491 Bacteria 1397
575 Ga0495606_0233761 3300046507 Bacteria 1029
576 Ga0495643_0105832 3300046522 Bacteria 1436
577 Ga0495642_0068255 3300046528 Bacteria 1484
578 Ga0495652_0381961 3300046529 Bacteria 1002
579 Ga0495667_0118225 3300046559 Bacteria 1712
580 Ga0495656_0122064 3300046615 Unclassified 1231
581 Ga0495658_0260547 3300046683 Bacteria 1092
582 Ga0495677_0382059 3300047445 Unclassified 557
583 Ga0496100_0117343 3300048903 Bacteria 1858
584 Ga0496101_0203574 3300048904 Unclassified 1531
585 Ga0496101_0869474 3300048904 Bacteria 710
586 Ga0496102_0424574 3300048905 Unclassified 1249
587 Ga0496102_1536776 3300048905 Bacteria 584
588 Ga0496103_0586124 3300048906 Bacteria 711
589 Ga0496103_1038728 3300048906 Bacteria 509
590 Ga0496108_0351391 3300048911 Unclassified 1286
591 Ga0496108_1669793 3300048911 Bacteria 525
592 Ga0496109_0037238 3300048912 Unclassified 4395
593 Ga0496109_0322539 3300048912 Bacteria 1458
594 Ga0496109_0358201 3300048912 Bacteria 1378
595 Ga0496110_0084674 3300048913 Bacteria 2830
596 Ga0496110_0203899 3300048913 Bacteria 1797
597 Ga0496111_0045830 3300048914 Unclassified 3147
598 Ga0496111_0499120 3300048914 Bacteria 896
599 Ga0496111_0505537 3300048914 Bacteria 889
600 Ga0496112_0544977 3300048915 Bacteria 1094
601 Ga0496112_1423555 3300048915 Unclassified 608
602 Ga0496113_0427509 3300048916 Bacteria 1064
603 Ga0496113_1189417 3300048916 Unclassified 596
604 Ga0501032_0848988 3300049569 Bacteria 576
605 Ga0501047_0445242 3300049581 Bacteria 1125
606 Ga0501067_0039080 3300049583 Bacteria 2634
607 Ga0501067_0106841 3300049583 Bacteria 1555
608 Ga0501068_0185291 3300049584 Bacteria 1317
609 Ga0501068_1107124 3300049584 Bacteria 524
610 Ga0501069_0025906 3300049585 Bacteria 3209
611 Ga0501070_0065554 3300049586 Bacteria 3007
612 Ga0501072_0012351 3300049588 Bacteria 6527
613 Ga0501073_0102024 3300049589 Bacteria 1992
614 Ga0501076_0760258 3300049592 Bacteria 800
615 Ga0501079_0055926 3300049741 Bacteria 3045
616 Ga0501080_0173487 3300049742 Bacteria 1987
617 Ga0501083_0002950 3300049744 Bacteria 11787
618 nmdc:mga0yw44_800978_c1 3300050492 Bacteria 640
619 nmdc:mga07m45_334558_c1 3300050496 Bacteria 880
620 nmdc:mga05p37_40752_c1 3300050507 Bacteria 5703
621 nmdc:mga05p37_579219_c1 3300050507 Bacteria 1271
622 nmdc:mga06r32_412823_c1 3300050510 Unclassified 1331
623 nmdc:mga08y16_108611_c1 3300050511 Bacteria 2888
624 nmdc:mga0n895_1117936_c1 3300050512 Bacteria 765
625 nmdc:mga0n895_1202227_c1 3300050512 Bacteria 732
626 nmdc:mga0n895_1612762_c1 3300050512 Unclassified 613
627 nmdc:mga0rr50_855035_c1 3300050513 Bacteria 776
628 nmdc:mga0a205_1559856_c1 3300050515 Bacteria 509
629 nmdc:mga0a205_5110_c1 3300050515 Bacteria 11802
630 Ga0495601_0303718 3300053077 Bacteria 1039
631 Ga0495612_0051155 3300053078 Bacteria 1697
632 Ga0495619_0982704 3300053085 Unclassified 565
633 Ga0500568_0021065 3300053139 Bacteria 2811
634 Ga0500604_0000006 3300053151 Bacteria 118567
635 Ga0500616_0000258 3300053153 Bacteria 81750
636 Ga0500587_007158 3300053739 Bacteria 1459
637 Ga0501084_0814671 3300054114 Bacteria 786
638 Ga0466962_0066052 3300061719 Bacteria 1727
639 Ga0466962_0175734 3300061719 Bacteria 1043
640 Ga0466962_0375840 3300061719 Unclassified 709
641 Ga0068863_100145658
642 JGI24736J21556_1007326
643 JGI24740J21852_10018972
644 JGI24739J22299_10004656
645 JGI24737J22298_10000387
646 JGI24737J22298_10016831
647 JGI24737J22298_10242756
648 JGI24735J21928_10170622
649 JGI24738J21930_10010451
650 Ga0065715_10035206
651 Ga0070658_10046454
652 Ga0070658_10115415
653 Ga0070658_10926345
654 Ga0070676_10020603
655 Ga0070676_10215639
656 Ga0070683_100013151
657 Ga0070683_100055119
658 Ga0070683_100084522
659 Ga0070683_100098698
660 Ga0070683_100300372
661 Ga0070690_100024405
662 Ga0070690_100979667
663 Ga0070670_100006442
664 Ga0070670_101737840
665 Ga0070677_10129976
666 Ga0068869_100007282
667 Ga0068869_100061478
668 Ga0068869_100386913
669 Ga0070666_10068945
670 Ga0070666_10371718
671 Ga0070666_11358491
672 Ga0070680_100313700
673 Ga0070680_100350039
674 Ga0068868_100000214
675 Ga0068868_100202105
676 Ga0068868_100307071
677 Ga0070660_100002970
678 Ga0070660_100008192
679 Ga0070660_100084881
680 Ga0070660_100224875
681 Ga0070660_100836226
682 Ga0070689_100936182
683 Ga0070687_100828001
684 Ga0070692_10013017
685 Ga0070668_100050254
686 Ga0070668_100268827
687 Ga0070668_100410701
688 Ga0070668_101011663
689 Ga0070669_100001233
690 Ga0070669_100026170
691 Ga0070669_100246378
692 Ga0070669_100518284
693 Ga0070675_100084250
694 Ga0070675_100091666
695 Ga0070675_100137199
696 Ga0070675_100532331
697 Ga0070675_100677703
698 Ga0070671_100002731
699 Ga0070671_102053134
700 Ga0070674_100002539
701 Ga0070674_100008308
702 Ga0070674_100438201
703 Ga0070673_100000537
704 Ga0070673_100008673
705 Ga0070673_100127510
706 Ga0070659_100001927
707 Ga0070659_100003141
708 Ga0070659_100084258
709 Ga0070659_100279722
710 Ga0070659_101287455
711 Ga0070667_100000045
712 Ga0070667_100322434
713 Ga0070667_101733502
714 Ga0070703_10404471
715 Ga0070709_11043475
716 Ga0070714_100015057
717 Ga0070714_100033835
718 Ga0070714_100258500
719 Ga0070714_100428525
720 Ga0070714_102178025
721 Ga0070714_102458320
722 Ga0070701_11374033
723 Ga0070711_101208738
724 Ga0070700_100275364
725 Ga0070700_101141061
726 Ga0070694_100006839
727 Ga0070694_100291480
728 Ga0070694_101437594
729 Ga0070663_100795029
730 Ga0070678_100052668
731 Ga0070662_100000242
732 Ga0070662_100005912
733 Ga0070662_100659530
734 Ga0070662_100805337
735 Ga0070662_101026937
736 Ga0070662_101065376
737 Ga0070681_10375747
738 Ga0070681_11172010
739 Ga0068867_100001284
740 Ga0068867_100001964
741 Ga0070685_10151464
742 Ga0070707_100009588
743 Ga0070707_100434116
744 Ga0070698_101058532
745 Ga0070699_101075876
746 Ga0070679_100063689
747 Ga0070679_100105058
748 Ga0070684_100026244
749 Ga0070684_100087207
750 Ga0070684_100090236
751 Ga0070684_100977522
752 Ga0070684_101117600
753 Ga0070697_100146768
754 Ga0070697_100452499
755 Ga0068853_100036829
756 Ga0068853_100057809
757 Ga0068853_100226503
758 Ga0068853_100288142
759 Ga0068853_100516874
760 Ga0070672_100000341
761 Ga0070672_100034018
762 Ga0070672_100127095
763 Ga0070686_100455725
764 Ga0070695_100048298
765 Ga0070695_100193914
766 Ga0070693_100118605
767 Ga0070693_101065603
768 Ga0070665_100003779
769 Ga0070665_100049284
770 Ga0070665_101342812
771 Ga0070704_100321260
772 Ga0068855_100019784
773 Ga0068855_100026582
774 Ga0068855_100077995
775 Ga0070664_100106720
776 Ga0070664_100118842
777 Ga0070664_100434833
778 Ga0070664_101295591
779 Ga0068857_100017699
780 Ga0068857_100038214
781 Ga0068854_100022455
782 Ga0068856_100416710
783 Ga0068856_100451753
784 Ga0070702_100685163
785 Ga0068852_100003856
786 Ga0068852_100070864
787 Ga0068852_100248615
788 Ga0068859_100010811
789 Ga0068859_100436541
790 Ga0068859_101178412
791 Ga0068864_100000729
792 Ga0068866_10117870
793 Ga0068866_10332626
794 Ga0068861_100174472
795 Ga0068861_100398360
796 Ga0068851_10027972
797 Ga0068851_10345150
798 Ga0068851_10807890
799 Ga0068870_10435481
800 Ga0068863_100039526
801 Ga0068863_100584527
802 Ga0068863_101600009
803 Ga0068858_100003387
804 Ga0068858_100048146
805 Ga0068858_100145275
806 Ga0068860_100000073
807 Ga0068860_100011771
808 Ga0068860_100101780
809 Ga0068860_100275376
810 Ga0068862_100043468
811 Ga0068862_100058378
812 Ga0068862_100121925
813 Ga0070717_10044417
814 Ga0070717_10057601
815 Ga0070715_10337141
816 Ga0070712_100001126
817 Ga0070712_100356152
818 Ga0097621_100054948
819 Ga0097621_100087568
820 Ga0097621_100312221
821 Ga0075370_10344114
822 Ga0075370_11025667
823 Ga0068871_100105626
824 Ga0068871_100129723
825 Ga0068871_100295242
826 Ga0075428_100387472
827 Ga0075428_100447466
828 Ga0075431_100139217
829 Ga0075433_10005238
830 Ga0075433_11803631
831 Ga0075434_100835701
832 Ga0075434_101268840
833 Ga0075434_101834640
834 Ga0075429_100843326
835 Ga0068865_100000731
836 Ga0068865_100061312
837 Ga0068865_100368050
838 Ga0097620_100010811
839 Ga0097620_100436572
840 Ga0097620_101178470
841 Ga0075435_100184579
842 Ga0105244_10073667
843 Ga0105240_10632161
844 Ga0105240_10719171
845 Ga0105240_12267000
846 Ga0105245_10000928
847 Ga0105245_10035092
848 Ga0105245_10239844
849 Ga0105245_10388380
850 Ga0105245_10854070
851 Ga0105247_11246308
852 Ga0114129_10199767
853 Ga0114129_10436518
854 Ga0114129_10519120
855 Ga0105243_10009114
856 Ga0105243_10053600
857 Ga0105243_10270548
858 Ga0105243_10735479
859 Ga0105243_10878153
860 Ga0105241_10034740
861 Ga0105241_10164755
862 Ga0105242_10008972
863 Ga0105242_10454952
864 Ga0105242_12239573
865 Ga0105242_12281210
866 Ga0105248_10105566
867 Ga0105248_11324275
868 Ga0105248_12355629
869 Ga0105237_10628491
870 Ga0105238_10065561
871 Ga0105238_10268511
872 Ga0105238_11721637
873 Ga0105249_10077212
874 Ga0105249_10176304
875 Ga0105249_10687333
876 Ga0105239_10312035
877 Ga0105239_10384537
878 Ga0105239_11069420
879 Ga0105239_11715231
880 Ga0105246_10002010
881 Ga0105246_10130005
882 Ga0105246_11021988
883 Ga0157373_10025642
884 Ga0157373_10589135
885 Ga0157371_10004597
886 Ga0157371_10269195
887 Ga0157371_10474413
888 Ga0157369_10060288
889 Ga0157369_10575969
890 Ga0157369_10826121
891 Ga0157374_10169937
892 Ga0157378_10010504
893 Ga0157378_10555184
894 Ga0163162_10025879
895 Ga0163162_10052932
896 Ga0163162_10101175
897 Ga0163162_12805348
898 Ga0157372_10055134
899 Ga0157372_10638746
900 Ga0157375_10161563
901 Ga0157375_10327218
902 Ga0157375_10663244
903 Ga0157380_10766305
904 Ga0157380_11346133
905 Ga0182008_10015877
906 Ga0182008_10251689
907 Ga0157377_10021555
908 Ga0157377_10393499
909 Ga0157379_10496639
910 Ga0157379_11025678
911 Ga0157376_13110508
912 Ga0182006_1059102
913 Ga0182007_10076963
914 Ga0163161_10520346
915 Ga0163161_10621001
916 Ga0206356_10915110
917 Ga0206356_11277488
918 Ga0206354_10544670
919 Ga0206354_11516569
920 Ga0206353_10360986
921 Ga0213875_10009862
922 Ga0213871_10013977
923 Ga0207697_10000249
924 Ga0207697_10052553
925 Ga0207697_10136034
926 Ga0207656_10099503
927 Ga0207653_10228442
928 Ga0207642_10123861
929 Ga0207688_10015087
930 Ga0207688_10062753
931 Ga0207688_10095338
932 Ga0207688_10170179
933 Ga0207680_10027828
934 Ga0207680_10150331
935 Ga0207680_10293803
936 Ga0207647_10000365
937 Ga0207647_10000661
938 Ga0207699_10089348
939 Ga0207699_10383536
940 Ga0207645_10018458
941 Ga0207645_10079277
942 Ga0207645_10101209
943 Ga0207645_10226807
944 Ga0207645_10418735
945 Ga0207643_10651143
946 Ga0207705_10232580
947 Ga0207705_10293727
948 Ga0207707_10023183
949 Ga0207695_10150458
950 Ga0207695_10858370
951 Ga0207695_11081629
952 Ga0207693_10001583
953 Ga0207660_11076420
954 Ga0207662_10317827
955 Ga0207657_10003268
956 Ga0207657_10010808
957 Ga0207657_10237672
958 Ga0207657_10323357
959 Ga0207657_10544633
960 Ga0207657_10682688
961 Ga0207657_11406955
962 Ga0207649_10115483
963 Ga0207649_10301354
964 Ga0207649_10543256
965 Ga0207652_10110342
966 Ga0207652_10721941
967 Ga0207652_10887456
968 Ga0207646_10002409
969 Ga0207681_10019777
970 Ga0207681_10071487
971 Ga0207681_10102621
972 Ga0207681_10376187
973 Ga0207681_11233613
974 Ga0207694_10046885
975 Ga0207694_10535638
976 Ga0207694_10910803
977 Ga0207650_10880139
978 Ga0207650_11378059
979 Ga0207659_10107584
980 Ga0207659_10595110
981 Ga0207659_10616892
982 Ga0207659_10967294
983 Ga0207687_10058863
984 Ga0207687_10156949
985 Ga0207687_10181819
986 Ga0207687_10755463
987 Ga0207687_11493179
988 Ga0207664_10010350
989 Ga0207664_10015538
990 Ga0207664_10192821
991 Ga0207664_11242689
992 Ga0207664_11372606
993 Ga0207644_10008001
994 Ga0207690_10003218
995 Ga0207690_10029898
996 Ga0207690_10092005
997 Ga0207690_10773555
998 Ga0207690_10920551
999 Ga0207706_10000661
1000 Ga0207706_10007863
1001 Ga0207706_10031528
1002 Ga0207706_10333675
1003 Ga0207706_10762020
1004 Ga0207686_10143500
1005 Ga0207709_10463672
1006 Ga0207709_11349611
1007 Ga0207669_10015926
1008 Ga0207669_10255049
1009 Ga0207669_10594340
1010 Ga0207704_10006622
1011 Ga0207704_10050728
1012 Ga0207704_10622343
1013 Ga0207691_10001406
1014 Ga0207691_10010260
1015 Ga0207691_10039133
1016 Ga0207711_10140724
1017 Ga0207711_10575087
1018 Ga0207689_10000580
1019 Ga0207689_10106531
1020 Ga0207689_10425885
1021 Ga0207689_11187784
1022 Ga0207689_11672834
1023 Ga0207661_10003070
1024 Ga0207661_10217676
1025 Ga0207679_10070490
1026 Ga0207679_10106248
1027 Ga0207667_10034122
1028 Ga0207667_12051705
1029 Ga0207651_10003806
1030 Ga0207651_10109695
1031 Ga0207651_11268797
1032 Ga0207712_10000309
1033 Ga0207712_10069986
1034 Ga0207668_10000129
1035 Ga0207668_10051448
1036 Ga0207668_10120862
1037 Ga0207668_11038717
1038 Ga0207640_10030058
1039 Ga0207640_10151230
1040 Ga0207640_11274456
1041 Ga0207658_10000025
1042 Ga0207658_10027796
1043 Ga0207658_10115900
1044 Ga0207658_10394814
1045 Ga0207677_10140519
1046 Ga0207677_10340449
1047 Ga0207677_10444803
1048 Ga0207703_10015871
1049 Ga0207703_10122365
1050 Ga0207703_10297203
1051 Ga0207639_10015409
1052 Ga0207639_10062382
1053 Ga0207639_10064242
1054 Ga0207639_10909426
1055 Ga0207678_10343464
1056 Ga0207678_10480925
1057 Ga0207708_10149010
1058 Ga0207702_10475876
1059 Ga0207702_11626530
1060 Ga0207641_10013253
1061 Ga0207641_10043167
1062 Ga0207641_10096529
1063 Ga0207641_10132190
1064 Ga0207648_10000800
1065 Ga0207648_10000838
1066 Ga0207648_11831806
1067 Ga0207676_10000550
1068 Ga0207674_10000283
1069 Ga0207674_10060615
1070 Ga0207675_100093679
1071 Ga0207675_100127299
1072 Ga0207675_100532723
1073 Ga0207675_100995368
1074 Ga0207683_10071636
1075 Ga0207698_10004067
1076 Ga0207698_10021348
1077 Ga0207698_10146872
1078 Ga0207698_10340076
1079 Ga0207698_10386757
1080 Ga0209969_1019286
1081 Ga0209970_1001822
1082 Ga0209974_10001776
1083 Ga0207428_10179504
1084 Ga0207428_10368892
1085 Ga0268266_10003459
1086 Ga0268266_10051807
1087 Ga0268265_10003811
1088 Ga0268265_10018467
1089 Ga0268265_10071307
1090 Ga0268265_10179817
1091 Ga0268264_10000120
1092 Ga0268264_10020592
1093 Ga0268264_10026302
1094 Ga0268264_10093242
1095 Ga0265337_1152859
1096 Ga0265340_10472933
1097 Ga0307408_100864527
1098 Ga0265342_10610604
1099 Ga0307405_10191053
1100 Ga0307405_10676798
1101 Ga0307405_11114732
1102 Ga0307413_10049712
1103 Ga0307410_10435317
1104 Ga0307406_10024672
1105 Ga0307406_10436555
1106 Ga0307407_10149883
1107 Ga0307407_10679616
1108 Ga0307407_11632507
1109 Ga0307412_10079259
1110 Ga0307412_10186826
1111 Ga0307412_11204536
1112 Ga0307409_100131426
1113 Ga0307409_100481471
1114 Ga0307416_100306016
1115 Ga0307416_100666760
1116 Ga0307416_102757458
1117 Ga0307414_10444111
1118 Ga0307414_11454302
1119 Ga0307411_10231099
1120 Ga0307411_10346568
1121 Ga0307415_100191646
1122 Ga0307415_100658903
1123 Ga0373925_0960032
1124 Ga0395899_0057408
1125 Ga0395899_0072640
1126 Ga0395899_0105238
1127 Ga0395899_0419320
1128 Ga0395900_0017274
1129 Ga0395900_0032801
1130 Ga0395900_0061180
1131 Ga0395900_0061807
1132 Ga0395900_0557743
1133 Ga0395900_0563099
1134 Ga0395900_0655911
1135 Ga0395900_0797652
1136 Ga0395900_1777895
1137 Ga0395900_1851742
1138 Ga0395898_0008340
1139 Ga0395898_0050073
1140 Ga0395898_0073858
1141 Ga0395898_0247424
1142 Ga0395898_0775269
1143 Ga0395898_0894688
1144 Ga0395905_0002564
1145 Ga0395905_0204711
1146 Ga0395905_0285897
1147 Ga0395905_0500302
1148 Ga0395905_0506478
1149 Ga0395905_0530776
1150 Ga0395905_0543876
1151 Ga0395905_0691299
1152 Ga0395905_1063709
1153 Ga0395905_1567583
1154 Ga0395901_0014921
1155 Ga0395901_0026915
1156 Ga0395901_0064408
1157 Ga0395901_0598106
1158 Ga0395901_0643196
1159 Ga0395901_0713800
1160 Ga0395901_0877667
1161 Ga0395901_1036756
1162 Ga0395901_1095072
1163 Ga0400483_006218
1164 Ga0436360_0266890
1165 Ga0451853_3191148
1166 Ga0439432_081733
1167 Ga0450898_048810
1168 Ga0466969_0532930
1169 Ga0466972_0022006
1170 Ga0466972_0114906
1171 Ga0466966_0007472
1172 Ga0466966_0010374
1173 Ga0466966_0120609
1174 Ga0466966_0300450
1175 Ga0466966_0390070
1176 Ga0466961_0024552
1177 Ga0466961_0178272
1178 Ga0466961_0481805
1179 Ga0466963_0021993
1180 Ga0466963_0038233
1181 Ga0466963_0222096
1182 Ga0466963_0393684
1183 Ga0466963_0950825
1184 Ga0466963_1053697
1185 Ga0466964_0015373
1186 Ga0466964_0119979
1187 Ga0466964_0125764
1188 Ga0466968_0383495
1189 Ga0466970_0036151
1190 Ga0466957_0005536
1191 Ga0466957_0015995
1192 Ga0466957_0154363
1193 Ga0466957_0322949
1194 Ga0466957_0351360
1195 Ga0466957_0396990
1196 Ga0466957_1404902
1197 Ga0466959_0002872
1198 Ga0466959_0295208
1199 Ga0466958_0002810
1200 Ga0466958_0015426
1201 Ga0466958_0084093
1202 Ga0466958_0582619
1203 Ga0466967_0033184
1204 Ga0466967_0043227
1205 Ga0466967_0070326
1206 Ga0466967_0168273
1207 Ga0466967_0861404
1208 Ga0466967_1219506
1209 Ga0466967_1679624
1210 Ga0466967_1980144
1211 Ga0495629_0108676
1212 Ga0495664_0055279
1213 Ga0495664_0157790
1214 Ga0495584_0109593
1215 Ga0495606_0233761
1216 Ga0495643_0105832
1217 Ga0495642_0068255
1218 Ga0495652_0381961
1219 Ga0495667_0118225
1220 Ga0495656_0122064
1221 Ga0495658_0260547
1222 Ga0495677_0382059
1223 Ga0496100_0117343
1224 Ga0496101_0203574
1225 Ga0496101_0869474
1226 Ga0496102_0424574
1227 Ga0496102_1536776
1228 Ga0496103_0586124
1229 Ga0496103_1038728
1230 Ga0496108_0351391
1231 Ga0496108_1669793
1232 Ga0496109_0037238
1233 Ga0496109_0322539
1234 Ga0496109_0358201
1235 Ga0496110_0084674
1236 Ga0496110_0203899
1237 Ga0496111_0045830
1238 Ga0496111_0499120
1239 Ga0496111_0505537
1240 Ga0496112_0544977
1241 Ga0496112_1423555
1242 Ga0496113_0427509
1243 Ga0496113_1189417
1244 Ga0501032_0848988
1245 Ga0501047_0445242
1246 Ga0501067_0039080
1247 Ga0501067_0106841
1248 Ga0501068_0185291
1249 Ga0501068_1107124
1250 Ga0501069_0025906
1251 Ga0501070_0065554
1252 Ga0501072_0012351
1253 Ga0501073_0102024
1254 Ga0501076_0760258
1255 Ga0501079_0055926
1256 Ga0501080_0173487
1257 Ga0501083_0002950
1258 nmdc:mga0yw44_800978_c1
1259 nmdc:mga07m45_334558_c1
1260 nmdc:mga05p37_40752_c1
1261 nmdc:mga05p37_579219_c1
1262 nmdc:mga06r32_412823_c1
1263 nmdc:mga08y16_108611_c1
1264 nmdc:mga0n895_1117936_c1
1265 nmdc:mga0n895_1202227_c1
1266 nmdc:mga0n895_1612762_c1
1267 nmdc:mga0rr50_855035_c1
1268 nmdc:mga0a205_1559856_c1
1269 nmdc:mga0a205_5110_c1
1270 Ga0495601_0303718
1271 Ga0495612_0051155
1272 Ga0495619_0982704
1273 Ga0500568_0021065
1274 Ga0500604_0000006
1275 Ga0500616_0000258
1276 Ga0500587_007158
1277 Ga0501084_0814671
1278 Ga0466962_0066052
1279 Ga0466962_0175734
1280 Ga0466962_0375840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

16

76

0.99

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

23

84

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

18

85

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tr0-assembly2.cif.gz_B crystal structure of gssg-bound cgrx2 0.9714 1 84
4tr1-assembly1.cif.gz_A crystal structure of gsh-bound cgrx2/c15s 0.9652 1 83
3qmx-assembly1.cif.gz_A x-ray crystal structure of synechocystis sp. pcc 6803 glutaredoxin a 0.9628 2 85
4mjb-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a79s 0.9619 2 85
4mja-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a75i 0.9616 2 85
ID Description Score Start End Superfamily
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9707 1 84 3.40.30.10
af_A0A1D6GDU0_1_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9622 14 83 3.40.30.10
af_A0A1D6LVM4_243_327_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9377 2 85 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9266 1 84 3.40.30.10
af_A0A1D6KSR1_221_307_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9242 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A840F2H1-F1-model_v4 Glutaredoxin 0.9974 2 85 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-A0A553AWX5-F1-model_v4 Glutaredoxin 0.9968 1 85 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-A0A2E2QJ62-F1-model_v4 Glutaredoxin 0.996 1 84 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-A0A3D0TZ98-F1-model_v4 Glutaredoxin 0.9959 1 85 GO:0005737
GO:0015038
GO:0034599
GO:0045454
AF-A0A4P5VHF2-F1-model_v4 Glutaredoxin 0.9959 2 84 GO:0005737
GO:0015038
GO:0034599
GO:0045454

Map