F471685

General Info

Members Datasets Scaffolds Average Seq Length
640 242 1280 70

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_12899129|Ga0157376_128991292
Length 82
Sequence MNDPILTMSGEGASPLRMIGRFPVLAAGAVMLAGCVSVKAPDKPIEINLNVTLRQEVLVRLQRDVEQLINQNPQAFPTQPKQ

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
224 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
225 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
226 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
227 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
228 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
234 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
235 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
236 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
237 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
238 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
239 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 3.91
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_12899129 3300014969 Bacteria 519
2 JGI24736J21556_1028704 3300001904 Bacteria 861
3 JGI24741J21665_1026273 3300001915 Bacteria 887
4 JGI24740J21852_10014093 3300001979 Bacteria 2960
5 JGI24739J22299_10002396 3300001989 Bacteria 7231
6 JGI24739J22299_10120171 3300001989 Bacteria 785
7 JGI24737J22298_10000013 3300001990 Bacteria 50248
8 JGI24737J22298_10007338 3300001990 Bacteria 3726
9 JGI24737J22298_10059402 3300001990 Bacteria 1152
10 JGI24743J22301_10002361 3300001991 Bacteria 2827
11 JGI24743J22301_10026347 3300001991 Bacteria 1131
12 JGI24735J21928_10073945 3300002067 Bacteria 976
13 JGI24735J21928_10094909 3300002067 Unclassified 856
14 JGI24750J21931_1061709 3300002070 Bacteria 600
15 JGI24745J21846_1026464 3300002073 Unclassified 692
16 JGI24738J21930_10000465 3300002075 Bacteria 11489
17 JGI24738J21930_10002029 3300002075 Bacteria 5429
18 JGI24034J26672_10115359 3300002239 Unclassified 516
19 JGI24742J22300_10024226 3300002244 Bacteria 1046
20 rootH1_10092651 3300003323 Bacteria 1803
21 Ga0065712_10250414 3300005290 Bacteria 961
22 Ga0065715_10160939 3300005293 Bacteria 1605
23 Ga0065715_10701767 3300005293 Bacteria 652
24 Ga0065715_10737259 3300005293 Unclassified 636
25 Ga0070658_10020744 3300005327 Bacteria 5264
26 Ga0070658_11477297 3300005327 Bacteria 589
27 Ga0070676_10014961 3300005328 Bacteria 4271
28 Ga0070676_10199818 3300005328 Bacteria 1310
29 Ga0070676_10602698 3300005328 Unclassified 792
30 Ga0070676_11076551 3300005328 Bacteria 606
31 Ga0070683_100059705 3300005329 Bacteria 3543
32 Ga0070690_100220468 3300005330 Bacteria 1329
33 Ga0070690_100361024 3300005330 Bacteria 1057
34 Ga0070670_100011819 3300005331 Bacteria 7465
35 Ga0070670_100025942 3300005331 Bacteria 5043
36 Ga0070670_100108343 3300005331 Bacteria 2393
37 Ga0070670_100262516 3300005331 Bacteria 1506
38 Ga0070670_100580118 3300005331 Bacteria 1002
39 Ga0070670_100748136 3300005331 Bacteria 881
40 Ga0070677_10025447 3300005333 Bacteria 2210
41 Ga0070677_10236214 3300005333 Bacteria 900
42 Ga0068869_100000237 3300005334 Bacteria 29089
43 Ga0068869_100014438 3300005334 Bacteria 5275
44 Ga0068869_101162339 3300005334 Bacteria 677
45 Ga0068869_101600329 3300005334 Bacteria 580
46 Ga0070666_10003972 3300005335 Bacteria 8971
47 Ga0070666_10102831 3300005335 Bacteria 1970
48 Ga0070680_100049800 3300005336 Bacteria 3416
49 Ga0070680_100870053 3300005336 Bacteria 777
50 Ga0070682_100496263 3300005337 Bacteria 945
51 Ga0070682_100610158 3300005337 Bacteria 863
52 Ga0068868_100001091 3300005338 Bacteria 18581
53 Ga0068868_100188516 3300005338 Bacteria 1714
54 Ga0068868_100497929 3300005338 Bacteria 1067
55 Ga0068868_100637240 3300005338 Bacteria 948
56 Ga0070660_100001039 3300005339 Bacteria 18659
57 Ga0070660_100023467 3300005339 Bacteria 4569
58 Ga0070660_100927143 3300005339 Bacteria 735
59 Ga0070660_100947985 3300005339 Bacteria 726
60 Ga0070689_100088407 3300005340 Bacteria 2439
61 Ga0070687_100982750 3300005343 Bacteria 611
62 Ga0070661_100015278 3300005344 Bacteria 5419
63 Ga0070661_100040519 3300005344 Bacteria 3398
64 Ga0070661_100067807 3300005344 Bacteria 2622
65 Ga0070661_100073323 3300005344 Bacteria 2520
66 Ga0070692_10005562 3300005345 Bacteria 5389
67 Ga0070692_10154212 3300005345 Bacteria 1311
68 Ga0070668_100011693 3300005347 Bacteria 6535
69 Ga0070668_100578070 3300005347 Bacteria 980
70 Ga0070668_101136446 3300005347 Bacteria 706
71 Ga0070669_100000319 3300005353 Bacteria 37553
72 Ga0070669_100017250 3300005353 Bacteria 5150
73 Ga0070669_100566090 3300005353 Bacteria 949
74 Ga0070669_101013208 3300005353 Unclassified 713
75 Ga0070669_101899780 3300005353 Bacteria 520
76 Ga0070675_100045417 3300005354 Bacteria 3595
77 Ga0070675_100123174 3300005354 Bacteria 2204
78 Ga0070675_100817544 3300005354 Bacteria 852
79 Ga0070675_101861755 3300005354 Bacteria 555
80 Ga0070674_100026830 3300005356 Bacteria 3768
81 Ga0070674_101305256 3300005356 Unclassified 647
82 Ga0070673_100000113 3300005364 Bacteria 37191
83 Ga0070673_100050242 3300005364 Bacteria 3260
84 Ga0070673_100181432 3300005364 Bacteria 1802
85 Ga0070673_100207572 3300005364 Bacteria 1690
86 Ga0070673_101905271 3300005364 Bacteria 564
87 Ga0070688_100219635 3300005365 Bacteria 1339
88 Ga0070659_100001812 3300005366 Bacteria 15374
89 Ga0070659_100003411 3300005366 Bacteria 11326
90 Ga0070659_100023550 3300005366 Bacteria 4713
91 Ga0070659_100140335 3300005366 Bacteria 1967
92 Ga0070659_100244244 3300005366 Bacteria 1487
93 Ga0070659_100251760 3300005366 Bacteria 1464
94 Ga0070659_100543501 3300005366 Bacteria 994
95 Ga0070659_100937164 3300005366 Bacteria 758
96 Ga0070667_100007263 3300005367 Bacteria 9206
97 Ga0070667_100014804 3300005367 Bacteria 6443
98 Ga0070667_100049727 3300005367 Bacteria 3531
99 Ga0070667_100149355 3300005367 Bacteria 2052
100 Ga0070667_100746722 3300005367 Bacteria 907
101 Ga0070667_100994569 3300005367 Bacteria 782
102 Ga0070705_100330583 3300005440 Bacteria 1104
103 Ga0070705_101937213 3300005440 Bacteria 502
104 Ga0070700_100434526 3300005441 Bacteria 995
105 Ga0070694_100003284 3300005444 Bacteria 9666
106 Ga0070663_100012782 3300005455 Bacteria 5324
107 Ga0070663_100039871 3300005455 Bacteria 3285
108 Ga0070663_100041944 3300005455 Bacteria 3213
109 Ga0070663_101658285 3300005455 Unclassified 571
110 Ga0070663_101858132 3300005455 Bacteria 540
111 Ga0070678_101848743 3300005456 Bacteria 570
112 Ga0070662_100001355 3300005457 Bacteria 15049
113 Ga0070662_100071576 3300005457 Bacteria 2557
114 Ga0070662_100249082 3300005457 Bacteria 1427
115 Ga0070662_100306712 3300005457 Unclassified 1291
116 Ga0070662_100444969 3300005457 Bacteria 1075
117 Ga0070662_100476691 3300005457 Bacteria 1038
118 Ga0070662_101504343 3300005457 Unclassified 580
119 Ga0070662_101573026 3300005457 Bacteria 567
120 Ga0068867_100001291 3300005459 Bacteria 17281
121 Ga0068867_100079137 3300005459 Bacteria 2474
122 Ga0070685_10173313 3300005466 Bacteria 1384
123 Ga0070685_10401998 3300005466 Bacteria 949
124 Ga0070679_100081193 3300005530 Bacteria 3231
125 Ga0068853_100015290 3300005539 Bacteria 6307
126 Ga0068853_100274941 3300005539 Bacteria 1552
127 Ga0068853_100349830 3300005539 Bacteria 1374
128 Ga0068853_100576450 3300005539 Bacteria 1067
129 Ga0068853_101285748 3300005539 Unclassified 707
130 Ga0070672_100000668 3300005543 Bacteria 20156
131 Ga0070672_100027502 3300005543 Bacteria 4243
132 Ga0070672_100148103 3300005543 Bacteria 1940
133 Ga0070695_100163756 3300005545 Bacteria 1563
134 Ga0070693_100017584 3300005547 Bacteria 3720
135 Ga0070693_100022681 3300005547 Bacteria 3342
136 Ga0070693_100067648 3300005547 Bacteria 2094
137 Ga0070665_100012483 3300005548 Bacteria 8562
138 Ga0070665_100045299 3300005548 Bacteria 4418
139 Ga0070665_100963416 3300005548 Unclassified 866
140 Ga0070665_101348101 3300005548 Bacteria 723
141 Ga0070704_101331353 3300005549 Bacteria 658
142 Ga0068855_100061201 3300005563 Bacteria 4399
143 Ga0068855_100062643 3300005563 Bacteria 4341
144 Ga0068855_100141286 3300005563 Bacteria 2744
145 Ga0070664_100016043 3300005564 Bacteria 6137
146 Ga0070664_100026904 3300005564 Bacteria 4777
147 Ga0070664_100168396 3300005564 Bacteria 1942
148 Ga0070664_100197952 3300005564 Bacteria 1792
149 Ga0070664_100674579 3300005564 Bacteria 962
150 Ga0068857_100000246 3300005577 Bacteria 36409
151 Ga0068857_100039894 3300005577 Bacteria 4161
152 Ga0068857_100057750 3300005577 Bacteria 3444
153 Ga0068857_100102883 3300005577 Bacteria 2564
154 Ga0068857_100218701 3300005577 Bacteria 1739
155 Ga0068857_101734542 3300005577 Bacteria 611
156 Ga0068854_100004453 3300005578 Bacteria 8835
157 Ga0068854_100006692 3300005578 Bacteria 7347
158 Ga0068854_100020055 3300005578 Bacteria 4514
159 Ga0068854_100324501 3300005578 Bacteria 1252
160 Ga0068854_100863632 3300005578 Bacteria 793
161 Ga0068856_100307697 3300005614 Bacteria 1602
162 Ga0070702_100251669 3300005615 Bacteria 1198
163 Ga0068852_100005248 3300005616 Bacteria 9242
164 Ga0068852_100019941 3300005616 Bacteria 5322
165 Ga0068852_100094916 3300005616 Bacteria 2677
166 Ga0068852_100694163 3300005616 Bacteria 1027
167 Ga0068852_102350980 3300005616 Unclassified 554
168 Ga0068859_100001164 3300005617 Bacteria 26886
169 Ga0068859_100039821 3300005617 Bacteria 4716
170 Ga0068864_100000764 3300005618 Bacteria 27049
171 Ga0068864_101030855 3300005618 Bacteria 817
172 Ga0068866_10118517 3300005718 Bacteria 1488
173 Ga0068866_10119882 3300005718 Bacteria 1481
174 Ga0068861_100137256 3300005719 Bacteria 1991
175 Ga0068861_100199716 3300005719 Bacteria 1678
176 Ga0068861_100289026 3300005719 Bacteria 1415
177 Ga0068851_10025204 3300005834 Bacteria 2916
178 Ga0068851_10080229 3300005834 Bacteria 1703
179 Ga0068851_10162245 3300005834 Bacteria 1228
180 Ga0068870_10104560 3300005840 Bacteria 1607
181 Ga0068863_100006391 3300005841 Bacteria 11555
182 Ga0068863_100014665 3300005841 Bacteria 7544
183 Ga0068863_100120094 3300005841 Bacteria 2505
184 Ga0068863_100131092 3300005841 Bacteria 2394
185 Ga0068858_100001398 3300005842 Bacteria 24841
186 Ga0068858_100058227 3300005842 Bacteria 3572
187 Ga0068860_100025264 3300005843 Bacteria 5733
188 Ga0068860_100030028 3300005843 Bacteria 5227
189 Ga0068860_100509236 3300005843 Bacteria 1202
190 Ga0068860_101126113 3300005843 Bacteria 804
191 Ga0068862_100080941 3300005844 Bacteria 2817
192 Ga0068862_100202741 3300005844 Bacteria 1789
193 Ga0068862_100403135 3300005844 Bacteria 1280
194 Ga0068862_101650699 3300005844 Bacteria 648
195 Ga0075365_10479059 3300006038 Bacteria 879
196 Ga0075364_10727692 3300006051 Bacteria 677
197 Ga0075362_10077923 3300006177 Bacteria 1524
198 Ga0097621_100149260 3300006237 Bacteria 2004
199 Ga0097621_102260785 3300006237 Bacteria 520
200 Ga0068871_100214077 3300006358 Bacteria 1667
201 Ga0068871_100656397 3300006358 Unclassified 958
202 Ga0068871_100657413 3300006358 Unclassified 957
203 Ga0068871_100804492 3300006358 Bacteria 867
204 Ga0075431_100083545 3300006847 Bacteria 3297
205 Ga0075433_10182150 3300006852 Bacteria 1869
206 Ga0075429_100426996 3300006880 Bacteria 1161
207 Ga0068865_100000374 3300006881 Bacteria 24788
208 Ga0097620_100001164 3300006931 Bacteria 26886
209 Ga0097620_100039821 3300006931 Bacteria 4716
210 Ga0105240_11020512 3300009093 Bacteria 884
211 Ga0111539_12585294 3300009094 Bacteria 589
212 Ga0105245_10037207 3300009098 Bacteria 4326
213 Ga0105245_11916177 3300009098 Bacteria 646
214 Ga0105243_10167008 3300009148 Bacteria 1903
215 Ga0105243_10397161 3300009148 Bacteria 1280
216 Ga0105241_10062245 3300009174 Bacteria 2876
217 Ga0105241_10068048 3300009174 Bacteria 2758
218 Ga0105241_10437242 3300009174 Bacteria 1155
219 Ga0105248_10063954 3300009177 Bacteria 4130
220 Ga0105248_10072519 3300009177 Bacteria 3870
221 Ga0105248_11919516 3300009177 Bacteria 672
222 Ga0105248_12078355 3300009177 Unclassified 646
223 Ga0105237_10100843 3300009545 Bacteria 2879
224 Ga0105249_11468579 3300009553 Bacteria 754
225 Ga0105249_12340049 3300009553 Unclassified 607
226 Ga0105239_10125050 3300010375 Bacteria 2858
227 Ga0105246_10020097 3300011119 Bacteria 4281
228 Ga0157373_10047774 3300013100 Bacteria 3052
229 Ga0157373_10075213 3300013100 Bacteria 2383
230 Ga0157373_10122379 3300013100 Unclassified 1829
231 Ga0157373_10179478 3300013100 Bacteria 1490
232 Ga0157371_10033021 3300013102 Bacteria 3721
233 Ga0157371_10055612 3300013102 Bacteria 2808
234 Ga0157371_10208511 3300013102 Bacteria 1402
235 Ga0157371_10436555 3300013102 Bacteria 961
236 Ga0157371_11349062 3300013102 Bacteria 553
237 Ga0157370_10311052 3300013104 Bacteria 1454
238 Ga0157370_11602236 3300013104 Unclassified 585
239 Ga0157374_10209416 3300013296 Unclassified 1911
240 Ga0157374_11196310 3300013296 Bacteria 781
241 Ga0157378_11777948 3300013297 Unclassified 664
242 Ga0163162_10496749 3300013306 Bacteria 1351
243 Ga0163162_10710325 3300013306 Bacteria 1126
244 Ga0163162_12296330 3300013306 Bacteria 620
245 Ga0157372_10012231 3300013307 Bacteria 9139
246 Ga0157372_10398170 3300013307 Bacteria 1605
247 Ga0157375_10103356 3300013308 Bacteria 2936
248 Ga0157375_10199015 3300013308 Bacteria 2159
249 Ga0157380_10211211 3300014326 Bacteria 1729
250 Ga0157380_11687114 3300014326 Unclassified 691
251 Ga0157380_11794051 3300014326 Bacteria 672
252 Ga0182008_10258563 3300014497 Bacteria 900
253 Ga0157377_10015317 3300014745 Bacteria 3919
254 Ga0157379_10291854 3300014968 Bacteria 1485
255 Ga0157379_11220129 3300014968 Bacteria 724
256 Ga0163161_11794439 3300017792 Bacteria 545
257 Ga0207673_1009176 3300025290 Bacteria 1261
258 Ga0207697_10000112 3300025315 Bacteria 37791
259 Ga0207656_10170653 3300025321 Bacteria 1040
260 Ga0207682_10028123 3300025893 Bacteria 2243
261 Ga0207682_10172946 3300025893 Bacteria 983
262 Ga0207710_10546547 3300025900 Bacteria 603
263 Ga0207688_10007926 3300025901 Bacteria 5780
264 Ga0207688_10097773 3300025901 Bacteria 1692
265 Ga0207688_10439807 3300025901 Bacteria 812
266 Ga0207688_10676039 3300025901 Bacteria 652
267 Ga0207680_10425841 3300025903 Bacteria 940
268 Ga0207680_10760636 3300025903 Bacteria 694
269 Ga0207647_10000101 3300025904 Bacteria 66258
270 Ga0207647_10000450 3300025904 Bacteria 33415
271 Ga0207647_10008523 3300025904 Bacteria 7343
272 Ga0207647_10053904 3300025904 Bacteria 2476
273 Ga0207645_10006401 3300025907 Bacteria 8455
274 Ga0207645_10046902 3300025907 Bacteria 2760
275 Ga0207645_10175891 3300025907 Bacteria 1404
276 Ga0207645_10387703 3300025907 Unclassified 938
277 Ga0207643_10156061 3300025908 Bacteria 1371
278 Ga0207705_10074420 3300025909 Bacteria 2465
279 Ga0207705_10524324 3300025909 Bacteria 921
280 Ga0207707_10165490 3300025912 Bacteria 1932
281 Ga0207695_11678152 3300025913 Bacteria 516
282 Ga0207671_10426482 3300025914 Unclassified 1055
283 Ga0207662_10215442 3300025918 Bacteria 1248
284 Ga0207662_10847495 3300025918 Bacteria 646
285 Ga0207657_10004615 3300025919 Bacteria 14556
286 Ga0207657_10009014 3300025919 Bacteria 10077
287 Ga0207657_10037359 3300025919 Bacteria 4337
288 Ga0207657_10066415 3300025919 Bacteria 3070
289 Ga0207657_10240256 3300025919 Bacteria 1446
290 Ga0207657_10533217 3300025919 Bacteria 918
291 Ga0207657_10706759 3300025919 Bacteria 783
292 Ga0207649_10010035 3300025920 Bacteria 5194
293 Ga0207649_10039268 3300025920 Bacteria 2869
294 Ga0207649_10132872 3300025920 Bacteria 1693
295 Ga0207652_10328960 3300025921 Bacteria 1380
296 Ga0207652_10734996 3300025921 Bacteria 879
297 Ga0207681_10001675 3300025923 Bacteria 14271
298 Ga0207681_10040198 3300025923 Bacteria 3110
299 Ga0207694_10050373 3300025924 Bacteria 3225
300 Ga0207650_10019650 3300025925 Bacteria 4750
301 Ga0207650_10037530 3300025925 Bacteria 3531
302 Ga0207650_10160304 3300025925 Bacteria 1782
303 Ga0207650_10192693 3300025925 Bacteria 1629
304 Ga0207650_10436450 3300025925 Bacteria 1088
305 Ga0207650_10514143 3300025925 Unclassified 1002
306 Ga0207659_10028322 3300025926 Bacteria 3806
307 Ga0207659_10105500 3300025926 Bacteria 2133
308 Ga0207659_10175246 3300025926 Bacteria 1695
309 Ga0207659_10761273 3300025926 Bacteria 831
310 Ga0207659_11423736 3300025926 Bacteria 594
311 Ga0207687_10003507 3300025927 Bacteria 10554
312 Ga0207687_10210040 3300025927 Bacteria 1527
313 Ga0207644_10000794 3300025931 Bacteria 20032
314 Ga0207644_10014594 3300025931 Bacteria 5260
315 Ga0207644_10016335 3300025931 Bacteria 4994
316 Ga0207644_10022141 3300025931 Bacteria 4339
317 Ga0207644_10037417 3300025931 Bacteria 3413
318 Ga0207644_10089254 3300025931 Bacteria 2294
319 Ga0207644_10474814 3300025931 Unclassified 1029
320 Ga0207644_11213323 3300025931 Bacteria 634
321 Ga0207690_10002439 3300025932 Bacteria 11246
322 Ga0207690_10002639 3300025932 Bacteria 10796
323 Ga0207690_10019903 3300025932 Bacteria 4138
324 Ga0207690_10025490 3300025932 Bacteria 3714
325 Ga0207690_10193172 3300025932 Bacteria 1541
326 Ga0207690_10739881 3300025932 Bacteria 810
327 Ga0207706_10000318 3300025933 Bacteria 52104
328 Ga0207706_10003641 3300025933 Bacteria 14717
329 Ga0207706_10015533 3300025933 Bacteria 6879
330 Ga0207706_10024002 3300025933 Bacteria 5472
331 Ga0207706_10044832 3300025933 Bacteria 3918
332 Ga0207706_10069755 3300025933 Bacteria 3091
333 Ga0207706_11568395 3300025933 Bacteria 535
334 Ga0207686_10092154 3300025934 Bacteria 2003
335 Ga0207709_10024173 3300025935 Bacteria 3467
336 Ga0207709_10084838 3300025935 Bacteria 2052
337 Ga0207709_10114535 3300025935 Bacteria 1809
338 Ga0207709_11720610 3300025935 Bacteria 521
339 Ga0207669_10030929 3300025937 Bacteria 2983
340 Ga0207669_10431818 3300025937 Bacteria 1039
341 Ga0207704_10014390 3300025938 Bacteria 3993
342 Ga0207704_10518342 3300025938 Bacteria 964
343 Ga0207691_10000593 3300025940 Bacteria 36106
344 Ga0207691_10014594 3300025940 Bacteria 7488
345 Ga0207691_10040728 3300025940 Bacteria 4291
346 Ga0207691_10472289 3300025940 Bacteria 1066
347 Ga0207711_10003282 3300025941 Bacteria 14060
348 Ga0207711_10023568 3300025941 Bacteria 5153
349 Ga0207711_10115903 3300025941 Bacteria 2388
350 Ga0207711_10181675 3300025941 Bacteria 1913
351 Ga0207711_11170575 3300025941 Bacteria 710
352 Ga0207711_11496873 3300025941 Bacteria 618
353 Ga0207711_11569761 3300025941 Bacteria 601
354 Ga0207689_10000016 3300025942 Bacteria 118140
355 Ga0207689_10009583 3300025942 Bacteria 8352
356 Ga0207689_11550126 3300025942 Bacteria 552
357 Ga0207661_11153060 3300025944 Bacteria 713
358 Ga0207679_10070006 3300025945 Bacteria 2642
359 Ga0207679_10153013 3300025945 Bacteria 1880
360 Ga0207679_10440793 3300025945 Bacteria 1153
361 Ga0207679_10699420 3300025945 Bacteria 920
362 Ga0207679_11105706 3300025945 Bacteria 727
363 Ga0207679_11868966 3300025945 Bacteria 548
364 Ga0207667_10007726 3300025949 Bacteria 12856
365 Ga0207667_10027560 3300025949 Bacteria 6181
366 Ga0207667_10114319 3300025949 Bacteria 2782
367 Ga0207651_10003207 3300025960 Bacteria 7996
368 Ga0207651_10033977 3300025960 Bacteria 3297
369 Ga0207651_10036174 3300025960 Bacteria 3220
370 Ga0207651_10171270 3300025960 Bacteria 1713
371 Ga0207651_10368790 3300025960 Bacteria 1214
372 Ga0207651_11126831 3300025960 Bacteria 703
373 Ga0207712_10000146 3300025961 Bacteria 73378
374 Ga0207712_11069727 3300025961 Bacteria 717
375 Ga0207668_10006604 3300025972 Bacteria 6859
376 Ga0207668_10270889 3300025972 Bacteria 1388
377 Ga0207668_10284656 3300025972 Unclassified 1357
378 Ga0207668_10862411 3300025972 Bacteria 804
379 Ga0207668_11393153 3300025972 Bacteria 632
380 Ga0207640_10072422 3300025981 Bacteria 2324
381 Ga0207640_10297994 3300025981 Bacteria 1274
382 Ga0207640_10372263 3300025981 Bacteria 1155
383 Ga0207640_10454744 3300025981 Bacteria 1056
384 Ga0207640_10576467 3300025981 Unclassified 949
385 Ga0207658_10043559 3300025986 Bacteria 3263
386 Ga0207658_10069733 3300025986 Bacteria 2657
387 Ga0207658_10103689 3300025986 Bacteria 2233
388 Ga0207658_10153728 3300025986 Bacteria 1878
389 Ga0207658_11745834 3300025986 Bacteria 568
390 Ga0207658_11983205 3300025986 Bacteria 530
391 Ga0207677_10002823 3300026023 Bacteria 9167
392 Ga0207677_12182117 3300026023 Bacteria 515
393 Ga0207703_10007173 3300026035 Bacteria 8866
394 Ga0207703_10102414 3300026035 Bacteria 2429
395 Ga0207703_11420708 3300026035 Bacteria 667
396 Ga0207639_10038297 3300026041 Bacteria 3566
397 Ga0207639_10062910 3300026041 Bacteria 2871
398 Ga0207639_10173732 3300026041 Bacteria 1827
399 Ga0207639_10233254 3300026041 Bacteria 1596
400 Ga0207639_11568243 3300026041 Unclassified 618
401 Ga0207678_10005390 3300026067 Bacteria 11460
402 Ga0207678_10310414 3300026067 Bacteria 1356
403 Ga0207702_10346398 3300026078 Bacteria 1420
404 Ga0207641_10030199 3300026088 Bacteria 4487
405 Ga0207641_10121759 3300026088 Bacteria 2329
406 Ga0207641_10165383 3300026088 Bacteria 2014
407 Ga0207641_10428267 3300026088 Bacteria 1275
408 Ga0207641_10545483 3300026088 Bacteria 1130
409 Ga0207641_11544480 3300026088 Bacteria 666
410 Ga0207648_10000367 3300026089 Bacteria 49592
411 Ga0207648_10028790 3300026089 Bacteria 4924
412 Ga0207676_10001572 3300026095 Bacteria 16793
413 Ga0207676_10017054 3300026095 Bacteria 5262
414 Ga0207676_10411008 3300026095 Bacteria 1267
415 Ga0207676_10732067 3300026095 Bacteria 961
416 Ga0207674_10000114 3300026116 Bacteria 93676
417 Ga0207674_10005415 3300026116 Bacteria 15173
418 Ga0207674_10006480 3300026116 Bacteria 13763
419 Ga0207674_10046443 3300026116 Bacteria 4458
420 Ga0207674_10103298 3300026116 Bacteria 2829
421 Ga0207674_11242574 3300026116 Bacteria 714
422 Ga0207674_11359634 3300026116 Bacteria 680
423 Ga0207675_100143382 3300026118 Bacteria 2270
424 Ga0207675_100310878 3300026118 Bacteria 1537
425 Ga0207675_101862032 3300026118 Bacteria 620
426 Ga0207675_102499191 3300026118 Bacteria 527
427 Ga0207698_10038715 3300026142 Bacteria 3525
428 Ga0207698_10074221 3300026142 Bacteria 2712
429 Ga0207698_10260372 3300026142 Bacteria 1593
430 Ga0207698_10419074 3300026142 Bacteria 1284
431 Ga0207698_11076426 3300026142 Bacteria 816
432 Ga0209999_1030344 3300027543 Bacteria 1003
433 Ga0209983_1014085 3300027665 Bacteria 1646
434 Ga0209983_1016913 3300027665 Bacteria 1507
435 Ga0268266_10002339 3300028379 Bacteria 20508
436 Ga0268266_10432711 3300028379 Bacteria 1248
437 Ga0268265_10060651 3300028380 Bacteria 2899
438 Ga0268265_10068790 3300028380 Bacteria 2747
439 Ga0268265_10361917 3300028380 Bacteria 1328
440 Ga0268264_10000594 3300028381 Bacteria 43886
441 Ga0268264_10025708 3300028381 Bacteria 4809
442 Ga0268264_10124170 3300028381 Bacteria 2279
443 Ga0268264_10282347 3300028381 Bacteria 1556
444 Ga0316177_1155977 3300030731 Bacteria 643
445 Ga0307408_100044684 3300031548 Bacteria 3158
446 Ga0307408_100080109 3300031548 Bacteria 2438
447 Ga0307408_100100111 3300031548 Bacteria 2207
448 Ga0307408_100102432 3300031548 Bacteria 2183
449 Ga0307408_100161738 3300031548 Bacteria 1779
450 Ga0307408_100542309 3300031548 Bacteria 1025
451 Ga0307405_10006360 3300031731 Bacteria 5806
452 Ga0307405_10041678 3300031731 Bacteria 2789
453 Ga0307405_10047979 3300031731 Bacteria 2631
454 Ga0307405_10137146 3300031731 Bacteria 1700
455 Ga0307405_10137506 3300031731 Bacteria 1698
456 Ga0307405_10205933 3300031731 Bacteria 1432
457 Ga0307405_10433786 3300031731 Bacteria 1037
458 Ga0307405_10552330 3300031731 Bacteria 932
459 Ga0307413_10066717 3300031824 Bacteria 2246
460 Ga0307413_10067637 3300031824 Bacteria 2234
461 Ga0307413_10181915 3300031824 Bacteria 1500
462 Ga0307413_10407288 3300031824 Bacteria 1067
463 Ga0307413_10613139 3300031824 Bacteria 892
464 Ga0307413_12064319 3300031824 Bacteria 515
465 Ga0307410_10014150 3300031852 Bacteria 4682
466 Ga0307410_10032966 3300031852 Bacteria 3340
467 Ga0307410_10044304 3300031852 Bacteria 2955
468 Ga0307410_10654558 3300031852 Bacteria 881
469 Ga0307406_10016038 3300031901 Bacteria 4346
470 Ga0307406_10171035 3300031901 Bacteria 1572
471 Ga0307406_10719079 3300031901 Bacteria 835
472 Ga0307407_10006564 3300031903 Bacteria 5189
473 Ga0307407_10009072 3300031903 Bacteria 4611
474 Ga0307407_10113278 3300031903 Bacteria 1706
475 Ga0307407_10280913 3300031903 Bacteria 1153
476 Ga0307412_10011595 3300031911 Bacteria 5110
477 Ga0307412_10014537 3300031911 Bacteria 4644
478 Ga0307412_10019000 3300031911 Bacteria 4150
479 Ga0307412_10353206 3300031911 Bacteria 1181
480 Ga0307412_11155772 3300031911 Bacteria 691
481 Ga0307409_100020197 3300031995 Bacteria 4534
482 Ga0307409_100053566 3300031995 Bacteria 3100
483 Ga0307409_100333385 3300031995 Bacteria 1424
484 Ga0307409_100541479 3300031995 Bacteria 1141
485 Ga0307409_100617829 3300031995 Bacteria 1073
486 Ga0307409_102290546 3300031995 Bacteria 569
487 Ga0307416_100010392 3300032002 Bacteria 6144
488 Ga0307416_100040573 3300032002 Bacteria 3617
489 Ga0307416_100527947 3300032002 Bacteria 1250
490 Ga0307416_101268781 3300032002 Bacteria 842
491 Ga0307416_101341972 3300032002 Bacteria 821
492 Ga0307416_102198494 3300032002 Bacteria 653
493 Ga0307414_10006609 3300032004 Bacteria 6477
494 Ga0307414_10008564 3300032004 Bacteria 5812
495 Ga0307414_10415153 3300032004 Bacteria 1172
496 Ga0307414_10541464 3300032004 Bacteria 1036
497 Ga0307414_10733941 3300032004 Bacteria 896
498 Ga0307414_11012954 3300032004 Bacteria 765
499 Ga0307414_11481485 3300032004 Bacteria 631
500 Ga0307414_11562714 3300032004 Bacteria 614
501 Ga0307411_10006078 3300032005 Bacteria 6003
502 Ga0307411_10011441 3300032005 Bacteria 4790
503 Ga0307411_10035310 3300032005 Bacteria 3120
504 Ga0307411_10052566 3300032005 Bacteria 2664
505 Ga0307411_10724950 3300032005 Bacteria 868
506 Ga0307415_100007346 3300032126 Bacteria 6021
507 Ga0307415_100011172 3300032126 Bacteria 5123
508 Ga0307415_100076596 3300032126 Bacteria 2372
509 Ga0307415_100088124 3300032126 Bacteria 2238
510 Ga0307415_100611413 3300032126 Bacteria 971
511 Ga0307415_100702549 3300032126 Bacteria 913
512 Ga0373952_0300596 3300035092 Bacteria 500
513 Ga0373960_0377897 3300035121 Bacteria 542
514 Ga0373947_0955444 3300035725 Bacteria 585
515 Ga0395899_0001279 3300037312 Bacteria 21800
516 Ga0395899_0015543 3300037312 Bacteria 5804
517 Ga0395899_0104888 3300037312 Bacteria 2037
518 Ga0395899_0196525 3300037312 Bacteria 1409
519 Ga0395899_0772004 3300037312 Unclassified 596
520 Ga0395900_0041973 3300037418 Bacteria 4713
521 Ga0395900_0043704 3300037418 Bacteria 4618
522 Ga0395900_0124561 3300037418 Bacteria 2643
523 Ga0395900_0125141 3300037418 Bacteria 2636
524 Ga0395900_0157092 3300037418 Bacteria 2322
525 Ga0395900_0167888 3300037418 Bacteria 2235
526 Ga0395900_0205134 3300037418 Bacteria 1992
527 Ga0395900_0309942 3300037418 Bacteria 1562
528 Ga0395900_0364670 3300037418 Bacteria 1415
529 Ga0395900_0748435 3300037418 Bacteria 908
530 Ga0395900_0990136 3300037418 Bacteria 761
531 Ga0395900_1664403 3300037418 Bacteria 549
532 Ga0395898_0009735 3300037466 Bacteria 10077
533 Ga0395898_0039150 3300037466 Bacteria 4694
534 Ga0395898_0121616 3300037466 Bacteria 2501
535 Ga0395898_0226440 3300037466 Bacteria 1783
536 Ga0395898_0335123 3300037466 Bacteria 1443
537 Ga0395898_0612388 3300037466 Bacteria 1032
538 Ga0395898_1619231 3300037466 Bacteria 571
539 Ga0395898_1806781 3300037466 Unclassified 532
540 Ga0395898_1951753 3300037466 Bacteria 507
541 Ga0395905_0000259 3300037471 Bacteria 79396
542 Ga0395905_0001373 3300037471 Bacteria 29537
543 Ga0395905_0009309 3300037471 Bacteria 9608
544 Ga0395905_0016153 3300037471 Bacteria 7096
545 Ga0395905_0027692 3300037471 Bacteria 5344
546 Ga0395905_0032348 3300037471 Bacteria 4919
547 Ga0395905_0051884 3300037471 Bacteria 3841
548 Ga0395905_0061303 3300037471 Bacteria 3518
549 Ga0395905_0107266 3300037471 Bacteria 2622
550 Ga0395905_0108523 3300037471 Bacteria 2605
551 Ga0395905_0129972 3300037471 Bacteria 2369
552 Ga0395905_0254701 3300037471 Bacteria 1639
553 Ga0395905_0266554 3300037471 Bacteria 1598
554 Ga0395905_0351362 3300037471 Bacteria 1366
555 Ga0395905_0815034 3300037471 Bacteria 836
556 Ga0395905_1413110 3300037471 Bacteria 600
557 Ga0395901_0023803 3300038443 Bacteria 6280
558 Ga0395901_0059989 3300038443 Bacteria 3958
559 Ga0395901_0076453 3300038443 Bacteria 3493
560 Ga0395901_0221355 3300038443 Bacteria 1978
561 Ga0395901_0261157 3300038443 Bacteria 1802
562 Ga0395901_0281738 3300038443 Bacteria 1727
563 Ga0395901_0317866 3300038443 Bacteria 1611
564 Ga0395901_0328892 3300038443 Bacteria 1580
565 Ga0395901_0607757 3300038443 Bacteria 1102
566 Ga0395901_0850721 3300038443 Bacteria 897
567 Ga0395901_0948819 3300038443 Bacteria 839
568 Ga0395901_1270550 3300038443 Bacteria 699
569 Ga0439438_053667 3300041405 Bacteria 1020
570 Ga0439465_0227536 3300041413 Bacteria 685
571 Ga0439448_0053578 3300042005 Bacteria 1324
572 Ga0439432_041480 3300042006 Bacteria 1457
573 Ga0439449_0022802 3300042007 Bacteria 2343
574 Ga0439452_030855 3300042010 Bacteria 1319
575 Ga0439458_0239256 3300042157 Bacteria 503
576 Ga0439464_0083658 3300042439 Bacteria 955
577 Ga0466964_0518024 3300044706 Bacteria 643
578 Ga0495629_0373645 3300046459 Bacteria 971
579 Ga0495621_0138747 3300046539 Bacteria 950
580 Ga0495668_0198935 3300046616 Unclassified 1097
581 Ga0495659_0057345 3300046664 Bacteria 1431
582 Ga0495669_0042185 3300046684 Bacteria 2028
583 Ga0495669_0328509 3300046684 Bacteria 738
584 Ga0495670_0778495 3300046691 Bacteria 522
585 Ga0495686_0000366 3300047472 Bacteria 73243
586 Ga0496100_0029472 3300048903 Bacteria 3395
587 Ga0496101_0108789 3300048904 Bacteria 2084
588 Ga0496102_1109027 3300048905 Bacteria 711
589 Ga0496103_0680488 3300048906 Unclassified 653
590 Ga0496106_0108677 3300048909 Bacteria 2157
591 Ga0496106_0498518 3300048909 Bacteria 978
592 Ga0496106_0985290 3300048909 Bacteria 663
593 Ga0496107_0063398 3300048910 Bacteria 2678
594 Ga0496107_0188249 3300048910 Bacteria 1533
595 Ga0496107_0210794 3300048910 Bacteria 1445
596 Ga0496107_0345565 3300048910 Bacteria 1107
597 Ga0496108_0185628 3300048911 Bacteria 1801
598 Ga0496109_0064762 3300048912 Bacteria 3345
599 Ga0496109_0114251 3300048912 Bacteria 2512
600 Ga0496109_0297935 3300048912 Bacteria 1520
601 Ga0496110_0061986 3300048913 Bacteria 3302
602 Ga0496110_0328159 3300048913 Bacteria 1394
603 Ga0496110_1191914 3300048913 Bacteria 670
604 Ga0496111_0097006 3300048914 Bacteria 2164
605 Ga0496111_1312927 3300048914 Bacteria 509
606 Ga0496112_0034388 3300048915 Bacteria 4932
607 Ga0496113_0181127 3300048916 Bacteria 1670
608 Ga0496113_0559427 3300048916 Bacteria 917
609 Ga0496114_1545943 3300048917 Bacteria 551
610 Ga0496115_0054231 3300048918 Bacteria 3219
611 Ga0495678_223557 3300049459 Bacteria 570
612 Ga0501067_0086698 3300049583 Bacteria 1737
613 Ga0501068_0123570 3300049584 Bacteria 1615
614 Ga0501069_0222671 3300049585 Bacteria 1097
615 Ga0501069_0607625 3300049585 Bacteria 657
616 Ga0501070_0128583 3300049586 Bacteria 2093
617 Ga0501073_0370429 3300049589 Bacteria 989
618 Ga0501074_0066260 3300049590 Bacteria 2598
619 Ga0501202_131684 3300049652 Bacteria 638
620 Ga0501206_053804 3300049653 Bacteria 647
621 Ga0501223_029706 3300049663 Bacteria 1063
622 Ga0501230_141472 3300049667 Bacteria 542
623 Ga0501242_009227 3300049674 Bacteria 1165
624 Ga0501250_068953 3300049680 Bacteria 580
625 Ga0501253_095428 3300049683 Bacteria 690
626 Ga0501257_036512 3300049686 Bacteria 1197
627 Ga0501225_0097344 3300049705 Bacteria 857
628 Ga0501229_029630 3300049706 Bacteria 747
629 Ga0501079_1291546 3300049741 Bacteria 575
630 Ga0501080_1024337 3300049742 Bacteria 715
631 Ga0501232_098166 3300049757 Bacteria 509
632 Ga0501268_004866 3300049765 Bacteria 1908
633 Ga0501270_026822 3300049767 Bacteria 922
634 Ga0501272_001630 3300049769 Bacteria 2149
635 Ga0501273_002117 3300049770 Bacteria 1993
636 Ga0501282_041446 3300049778 Bacteria 551
637 Ga0501283_106127 3300049779 Bacteria 551
638 nmdc:mga03683_293421_c1 3300050489 Bacteria 761
639 nmdc:mga06r32_57616_c1 3300050510 Bacteria 3732
640 Ga0590071_128652 3300059421 Bacteria 650
641 Ga0157376_12899129
642 JGI24736J21556_1028704
643 JGI24741J21665_1026273
644 JGI24740J21852_10014093
645 JGI24739J22299_10002396
646 JGI24739J22299_10120171
647 JGI24737J22298_10000013
648 JGI24737J22298_10007338
649 JGI24737J22298_10059402
650 JGI24743J22301_10002361
651 JGI24743J22301_10026347
652 JGI24735J21928_10073945
653 JGI24735J21928_10094909
654 JGI24750J21931_1061709
655 JGI24745J21846_1026464
656 JGI24738J21930_10000465
657 JGI24738J21930_10002029
658 JGI24034J26672_10115359
659 JGI24742J22300_10024226
660 rootH1_10092651
661 Ga0065712_10250414
662 Ga0065715_10160939
663 Ga0065715_10701767
664 Ga0065715_10737259
665 Ga0070658_10020744
666 Ga0070658_11477297
667 Ga0070676_10014961
668 Ga0070676_10199818
669 Ga0070676_10602698
670 Ga0070676_11076551
671 Ga0070683_100059705
672 Ga0070690_100220468
673 Ga0070690_100361024
674 Ga0070670_100011819
675 Ga0070670_100025942
676 Ga0070670_100108343
677 Ga0070670_100262516
678 Ga0070670_100580118
679 Ga0070670_100748136
680 Ga0070677_10025447
681 Ga0070677_10236214
682 Ga0068869_100000237
683 Ga0068869_100014438
684 Ga0068869_101162339
685 Ga0068869_101600329
686 Ga0070666_10003972
687 Ga0070666_10102831
688 Ga0070680_100049800
689 Ga0070680_100870053
690 Ga0070682_100496263
691 Ga0070682_100610158
692 Ga0068868_100001091
693 Ga0068868_100188516
694 Ga0068868_100497929
695 Ga0068868_100637240
696 Ga0070660_100001039
697 Ga0070660_100023467
698 Ga0070660_100927143
699 Ga0070660_100947985
700 Ga0070689_100088407
701 Ga0070687_100982750
702 Ga0070661_100015278
703 Ga0070661_100040519
704 Ga0070661_100067807
705 Ga0070661_100073323
706 Ga0070692_10005562
707 Ga0070692_10154212
708 Ga0070668_100011693
709 Ga0070668_100578070
710 Ga0070668_101136446
711 Ga0070669_100000319
712 Ga0070669_100017250
713 Ga0070669_100566090
714 Ga0070669_101013208
715 Ga0070669_101899780
716 Ga0070675_100045417
717 Ga0070675_100123174
718 Ga0070675_100817544
719 Ga0070675_101861755
720 Ga0070674_100026830
721 Ga0070674_101305256
722 Ga0070673_100000113
723 Ga0070673_100050242
724 Ga0070673_100181432
725 Ga0070673_100207572
726 Ga0070673_101905271
727 Ga0070688_100219635
728 Ga0070659_100001812
729 Ga0070659_100003411
730 Ga0070659_100023550
731 Ga0070659_100140335
732 Ga0070659_100244244
733 Ga0070659_100251760
734 Ga0070659_100543501
735 Ga0070659_100937164
736 Ga0070667_100007263
737 Ga0070667_100014804
738 Ga0070667_100049727
739 Ga0070667_100149355
740 Ga0070667_100746722
741 Ga0070667_100994569
742 Ga0070705_100330583
743 Ga0070705_101937213
744 Ga0070700_100434526
745 Ga0070694_100003284
746 Ga0070663_100012782
747 Ga0070663_100039871
748 Ga0070663_100041944
749 Ga0070663_101658285
750 Ga0070663_101858132
751 Ga0070678_101848743
752 Ga0070662_100001355
753 Ga0070662_100071576
754 Ga0070662_100249082
755 Ga0070662_100306712
756 Ga0070662_100444969
757 Ga0070662_100476691
758 Ga0070662_101504343
759 Ga0070662_101573026
760 Ga0068867_100001291
761 Ga0068867_100079137
762 Ga0070685_10173313
763 Ga0070685_10401998
764 Ga0070679_100081193
765 Ga0068853_100015290
766 Ga0068853_100274941
767 Ga0068853_100349830
768 Ga0068853_100576450
769 Ga0068853_101285748
770 Ga0070672_100000668
771 Ga0070672_100027502
772 Ga0070672_100148103
773 Ga0070695_100163756
774 Ga0070693_100017584
775 Ga0070693_100022681
776 Ga0070693_100067648
777 Ga0070665_100012483
778 Ga0070665_100045299
779 Ga0070665_100963416
780 Ga0070665_101348101
781 Ga0070704_101331353
782 Ga0068855_100061201
783 Ga0068855_100062643
784 Ga0068855_100141286
785 Ga0070664_100016043
786 Ga0070664_100026904
787 Ga0070664_100168396
788 Ga0070664_100197952
789 Ga0070664_100674579
790 Ga0068857_100000246
791 Ga0068857_100039894
792 Ga0068857_100057750
793 Ga0068857_100102883
794 Ga0068857_100218701
795 Ga0068857_101734542
796 Ga0068854_100004453
797 Ga0068854_100006692
798 Ga0068854_100020055
799 Ga0068854_100324501
800 Ga0068854_100863632
801 Ga0068856_100307697
802 Ga0070702_100251669
803 Ga0068852_100005248
804 Ga0068852_100019941
805 Ga0068852_100094916
806 Ga0068852_100694163
807 Ga0068852_102350980
808 Ga0068859_100001164
809 Ga0068859_100039821
810 Ga0068864_100000764
811 Ga0068864_101030855
812 Ga0068866_10118517
813 Ga0068866_10119882
814 Ga0068861_100137256
815 Ga0068861_100199716
816 Ga0068861_100289026
817 Ga0068851_10025204
818 Ga0068851_10080229
819 Ga0068851_10162245
820 Ga0068870_10104560
821 Ga0068863_100006391
822 Ga0068863_100014665
823 Ga0068863_100120094
824 Ga0068863_100131092
825 Ga0068858_100001398
826 Ga0068858_100058227
827 Ga0068860_100025264
828 Ga0068860_100030028
829 Ga0068860_100509236
830 Ga0068860_101126113
831 Ga0068862_100080941
832 Ga0068862_100202741
833 Ga0068862_100403135
834 Ga0068862_101650699
835 Ga0075365_10479059
836 Ga0075364_10727692
837 Ga0075362_10077923
838 Ga0097621_100149260
839 Ga0097621_102260785
840 Ga0068871_100214077
841 Ga0068871_100656397
842 Ga0068871_100657413
843 Ga0068871_100804492
844 Ga0075431_100083545
845 Ga0075433_10182150
846 Ga0075429_100426996
847 Ga0068865_100000374
848 Ga0097620_100001164
849 Ga0097620_100039821
850 Ga0105240_11020512
851 Ga0111539_12585294
852 Ga0105245_10037207
853 Ga0105245_11916177
854 Ga0105243_10167008
855 Ga0105243_10397161
856 Ga0105241_10062245
857 Ga0105241_10068048
858 Ga0105241_10437242
859 Ga0105248_10063954
860 Ga0105248_10072519
861 Ga0105248_11919516
862 Ga0105248_12078355
863 Ga0105237_10100843
864 Ga0105249_11468579
865 Ga0105249_12340049
866 Ga0105239_10125050
867 Ga0105246_10020097
868 Ga0157373_10047774
869 Ga0157373_10075213
870 Ga0157373_10122379
871 Ga0157373_10179478
872 Ga0157371_10033021
873 Ga0157371_10055612
874 Ga0157371_10208511
875 Ga0157371_10436555
876 Ga0157371_11349062
877 Ga0157370_10311052
878 Ga0157370_11602236
879 Ga0157374_10209416
880 Ga0157374_11196310
881 Ga0157378_11777948
882 Ga0163162_10496749
883 Ga0163162_10710325
884 Ga0163162_12296330
885 Ga0157372_10012231
886 Ga0157372_10398170
887 Ga0157375_10103356
888 Ga0157375_10199015
889 Ga0157380_10211211
890 Ga0157380_11687114
891 Ga0157380_11794051
892 Ga0182008_10258563
893 Ga0157377_10015317
894 Ga0157379_10291854
895 Ga0157379_11220129
896 Ga0163161_11794439
897 Ga0207673_1009176
898 Ga0207697_10000112
899 Ga0207656_10170653
900 Ga0207682_10028123
901 Ga0207682_10172946
902 Ga0207710_10546547
903 Ga0207688_10007926
904 Ga0207688_10097773
905 Ga0207688_10439807
906 Ga0207688_10676039
907 Ga0207680_10425841
908 Ga0207680_10760636
909 Ga0207647_10000101
910 Ga0207647_10000450
911 Ga0207647_10008523
912 Ga0207647_10053904
913 Ga0207645_10006401
914 Ga0207645_10046902
915 Ga0207645_10175891
916 Ga0207645_10387703
917 Ga0207643_10156061
918 Ga0207705_10074420
919 Ga0207705_10524324
920 Ga0207707_10165490
921 Ga0207695_11678152
922 Ga0207671_10426482
923 Ga0207662_10215442
924 Ga0207662_10847495
925 Ga0207657_10004615
926 Ga0207657_10009014
927 Ga0207657_10037359
928 Ga0207657_10066415
929 Ga0207657_10240256
930 Ga0207657_10533217
931 Ga0207657_10706759
932 Ga0207649_10010035
933 Ga0207649_10039268
934 Ga0207649_10132872
935 Ga0207652_10328960
936 Ga0207652_10734996
937 Ga0207681_10001675
938 Ga0207681_10040198
939 Ga0207694_10050373
940 Ga0207650_10019650
941 Ga0207650_10037530
942 Ga0207650_10160304
943 Ga0207650_10192693
944 Ga0207650_10436450
945 Ga0207650_10514143
946 Ga0207659_10028322
947 Ga0207659_10105500
948 Ga0207659_10175246
949 Ga0207659_10761273
950 Ga0207659_11423736
951 Ga0207687_10003507
952 Ga0207687_10210040
953 Ga0207644_10000794
954 Ga0207644_10014594
955 Ga0207644_10016335
956 Ga0207644_10022141
957 Ga0207644_10037417
958 Ga0207644_10089254
959 Ga0207644_10474814
960 Ga0207644_11213323
961 Ga0207690_10002439
962 Ga0207690_10002639
963 Ga0207690_10019903
964 Ga0207690_10025490
965 Ga0207690_10193172
966 Ga0207690_10739881
967 Ga0207706_10000318
968 Ga0207706_10003641
969 Ga0207706_10015533
970 Ga0207706_10024002
971 Ga0207706_10044832
972 Ga0207706_10069755
973 Ga0207706_11568395
974 Ga0207686_10092154
975 Ga0207709_10024173
976 Ga0207709_10084838
977 Ga0207709_10114535
978 Ga0207709_11720610
979 Ga0207669_10030929
980 Ga0207669_10431818
981 Ga0207704_10014390
982 Ga0207704_10518342
983 Ga0207691_10000593
984 Ga0207691_10014594
985 Ga0207691_10040728
986 Ga0207691_10472289
987 Ga0207711_10003282
988 Ga0207711_10023568
989 Ga0207711_10115903
990 Ga0207711_10181675
991 Ga0207711_11170575
992 Ga0207711_11496873
993 Ga0207711_11569761
994 Ga0207689_10000016
995 Ga0207689_10009583
996 Ga0207689_11550126
997 Ga0207661_11153060
998 Ga0207679_10070006
999 Ga0207679_10153013
1000 Ga0207679_10440793
1001 Ga0207679_10699420
1002 Ga0207679_11105706
1003 Ga0207679_11868966
1004 Ga0207667_10007726
1005 Ga0207667_10027560
1006 Ga0207667_10114319
1007 Ga0207651_10003207
1008 Ga0207651_10033977
1009 Ga0207651_10036174
1010 Ga0207651_10171270
1011 Ga0207651_10368790
1012 Ga0207651_11126831
1013 Ga0207712_10000146
1014 Ga0207712_11069727
1015 Ga0207668_10006604
1016 Ga0207668_10270889
1017 Ga0207668_10284656
1018 Ga0207668_10862411
1019 Ga0207668_11393153
1020 Ga0207640_10072422
1021 Ga0207640_10297994
1022 Ga0207640_10372263
1023 Ga0207640_10454744
1024 Ga0207640_10576467
1025 Ga0207658_10043559
1026 Ga0207658_10069733
1027 Ga0207658_10103689
1028 Ga0207658_10153728
1029 Ga0207658_11745834
1030 Ga0207658_11983205
1031 Ga0207677_10002823
1032 Ga0207677_12182117
1033 Ga0207703_10007173
1034 Ga0207703_10102414
1035 Ga0207703_11420708
1036 Ga0207639_10038297
1037 Ga0207639_10062910
1038 Ga0207639_10173732
1039 Ga0207639_10233254
1040 Ga0207639_11568243
1041 Ga0207678_10005390
1042 Ga0207678_10310414
1043 Ga0207702_10346398
1044 Ga0207641_10030199
1045 Ga0207641_10121759
1046 Ga0207641_10165383
1047 Ga0207641_10428267
1048 Ga0207641_10545483
1049 Ga0207641_11544480
1050 Ga0207648_10000367
1051 Ga0207648_10028790
1052 Ga0207676_10001572
1053 Ga0207676_10017054
1054 Ga0207676_10411008
1055 Ga0207676_10732067
1056 Ga0207674_10000114
1057 Ga0207674_10005415
1058 Ga0207674_10006480
1059 Ga0207674_10046443
1060 Ga0207674_10103298
1061 Ga0207674_11242574
1062 Ga0207674_11359634
1063 Ga0207675_100143382
1064 Ga0207675_100310878
1065 Ga0207675_101862032
1066 Ga0207675_102499191
1067 Ga0207698_10038715
1068 Ga0207698_10074221
1069 Ga0207698_10260372
1070 Ga0207698_10419074
1071 Ga0207698_11076426
1072 Ga0209999_1030344
1073 Ga0209983_1014085
1074 Ga0209983_1016913
1075 Ga0268266_10002339
1076 Ga0268266_10432711
1077 Ga0268265_10060651
1078 Ga0268265_10068790
1079 Ga0268265_10361917
1080 Ga0268264_10000594
1081 Ga0268264_10025708
1082 Ga0268264_10124170
1083 Ga0268264_10282347
1084 Ga0316177_1155977
1085 Ga0307408_100044684
1086 Ga0307408_100080109
1087 Ga0307408_100100111
1088 Ga0307408_100102432
1089 Ga0307408_100161738
1090 Ga0307408_100542309
1091 Ga0307405_10006360
1092 Ga0307405_10041678
1093 Ga0307405_10047979
1094 Ga0307405_10137146
1095 Ga0307405_10137506
1096 Ga0307405_10205933
1097 Ga0307405_10433786
1098 Ga0307405_10552330
1099 Ga0307413_10066717
1100 Ga0307413_10067637
1101 Ga0307413_10181915
1102 Ga0307413_10407288
1103 Ga0307413_10613139
1104 Ga0307413_12064319
1105 Ga0307410_10014150
1106 Ga0307410_10032966
1107 Ga0307410_10044304
1108 Ga0307410_10654558
1109 Ga0307406_10016038
1110 Ga0307406_10171035
1111 Ga0307406_10719079
1112 Ga0307407_10006564
1113 Ga0307407_10009072
1114 Ga0307407_10113278
1115 Ga0307407_10280913
1116 Ga0307412_10011595
1117 Ga0307412_10014537
1118 Ga0307412_10019000
1119 Ga0307412_10353206
1120 Ga0307412_11155772
1121 Ga0307409_100020197
1122 Ga0307409_100053566
1123 Ga0307409_100333385
1124 Ga0307409_100541479
1125 Ga0307409_100617829
1126 Ga0307409_102290546
1127 Ga0307416_100010392
1128 Ga0307416_100040573
1129 Ga0307416_100527947
1130 Ga0307416_101268781
1131 Ga0307416_101341972
1132 Ga0307416_102198494
1133 Ga0307414_10006609
1134 Ga0307414_10008564
1135 Ga0307414_10415153
1136 Ga0307414_10541464
1137 Ga0307414_10733941
1138 Ga0307414_11012954
1139 Ga0307414_11481485
1140 Ga0307414_11562714
1141 Ga0307411_10006078
1142 Ga0307411_10011441
1143 Ga0307411_10035310
1144 Ga0307411_10052566
1145 Ga0307411_10724950
1146 Ga0307415_100007346
1147 Ga0307415_100011172
1148 Ga0307415_100076596
1149 Ga0307415_100088124
1150 Ga0307415_100611413
1151 Ga0307415_100702549
1152 Ga0373952_0300596
1153 Ga0373960_0377897
1154 Ga0373947_0955444
1155 Ga0395899_0001279
1156 Ga0395899_0015543
1157 Ga0395899_0104888
1158 Ga0395899_0196525
1159 Ga0395899_0772004
1160 Ga0395900_0041973
1161 Ga0395900_0043704
1162 Ga0395900_0124561
1163 Ga0395900_0125141
1164 Ga0395900_0157092
1165 Ga0395900_0167888
1166 Ga0395900_0205134
1167 Ga0395900_0309942
1168 Ga0395900_0364670
1169 Ga0395900_0748435
1170 Ga0395900_0990136
1171 Ga0395900_1664403
1172 Ga0395898_0009735
1173 Ga0395898_0039150
1174 Ga0395898_0121616
1175 Ga0395898_0226440
1176 Ga0395898_0335123
1177 Ga0395898_0612388
1178 Ga0395898_1619231
1179 Ga0395898_1806781
1180 Ga0395898_1951753
1181 Ga0395905_0000259
1182 Ga0395905_0001373
1183 Ga0395905_0009309
1184 Ga0395905_0016153
1185 Ga0395905_0027692
1186 Ga0395905_0032348
1187 Ga0395905_0051884
1188 Ga0395905_0061303
1189 Ga0395905_0107266
1190 Ga0395905_0108523
1191 Ga0395905_0129972
1192 Ga0395905_0254701
1193 Ga0395905_0266554
1194 Ga0395905_0351362
1195 Ga0395905_0815034
1196 Ga0395905_1413110
1197 Ga0395901_0023803
1198 Ga0395901_0059989
1199 Ga0395901_0076453
1200 Ga0395901_0221355
1201 Ga0395901_0261157
1202 Ga0395901_0281738
1203 Ga0395901_0317866
1204 Ga0395901_0328892
1205 Ga0395901_0607757
1206 Ga0395901_0850721
1207 Ga0395901_0948819
1208 Ga0395901_1270550
1209 Ga0439438_053667
1210 Ga0439465_0227536
1211 Ga0439448_0053578
1212 Ga0439432_041480
1213 Ga0439449_0022802
1214 Ga0439452_030855
1215 Ga0439458_0239256
1216 Ga0439464_0083658
1217 Ga0466964_0518024
1218 Ga0495629_0373645
1219 Ga0495621_0138747
1220 Ga0495668_0198935
1221 Ga0495659_0057345
1222 Ga0495669_0042185
1223 Ga0495669_0328509
1224 Ga0495670_0778495
1225 Ga0495686_0000366
1226 Ga0496100_0029472
1227 Ga0496101_0108789
1228 Ga0496102_1109027
1229 Ga0496103_0680488
1230 Ga0496106_0108677
1231 Ga0496106_0498518
1232 Ga0496106_0985290
1233 Ga0496107_0063398
1234 Ga0496107_0188249
1235 Ga0496107_0210794
1236 Ga0496107_0345565
1237 Ga0496108_0185628
1238 Ga0496109_0064762
1239 Ga0496109_0114251
1240 Ga0496109_0297935
1241 Ga0496110_0061986
1242 Ga0496110_0328159
1243 Ga0496110_1191914
1244 Ga0496111_0097006
1245 Ga0496111_1312927
1246 Ga0496112_0034388
1247 Ga0496113_0181127
1248 Ga0496113_0559427
1249 Ga0496114_1545943
1250 Ga0496115_0054231
1251 Ga0495678_223557
1252 Ga0501067_0086698
1253 Ga0501068_0123570
1254 Ga0501069_0222671
1255 Ga0501069_0607625
1256 Ga0501070_0128583
1257 Ga0501073_0370429
1258 Ga0501074_0066260
1259 Ga0501202_131684
1260 Ga0501206_053804
1261 Ga0501223_029706
1262 Ga0501230_141472
1263 Ga0501242_009227
1264 Ga0501250_068953
1265 Ga0501253_095428
1266 Ga0501257_036512
1267 Ga0501225_0097344
1268 Ga0501229_029630
1269 Ga0501079_1291546
1270 Ga0501080_1024337
1271 Ga0501232_098166
1272 Ga0501268_004866
1273 Ga0501270_026822
1274 Ga0501272_001630
1275 Ga0501273_002117
1276 Ga0501282_041446
1277 Ga0501283_106127
1278 nmdc:mga03683_293421_c1
1279 nmdc:mga06r32_57616_c1
1280 Ga0590071_128652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13617

Lipoprotein_19

YnbE-like lipoprotein

41

74

0.99

Map