F471817

General Info

Members Datasets Scaffolds Average Seq Length
641 249 1282 66

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_1317364|Ga0496111_1317364_177_416
Length 79
Sequence MAYVYKPIGGFFFMKNGKVKWFNSEKGFGFIEAEDGNDVFVHYSAIQTEGFKTLEEGQEVSFEVVEGARGPQAANVTKK

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
94 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
95 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
115 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
187 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
188 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
221 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
222 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
223 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
224 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
229 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
237 2738541283 Pedobacter sp. OK701 Isolate Unclassified
238 2738541302 Pedobacter sp. CF074 Isolate Unclassified
239 2739367651 Pedobacter sp. OK291 Isolate Unclassified
240 2739367656 Pedobacter sp. CF523 Isolate Unclassified
241 2739367663 Pedobacter sp. YR510 Isolate Unclassified
242 2818991437 Pedobacter terrae 518 Isolate Unclassified
243 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
244 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
245 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
246 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
247 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
248 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
249 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 67.08
Metatranscriptomes 30.73
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.64
Nodule 0
Rhizoplane 8.11
Rhizosphere 69.27
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_1317364 3300048914 Bacteria 508
2 JGI25152J39213_1000867 3300002773 Bacteria 14936
3 JGI25150J39212_1000008 3300002774 Bacteria 253098
4 JGI25159J45721_1002854 3300002987 Bacteria 6338
5 JGI25159J45721_1010898 3300002987 Bacteria 2271
6 JGI25159J45721_1019285 3300002987 Bacteria 1347
7 JGI25159J45721_1028602 3300002987 Bacteria 929
8 JGI25151J46595_10000009 3300003187 Bacteria 296412
9 JGI25151J46595_10000014 3300003187 Bacteria 253098
10 JGI25151J46595_10000995 3300003187 Bacteria 21425
11 JGI25151J46595_10001946 3300003187 Bacteria 13072
12 JGI25151J46595_10002449 3300003187 Bacteria 11148
13 JGI25151J46595_10005677 3300003187 Bacteria 6414
14 JGI25151J46595_10008092 3300003187 Bacteria 5094
15 JGI25151J46595_10014184 3300003187 Bacteria 3560
16 JGI25151J46595_10017189 3300003187 Bacteria 3143
17 JGI25151J46595_10017353 3300003187 Bacteria 3123
18 JGI25151J46595_10018872 3300003187 Bacteria 2946
19 JGI25151J46595_10023751 3300003187 Bacteria 2519
20 JGI25151J46595_10052039 3300003187 Bacteria 1381
21 JGI25153J46596_10000020 3300003215 Bacteria 252978
22 rootH1_10000468 3300003316 Bacteria 17805
23 rootH1_10002180 3300003316 Bacteria 29373
24 rootL2_10056323 3300003322 Bacteria 23121
25 rootL2_10195243 3300003322 Bacteria 3180
26 Ga0006562J51391_1000133 3300003578 Bacteria 4060
27 Ga0055538_1000384 3300003751 Bacteria 18126
28 Ga0055532_1000088 3300003758 Bacteria 106291
29 Ga0055532_1007874 3300003758 Bacteria 1351
30 Ga0055532_1015471 3300003758 Bacteria 842
31 Ga0055536_1000226 3300003781 Bacteria 45469
32 Ga0055536_1036255 3300003781 Bacteria 1222
33 Ga0055528_1001866 3300003790 Bacteria 11999
34 Ga0055528_1017989 3300003790 Bacteria 2418
35 Ga0055530_10003368 3300003791 Bacteria 9150
36 Ga0055530_10122690 3300003791 Bacteria 502
37 Ga0065165_1095519 3300005262 Bacteria 751
38 Ga0065714_10081440 3300005288 Bacteria 2374
39 Ga0070670_100547616 3300005331 Bacteria 1032
40 Ga0070677_10321272 3300005333 Bacteria 793
41 Ga0070691_11033150 3300005341 Bacteria 514
42 Ga0070669_100187705 3300005353 Bacteria 1620
43 Ga0070669_100916458 3300005353 Bacteria 749
44 Ga0070675_100650047 3300005354 Bacteria 958
45 Ga0070675_101303823 3300005354 Bacteria 669
46 Ga0070671_100573741 3300005355 Bacteria 974
47 Ga0070671_100705786 3300005355 Bacteria 875
48 Ga0070659_100204291 3300005366 Bacteria 1627
49 Ga0070714_100791651 3300005435 Bacteria 918
50 Ga0070708_101104958 3300005445 Bacteria 742
51 Ga0070706_101091224 3300005467 Unclassified 735
52 Ga0068852_100948308 3300005616 Bacteria 878
53 Ga0068864_100754058 3300005618 Bacteria 954
54 Ga0068870_10586543 3300005840 Bacteria 755
55 Ga0068863_101537555 3300005841 Bacteria 674
56 Ga0070715_10265694 3300006163 Bacteria 903
57 Ga0070715_11057505 3300006163 Bacteria 509
58 Ga0075431_100869435 3300006847 Bacteria 872
59 Ga0075431_101090811 3300006847 Bacteria 763
60 Ga0099794_10056940 3300007265 Bacteria 1893
61 Ga0105251_10009354 3300009011 Bacteria 5793
62 Ga0105251_10027444 3300009011 Bacteria 2887
63 Ga0105251_10065266 3300009011 Bacteria 1704
64 Ga0105251_10147559 3300009011 Bacteria 1063
65 Ga0105251_10150055 3300009011 Bacteria 1053
66 Ga0105251_10220100 3300009011 Bacteria 855
67 Ga0105244_10033080 3300009036 Bacteria 2730
68 Ga0105244_10050015 3300009036 Bacteria 2133
69 Ga0105244_10051980 3300009036 Bacteria 2088
70 Ga0105244_10100296 3300009036 Bacteria 1417
71 Ga0105244_10108870 3300009036 Bacteria 1350
72 Ga0105244_10137690 3300009036 Bacteria 1176
73 Ga0105244_10216786 3300009036 Bacteria 899
74 Ga0105244_10506265 3300009036 Bacteria 556
75 Ga0105250_10000972 3300009092 Bacteria 16728
76 Ga0105250_10001672 3300009092 Bacteria 11739
77 Ga0105250_10050740 3300009092 Bacteria 1665
78 Ga0105250_10061743 3300009092 Bacteria 1507
79 Ga0105250_10086969 3300009092 Bacteria 1269
80 Ga0105250_10194057 3300009092 Bacteria 855
81 Ga0105250_10244575 3300009092 Bacteria 765
82 Ga0105250_10315493 3300009092 Bacteria 678
83 Ga0105245_13137182 3300009098 Bacteria 512
84 Ga0105247_10044820 3300009101 Bacteria 2713
85 Ga0114129_11006675 3300009147 Bacteria 1049
86 Ga0114129_12004420 3300009147 Bacteria 700
87 Ga0105243_10022074 3300009148 Bacteria 4836
88 Ga0105243_12781938 3300009148 Bacteria 530
89 Ga0105242_10051280 3300009176 Bacteria 3362
90 Ga0105242_10052645 3300009176 Bacteria 3322
91 Ga0105248_12054350 3300009177 Bacteria 649
92 Ga0105237_10004656 3300009545 Bacteria 15799
93 Ga0105249_10722686 3300009553 Bacteria 1057
94 Ga0105239_10809108 3300010375 Bacteria 1074
95 Ga0105239_11127562 3300010375 Bacteria 903
96 Ga0105246_10000485 3300011119 Bacteria 21476
97 Ga0105246_10089462 3300011119 Bacteria 2215
98 Ga0105246_10107969 3300011119 Bacteria 2039
99 Ga0105246_10281027 3300011119 Bacteria 1335
100 Ga0157371_10003000 3300013102 Bacteria 15675
101 Ga0157370_10000207 3300013104 Bacteria 74451
102 Ga0157370_10018370 3300013104 Bacteria 7033
103 Ga0157370_10019227 3300013104 Bacteria 6860
104 Ga0157370_11289423 3300013104 Bacteria 658
105 Ga0157369_10000071 3300013105 Bacteria 140377
106 Ga0157369_11616035 3300013105 Bacteria 659
107 Ga0157374_10056360 3300013296 Bacteria 3668
108 Ga0157374_10937897 3300013296 Bacteria 884
109 Ga0157378_10022291 3300013297 Bacteria 5575
110 Ga0157378_10241627 3300013297 Bacteria 1725
111 Ga0157372_10681016 3300013307 Bacteria 1197
112 Ga0157372_10877555 3300013307 Bacteria 1041
113 Ga0157375_12821651 3300013308 Bacteria 581
114 Ga0182008_10001007 3300014497 Bacteria 19580
115 Ga0157377_10128646 3300014745 Bacteria 1544
116 Ga0182006_1000218 3300015261 Bacteria 55915
117 Ga0182006_1000332 3300015261 Bacteria 40804
118 Ga0182007_10000006 3300015262 Bacteria 427355
119 Ga0183373_1001 3300015682 Bacteria 1410374
120 Ga0163161_10000309 3300017792 Bacteria 42593
121 Ga0163161_10000394 3300017792 Bacteria 36483
122 Ga0163161_10001366 3300017792 Bacteria 18108
123 Ga0163161_10004577 3300017792 Bacteria 9628
124 Ga0163161_10036311 3300017792 Bacteria 3529
125 Ga0163161_10247121 3300017792 Bacteria 1389
126 Ga0209784_100075 3300025224 Bacteria 139902
127 Ga0209566_100163 3300025225 Bacteria 74229
128 Ga0209566_101967 3300025225 Bacteria 4413
129 Ga0209147_100058 3300025229 Bacteria 252750
130 Ga0209147_100101 3300025229 Bacteria 161976
131 Ga0209147_100804 3300025229 Bacteria 15179
132 Ga0209147_101577 3300025229 Bacteria 7737
133 Ga0209147_101979 3300025229 Bacteria 5982
134 Ga0209147_103674 3300025229 Bacteria 2863
135 Ga0209147_106030 3300025229 Bacteria 1725
136 Ga0209147_107772 3300025229 Bacteria 1374
137 Ga0209437_100453 3300025233 Bacteria 33692
138 Ga0207425_1000007 3300025245 Bacteria 777411
139 Ga0209129_1000006 3300025258 Bacteria 777761
140 Ga0209673_1003112 3300025273 Bacteria 10159
141 Ga0209673_1025919 3300025273 Bacteria 1938
142 Ga0209130_1000339 3300025284 Bacteria 53895
143 Ga0209130_1001601 3300025284 Bacteria 14115
144 Ga0209130_1005233 3300025284 Bacteria 4576
145 Ga0209130_1026007 3300025284 Bacteria 1260
146 Ga0209130_1061687 3300025284 Bacteria 647
147 Ga0209676_1000090 3300025292 Bacteria 256336
148 Ga0209676_1002149 3300025292 Bacteria 14927
149 Ga0209676_1065880 3300025292 Bacteria 880
150 Ga0209025_1000001 3300025294 Bacteria 1888151
151 Ga0209025_1000089 3300025294 Bacteria 254130
152 Ga0209025_1000448 3300025294 Bacteria 80629
153 Ga0209025_1000517 3300025294 Bacteria 73456
154 Ga0209025_1001072 3300025294 Bacteria 39679
155 Ga0209025_1002054 3300025294 Bacteria 22919
156 Ga0209025_1002063 3300025294 Bacteria 22823
157 Ga0209025_1003433 3300025294 Bacteria 15018
158 Ga0209025_1005366 3300025294 Bacteria 10492
159 Ga0209025_1008647 3300025294 Bacteria 7280
160 Ga0209025_1008729 3300025294 Bacteria 7221
161 Ga0209025_1020338 3300025294 Bacteria 3636
162 Ga0209025_1028431 3300025294 Bacteria 2739
163 Ga0209025_1038582 3300025294 Bacteria 2098
164 Ga0209025_1050381 3300025294 Bacteria 1665
165 Ga0209025_1072334 3300025294 Bacteria 1216
166 Ga0209025_1106974 3300025294 Bacteria 869
167 Ga0209025_1109016 3300025294 Bacteria 855
168 Ga0209025_1135416 3300025294 Bacteria 707
169 Ga0209564_1041980 3300025295 Bacteria 1219
170 Ga0209758_1000016 3300025297 Bacteria 778557
171 Ga0209050_1000091 3300025298 Bacteria 253049
172 Ga0209050_1029751 3300025298 Bacteria 1738
173 Ga0207426_1012595 3300025302 Bacteria 3170
174 Ga0207696_1000759 3300025711 Bacteria 21303
175 Ga0207696_1000957 3300025711 Bacteria 17604
176 Ga0207696_1005278 3300025711 Bacteria 5384
177 Ga0207696_1006172 3300025711 Bacteria 4870
178 Ga0207696_1014863 3300025711 Bacteria 2655
179 Ga0207696_1064745 3300025711 Bacteria 1024
180 Ga0207655_1002615 3300025728 Bacteria 14305
181 Ga0207655_1031303 3300025728 Bacteria 2454
182 Ga0207655_1033182 3300025728 Bacteria 2344
183 Ga0207655_1073849 3300025728 Bacteria 1257
184 Ga0207655_1074361 3300025728 Bacteria 1250
185 Ga0207655_1087716 3300025728 Bacteria 1103
186 Ga0207655_1088728 3300025728 Bacteria 1094
187 Ga0207655_1100710 3300025728 Bacteria 996
188 Ga0207713_1002533 3300025735 Bacteria 13221
189 Ga0207713_1021180 3300025735 Bacteria 3123
190 Ga0207713_1028893 3300025735 Bacteria 2493
191 Ga0207713_1103844 3300025735 Bacteria 977
192 Ga0207713_1133394 3300025735 Bacteria 819
193 Ga0207713_1171541 3300025735 Bacteria 684
194 Ga0207713_1257845 3300025735 Bacteria 512
195 Ga0207710_10106730 3300025900 Bacteria 1326
196 Ga0207710_10455497 3300025900 Bacteria 661
197 Ga0207643_10228281 3300025908 Bacteria 1141
198 Ga0207671_10011917 3300025914 Bacteria 7030
199 Ga0207681_10203798 3300025923 Bacteria 1520
200 Ga0207681_10522044 3300025923 Bacteria 975
201 Ga0207681_11318323 3300025923 Bacteria 606
202 Ga0207650_10697353 3300025925 Bacteria 857
203 Ga0207659_10601039 3300025926 Bacteria 938
204 Ga0207690_11122075 3300025932 Bacteria 656
205 Ga0207686_10493300 3300025934 Bacteria 949
206 Ga0207709_10337117 3300025935 Bacteria 1134
207 Ga0207703_11460158 3300026035 Bacteria 658
208 Ga0207676_11449038 3300026095 Bacteria 683
209 Ga0207698_11568204 3300026142 Bacteria 674
210 Ga0209371_1023695 3300027312 Bacteria 1441
211 Ga0265336_10050893 3300028666 Bacteria 1252
212 Ga0237817_10116 3300030083 Bacteria 24644
213 Ga0237817_10185 3300030083 Bacteria 16640
214 Ga0237817_10225 3300030083 Bacteria 14416
215 Ga0268256_1026858 3300030500 Bacteria 1441
216 Ga0316177_1077413 3300030731 Bacteria 11719
217 Ga0316176_1040115 3300030732 Bacteria 64357
218 Ga0314311_1138905 3300030733 Bacteria 1473
219 Ga0316183_1058968 3300030742 Bacteria 25350
220 Ga0316181_1195464 3300030744 Bacteria 10018
221 Ga0316181_1278082 3300030744 Bacteria 956
222 Ga0316182_1070017 3300030745 Bacteria 684
223 Ga0307408_100020895 3300031548 Bacteria 4424
224 Ga0307408_100029296 3300031548 Bacteria 3812
225 Ga0307408_100494431 3300031548 Bacteria 1069
226 Ga0307408_100543009 3300031548 Bacteria 1024
227 Ga0307408_100789827 3300031548 Bacteria 861
228 Ga0307405_10000012 3300031731 Bacteria 233774
229 Ga0307405_11060768 3300031731 Bacteria 694
230 Ga0307405_11961522 3300031731 Bacteria 523
231 Ga0307410_11893244 3300031852 Bacteria 531
232 Ga0307406_11153987 3300031901 Bacteria 671
233 Ga0307407_10000038 3300031903 Bacteria 68710
234 Ga0307407_10964945 3300031903 Bacteria 657
235 Ga0307412_10103523 3300031911 Bacteria 2018
236 Ga0307412_10597100 3300031911 Bacteria 934
237 Ga0307409_100018796 3300031995 Bacteria 4659
238 Ga0307409_100088814 3300031995 Bacteria 2524
239 Ga0307409_100130985 3300031995 Bacteria 2143
240 Ga0307409_101193913 3300031995 Bacteria 784
241 Ga0307409_101413213 3300031995 Bacteria 722
242 Ga0307416_100000007 3300032002 Bacteria 433284
243 Ga0307416_100030544 3300032002 Bacteria 4044
244 Ga0307416_100045485 3300032002 Bacteria 3457
245 Ga0307416_100143998 3300032002 Bacteria 2172
246 Ga0307416_100152940 3300032002 Bacteria 2119
247 Ga0307416_101133367 3300032002 Bacteria 887
248 Ga0307416_101352499 3300032002 Bacteria 818
249 Ga0307414_10202896 3300032004 Bacteria 1614
250 Ga0316593_10178595 3300032168 Bacteria 780
251 Ga0395899_0481788 3300037312 Bacteria 808
252 Ga0395898_0411741 3300037466 Bacteria 1289
253 Ga0395898_0977656 3300037466 Bacteria 783
254 Ga0395898_1379592 3300037466 Bacteria 633
255 Ga0395898_1504428 3300037466 Bacteria 599
256 Ga0395901_0072903 3300038443 Bacteria 3580
257 Ga0395901_1285939 3300038443 Bacteria 694
258 Ga0395901_1669199 3300038443 Bacteria 589
259 Ga0237819_00033 3300038705 Bacteria 47134
260 Ga0237819_00069 3300038705 Bacteria 37429
261 Ga0237819_00222 3300038705 Bacteria 20663
262 Ga0451787_150981 3300041441 Bacteria 522
263 Ga0451789_0488552 3300041443 Bacteria 626
264 Ga0451855_1918519 3300041511 Bacteria 638
265 Ga0451577_0933433 3300042876 Bacteria 781
266 Ga0466972_0301390 3300044658 Bacteria 749
267 Ga0466972_0337291 3300044658 Bacteria 705
268 Ga0466961_0170223 3300044693 Bacteria 1355
269 Ga0453684_0000797 3300044712 Bacteria 107625
270 Ga0453684_0072937 3300044712 Bacteria 4331
271 Ga0453684_0147397 3300044712 Bacteria 2801
272 Ga0453684_0154297 3300044712 Bacteria 2724
273 Ga0466970_0466320 3300044765 Bacteria 725
274 Ga0466959_0577989 3300045049 Bacteria 757
275 Ga0451576_0184301 3300045051 Bacteria 2180
276 Ga0451576_0682827 3300045051 Eukaryota 1079
277 Ga0466967_0000150 3300045976 Bacteria 27396
278 Ga0466967_0085795 3300045976 Bacteria 2851
279 Ga0466967_0323350 3300045976 Bacteria 1488
280 Ga0466967_2423182 3300045976 Bacteria 520
281 Ga0495627_189492 3300046453 Bacteria 568
282 Ga0495603_0022270 3300046455 Bacteria 3837
283 Ga0495603_0252353 3300046455 Bacteria 1015
284 Ga0495580_0919818 3300046472 Unclassified 561
285 Ga0495605_0172769 3300046474 Bacteria 954
286 Ga0495605_0346574 3300046474 Bacteria 623
287 Ga0495584_0165989 3300046491 Bacteria 1122
288 Ga0495584_0187701 3300046491 Bacteria 1050
289 Ga0495585_0033639 3300046492 Bacteria 2901
290 Ga0495585_0052367 3300046492 Bacteria 2260
291 Ga0495594_0626071 3300046499 Bacteria 610
292 Ga0495607_0458796 3300046501 Bacteria 571
293 Ga0495610_0000060 3300046512 Bacteria 131116
294 Ga0495610_0017632 3300046512 Bacteria 4064
295 Ga0495631_0045430 3300046518 Bacteria 1934
296 Ga0495631_0141199 3300046518 Bacteria 1034
297 Ga0495637_0348827 3300046520 Bacteria 519
298 Ga0495609_0114665 3300046538 Bacteria 1161
299 Ga0495597_0252399 3300046542 Bacteria 693
300 Ga0495597_0262800 3300046542 Bacteria 676
301 Ga0495622_0033765 3300046557 Bacteria 2388
302 Ga0495622_0195864 3300046557 Bacteria 902
303 Ga0495622_0268125 3300046557 Bacteria 748
304 Ga0495633_0230786 3300046558 Bacteria 846
305 Ga0495633_0349195 3300046558 Bacteria 670
306 Ga0495668_0703620 3300046616 Bacteria 559
307 Ga0495661_0096745 3300046665 Bacteria 1669
308 Ga0495661_0145126 3300046665 Bacteria 1287
309 Ga0495661_0426606 3300046665 Bacteria 641
310 Ga0495670_0499077 3300046691 Bacteria 661
311 Ga0495670_0765073 3300046691 Bacteria 527
312 Ga0495589_0016929 3300046794 Bacteria 3743
313 Ga0495589_0225896 3300046794 Bacteria 879
314 Ga0495589_0356570 3300046794 Bacteria 673
315 Ga0495676_0223928 3300047321 Bacteria 1295
316 Ga0495676_0288437 3300047321 Bacteria 1109
317 Ga0495683_0016063 3300047323 Bacteria 3888
318 Ga0495683_0066595 3300047323 Bacteria 1774
319 Ga0495681_0204614 3300047470 Bacteria 799
320 Ga0495614_0115636 3300048089 Bacteria 1180
321 Ga0495614_0215910 3300048089 Bacteria 871
322 Ga0495626_0156768 3300048091 Bacteria 957
323 Ga0496100_0000291 3300048903 Bacteria 25201
324 Ga0496100_0002948 3300048903 Bacteria 8754
325 Ga0496101_0023551 3300048904 Bacteria 4255
326 Ga0496101_0263882 3300048904 Bacteria 1343
327 Ga0496101_0560757 3300048904 Bacteria 903
328 Ga0496102_0010426 3300048905 Bacteria 7992
329 Ga0496102_0091916 3300048905 Bacteria 2809
330 Ga0496102_0096109 3300048905 Bacteria 2747
331 Ga0496102_0335245 3300048905 Bacteria 1424
332 Ga0496102_1039593 3300048905 Bacteria 739
333 Ga0496102_1365013 3300048905 Bacteria 628
334 Ga0496103_0007550 3300048906 Bacteria 6479
335 Ga0496103_0021121 3300048906 Bacteria 3916
336 Ga0496103_0272074 3300048906 Bacteria 1090
337 Ga0496103_1044118 3300048906 Bacteria 507
338 Ga0496104_0001238 3300048907 Bacteria 21997
339 Ga0496104_0001710 3300048907 Bacteria 18952
340 Ga0496105_0000655 3300048908 Bacteria 23203
341 Ga0496105_0000827 3300048908 Bacteria 21031
342 Ga0496106_0012848 3300048909 Bacteria 6180
343 Ga0496106_0017084 3300048909 Bacteria 5370
344 Ga0496106_0856241 3300048909 Bacteria 719
345 Ga0496106_1177276 3300048909 Bacteria 598
346 Ga0496106_1185455 3300048909 Bacteria 596
347 Ga0496107_0000296 3300048910 Bacteria 26548
348 Ga0496107_0000352 3300048910 Bacteria 25045
349 Ga0496107_0346649 3300048910 Bacteria 1105
350 Ga0496107_0356117 3300048910 Bacteria 1089
351 Ga0496108_0005976 3300048911 Bacteria 9863
352 Ga0496108_0071598 3300048911 Bacteria 2925
353 Ga0496109_0021753 3300048912 Bacteria 5675
354 Ga0496109_0036427 3300048912 Bacteria 4440
355 Ga0496110_0093518 3300048913 Bacteria 2691
356 Ga0496110_0135677 3300048913 Bacteria 2224
357 Ga0496110_0189345 3300048913 Bacteria 1868
358 Ga0496110_0525592 3300048913 Bacteria 1076
359 Ga0496110_1664651 3300048913 Bacteria 548
360 Ga0496111_0024128 3300048914 Bacteria 4278
361 Ga0496111_0098615 3300048914 Bacteria 2145
362 Ga0496111_0576637 3300048914 Bacteria 825
363 Ga0496112_0002110 3300048915 Bacteria 15779
364 Ga0496112_0106574 3300048915 Bacteria 2772
365 Ga0496112_0204457 3300048915 Bacteria 1933
366 Ga0496113_0028055 3300048916 Bacteria 4044
367 Ga0496113_0049705 3300048916 Bacteria 3123
368 Ga0496114_0669443 3300048917 Bacteria 912
369 Ga0496114_0983038 3300048917 Bacteria 727
370 Ga0496115_0735610 3300048918 Bacteria 773
371 Ga0496115_0874403 3300048918 Bacteria 695
372 Ga0496116_0002717 3300048919 Bacteria 18216
373 Ga0496116_0004309 3300048919 Bacteria 13614
374 Ga0496116_0014479 3300048919 Bacteria 6294
375 Ga0496116_0048312 3300048919 Bacteria 2857
376 Ga0496116_0078423 3300048919 Bacteria 2060
377 Ga0496116_0107289 3300048919 Bacteria 1651
378 Ga0496116_0181560 3300048919 Bacteria 1126
379 Ga0496116_0342219 3300048919 Bacteria 689
380 Ga0496117_0012885 3300048920 Bacteria 7331
381 Ga0496117_0562349 3300048920 Unclassified 541
382 Ga0496118_0070306 3300048921 Bacteria 2528
383 Ga0496118_0085671 3300048921 Bacteria 2193
384 Ga0496119_0007723 3300048922 Bacteria 9613
385 Ga0496119_0047423 3300048922 Bacteria 2673
386 Ga0496120_0012145 3300048923 Bacteria 5875
387 Ga0496120_0254003 3300048923 Bacteria 824
388 Ga0496120_0489252 3300048923 Bacteria 530
389 Ga0496121_0054016 3300048924 Bacteria 3361
390 Ga0496121_0086698 3300048924 Bacteria 2460
391 Ga0496121_0784075 3300048924 Bacteria 562
392 Ga0496122_0000041 3300048925 Bacteria 282392
393 Ga0496122_0001846 3300048925 Bacteria 32295
394 Ga0496122_0003541 3300048925 Bacteria 20419
395 Ga0496122_0005848 3300048925 Bacteria 14445
396 Ga0496122_0114838 3300048925 Bacteria 1755
397 Ga0496122_0125266 3300048925 Bacteria 1646
398 Ga0496122_0141277 3300048925 Bacteria 1506
399 Ga0496122_0315574 3300048925 Bacteria 834
400 Ga0496123_0002062 3300048926 Bacteria 25924
401 Ga0496123_0010099 3300048926 Bacteria 8395
402 Ga0496123_0498646 3300048926 Bacteria 532
403 Ga0496124_0103024 3300048927 Bacteria 2309
404 Ga0496124_0300703 3300048927 Bacteria 1159
405 Ga0496124_0589940 3300048927 Bacteria 725
406 Ga0496124_0693278 3300048927 Bacteria 647
407 Ga0496125_0006817 3300048928 Bacteria 12258
408 Ga0496125_0037225 3300048928 Bacteria 4232
409 Ga0496125_0296042 3300048928 Bacteria 994
410 Ga0496126_0001264 3300048929 Bacteria 40755
411 Ga0496126_0031949 3300048929 Bacteria 4966
412 Ga0496126_0076002 3300048929 Bacteria 2980
413 Ga0496126_1122022 3300048929 Bacteria 583
414 Ga0501306_022650 3300049127 Bacteria 887
415 Ga0501306_029234 3300049127 Bacteria 811
416 Ga0501306_066841 3300049127 Bacteria 601
417 Ga0501306_091474 3300049127 Bacteria 535
418 Ga0501308_018014 3300049128 Bacteria 860
419 Ga0501308_041116 3300049128 Bacteria 651
420 Ga0501308_045061 3300049128 Bacteria 631
421 Ga0501308_074506 3300049128 Bacteria 532
422 Ga0501309_051234 3300049129 Bacteria 649
423 Ga0501309_060125 3300049129 Bacteria 610
424 Ga0501309_068602 3300049129 Bacteria 580
425 Ga0501309_088196 3300049129 Bacteria 527
426 Ga0501310_028539 3300049130 Bacteria 732
427 Ga0501310_039124 3300049130 Bacteria 655
428 Ga0501310_042666 3300049130 Bacteria 636
429 Ga0501310_044026 3300049130 Bacteria 629
430 Ga0501341_02594 3300049131 Bacteria 985
431 Ga0501341_07426 3300049131 Bacteria 686
432 Ga0501341_08197 3300049131 Bacteria 664
433 Ga0501341_13250 3300049131 Bacteria 565
434 Ga0501341_14847 3300049131 Bacteria 543
435 Ga0501343_004310 3300049132 Bacteria 1067
436 Ga0501343_012692 3300049132 Bacteria 702
437 Ga0501343_013953 3300049132 Bacteria 676
438 Ga0501343_020553 3300049132 Bacteria 582
439 Ga0501343_022700 3300049132 Bacteria 559
440 Ga0501343_024544 3300049132 Bacteria 542
441 Ga0501344_01950 3300049133 Bacteria 1036
442 Ga0501344_03700 3300049133 Bacteria 821
443 Ga0501344_07041 3300049133 Bacteria 657
444 Ga0501344_10959 3300049133 Bacteria 559
445 Ga0501345_01406 3300049134 Bacteria 922
446 Ga0501345_03833 3300049134 Bacteria 660
447 Ga0501304_014418 3300049160 Bacteria 732
448 Ga0501304_017582 3300049160 Bacteria 685
449 Ga0501304_021743 3300049160 Bacteria 640
450 Ga0501305_001129 3300049161 Bacteria 2511
451 Ga0501305_001192 3300049161 Bacteria 2475
452 Ga0501305_012428 3300049161 Bacteria 1164
453 Ga0501305_016385 3300049161 Bacteria 1056
454 Ga0501305_030730 3300049161 Bacteria 836
455 Ga0501305_045837 3300049161 Bacteria 723
456 Ga0501305_081101 3300049161 Bacteria 583
457 Ga0501305_117485 3300049161 Bacteria 508
458 Ga0501307_027013 3300049162 Bacteria 779
459 Ga0501307_029146 3300049162 Bacteria 758
460 Ga0501307_041820 3300049162 Bacteria 668
461 Ga0501342_02295 3300049163 Bacteria 644
462 Ga0501342_04017 3300049163 Bacteria 533
463 Ga0501290_037886 3300049513 Bacteria 713
464 Ga0501300_057544 3300049523 Bacteria 610
465 Ga0501311_003131 3300049527 Bacteria 1659
466 Ga0501311_018971 3300049527 Bacteria 918
467 Ga0501311_034666 3300049527 Bacteria 744
468 Ga0501311_055595 3300049527 Bacteria 629
469 Ga0501311_072220 3300049527 Bacteria 575
470 Ga0501311_073773 3300049527 Bacteria 570
471 Ga0501312_001813 3300049528 Bacteria 2194
472 Ga0501312_004756 3300049528 Bacteria 1616
473 Ga0501312_012147 3300049528 Bacteria 1181
474 Ga0501312_015380 3300049528 Bacteria 1085
475 Ga0501312_030417 3300049528 Bacteria 845
476 Ga0501312_041840 3300049528 Bacteria 751
477 Ga0501312_053845 3300049528 Bacteria 684
478 Ga0501313_014762 3300049529 Bacteria 927
479 Ga0501313_028022 3300049529 Bacteria 721
480 Ga0501313_028189 3300049529 Bacteria 719
481 Ga0501313_030745 3300049529 Bacteria 696
482 Ga0501313_062458 3300049529 Bacteria 529
483 Ga0501314_008322 3300049530 Bacteria 936
484 Ga0501314_024388 3300049530 Bacteria 645
485 Ga0501314_024600 3300049530 Bacteria 643
486 Ga0501314_046228 3300049530 Bacteria 518
487 Ga0501315_014823 3300049531 Bacteria 992
488 Ga0501315_027490 3300049531 Bacteria 803
489 Ga0501315_041586 3300049531 Bacteria 697
490 Ga0501315_042763 3300049531 Bacteria 690
491 Ga0501315_050881 3300049531 Bacteria 650
492 Ga0501315_084435 3300049531 Bacteria 543
493 Ga0501315_098125 3300049531 Bacteria 515
494 Ga0501316_004985 3300049532 Bacteria 1358
495 Ga0501316_031056 3300049532 Bacteria 715
496 Ga0501316_035900 3300049532 Bacteria 678
497 Ga0501316_079642 3300049532 Bacteria 506
498 Ga0501317_016328 3300049533 Bacteria 962
499 Ga0501317_027870 3300049533 Bacteria 804
500 Ga0501317_028186 3300049533 Bacteria 801
501 Ga0501317_045467 3300049533 Bacteria 683
502 Ga0501317_045531 3300049533 Bacteria 683
503 Ga0501317_046651 3300049533 Bacteria 677
504 Ga0501317_056789 3300049533 Bacteria 634
505 Ga0501317_100163 3300049533 Bacteria 522
506 Ga0501317_101264 3300049533 Bacteria 520
507 Ga0501318_008895 3300049534 Bacteria 1084
508 Ga0501318_023834 3300049534 Bacteria 793
509 Ga0501318_037387 3300049534 Bacteria 682
510 Ga0501319_006303 3300049535 Bacteria 872
511 Ga0501319_013869 3300049535 Bacteria 672
512 Ga0501319_033359 3300049535 Bacteria 502
513 Ga0501320_003370 3300049536 Bacteria 1351
514 Ga0501320_028390 3300049536 Bacteria 685
515 Ga0501320_028950 3300049536 Bacteria 680
516 Ga0501320_035660 3300049536 Bacteria 635
517 Ga0501321_001115 3300049537 Bacteria 2041
518 Ga0501321_028899 3300049537 Bacteria 731
519 Ga0501321_034372 3300049537 Bacteria 690
520 Ga0501321_074175 3300049537 Bacteria 534
521 Ga0501321_080451 3300049537 Bacteria 519
522 Ga0501322_010136 3300049538 Bacteria 722
523 Ga0501322_014565 3300049538 Bacteria 643
524 Ga0501322_015011 3300049538 Bacteria 637
525 Ga0501322_022371 3300049538 Bacteria 562
526 Ga0501323_004873 3300049539 Bacteria 1441
527 Ga0501323_008799 3300049539 Bacteria 1179
528 Ga0501323_016580 3300049539 Bacteria 940
529 Ga0501323_024182 3300049539 Bacteria 820
530 Ga0501323_040249 3300049539 Bacteria 683
531 Ga0501323_051709 3300049539 Bacteria 625
532 Ga0501324_006366 3300049540 Bacteria 993
533 Ga0501324_012194 3300049540 Bacteria 802
534 Ga0501324_020623 3300049540 Bacteria 672
535 Ga0501324_034340 3300049540 Bacteria 563
536 Ga0501325_004678 3300049541 Bacteria 1059
537 Ga0501325_025440 3300049541 Bacteria 650
538 Ga0501325_045804 3300049541 Bacteria 544
539 Ga0501326_02415 3300049542 Bacteria 918
540 Ga0501326_05121 3300049542 Bacteria 708
541 Ga0501326_09218 3300049542 Bacteria 581
542 Ga0501326_12175 3300049542 Bacteria 528
543 Ga0501327_00525 3300049543 Bacteria 1569
544 Ga0501327_04273 3300049543 Bacteria 814
545 Ga0501327_04558 3300049543 Bacteria 797
546 Ga0501327_08558 3300049543 Bacteria 652
547 Ga0501327_10501 3300049543 Bacteria 611
548 Ga0501327_14431 3300049543 Bacteria 552
549 Ga0501328_03259 3300049544 Bacteria 746
550 Ga0501328_04710 3300049544 Bacteria 669
551 Ga0501328_10646 3300049544 Bacteria 522
552 Ga0501329_00588 3300049545 Bacteria 1342
553 Ga0501329_08450 3300049545 Bacteria 618
554 Ga0501329_09124 3300049545 Bacteria 605
555 Ga0501329_11035 3300049545 Bacteria 572
556 Ga0501330_000757 3300049546 Bacteria 1503
557 Ga0501330_003240 3300049546 Bacteria 961
558 Ga0501330_004880 3300049546 Bacteria 841
559 Ga0501330_012793 3300049546 Bacteria 618
560 Ga0501330_016818 3300049546 Bacteria 564
561 Ga0501330_020977 3300049546 Bacteria 525
562 Ga0501331_04063 3300049547 Bacteria 807
563 Ga0501331_05972 3300049547 Bacteria 704
564 Ga0501331_10700 3300049547 Bacteria 574
565 Ga0501332_02033 3300049548 Bacteria 1109
566 Ga0501332_07927 3300049548 Bacteria 684
567 Ga0501333_007860 3300049549 Bacteria 727
568 Ga0501333_009428 3300049549 Bacteria 685
569 Ga0501333_009531 3300049549 Bacteria 683
570 Ga0501333_009940 3300049549 Bacteria 672
571 Ga0501333_019556 3300049549 Bacteria 534
572 Ga0501333_019589 3300049549 Bacteria 534
573 Ga0501333_021003 3300049549 Bacteria 521
574 Ga0501334_02380 3300049550 Bacteria 1113
575 Ga0501334_06149 3300049550 Bacteria 805
576 Ga0501334_07415 3300049550 Bacteria 755
577 Ga0501334_10261 3300049550 Bacteria 675
578 Ga0501334_11215 3300049550 Bacteria 655
579 Ga0501334_11544 3300049550 Bacteria 648
580 Ga0501334_17855 3300049550 Bacteria 556
581 Ga0501335_005475 3300049551 Bacteria 1134
582 Ga0501335_007703 3300049551 Bacteria 1000
583 Ga0501335_024288 3300049551 Bacteria 660
584 Ga0501335_034936 3300049551 Bacteria 579
585 Ga0501335_036214 3300049551 Bacteria 571
586 Ga0501335_040272 3300049551 Bacteria 549
587 Ga0501335_041362 3300049551 Bacteria 544
588 Ga0501335_045404 3300049551 Bacteria 526
589 Ga0501336_014187 3300049552 Bacteria 672
590 Ga0501336_020839 3300049552 Bacteria 596
591 Ga0501336_023431 3300049552 Bacteria 574
592 Ga0501337_007801 3300049553 Bacteria 751
593 Ga0501337_008453 3300049553 Bacteria 731
594 Ga0501337_009701 3300049553 Bacteria 694
595 Ga0501337_012083 3300049553 Bacteria 643
596 Ga0501337_015044 3300049553 Bacteria 595
597 Ga0501338_02460 3300049554 Bacteria 1056
598 Ga0501338_04009 3300049554 Bacteria 884
599 Ga0501338_05148 3300049554 Bacteria 806
600 Ga0501338_07580 3300049554 Bacteria 702
601 Ga0501338_08308 3300049554 Bacteria 679
602 Ga0501338_14627 3300049554 Bacteria 554
603 Ga0501338_18970 3300049554 Bacteria 506
604 Ga0501340_003564 3300049556 Bacteria 950
605 Ga0501340_007562 3300049556 Bacteria 751
606 Ga0501340_011652 3300049556 Bacteria 658
607 Ga0501340_023682 3300049556 Bacteria 528
608 Ga0501041_0346837 3300049577 Bacteria 938
609 Ga0501071_1482414 3300049587 Bacteria 524
610 Ga0501072_1466400 3300049588 Bacteria 527
611 Ga0501208_090222 3300049655 Bacteria 643
612 Ga0501217_113167 3300049661 Bacteria 781
613 Ga0501227_249114 3300049665 Bacteria 506
614 Ga0501243_119493 3300049675 Bacteria 545
615 Ga0501252_062523 3300049682 Bacteria 585
616 Ga0501234_046557 3300049707 Bacteria 717
617 Ga0501245_100362 3300049708 Bacteria 586
618 Ga0501245_146298 3300049708 Bacteria 518
619 Ga0501079_0745701 3300049741 Bacteria 771
620 Ga0501278_012389 3300049774 Bacteria 703
621 Ga0501212_021103 3300049851 Bacteria 1008
622 nmdc:mga0qj67_1496047_c1 3300050509 Bacteria 519
623 Ga0500634_0320466 3300053161 Bacteria 605
624 Ga0500645_167784 3300053730 Bacteria 600
625 Ga0587070_135606 3300059491 Bacteria 603
626 Ga0587067_084987 3300059640 Bacteria 707
627 Ga0587072_154891 3300059643 Bacteria 556
628 2586208596 2585427687 Bacteria 5544917
629 2738757182 2738541283 Bacteria 7222293
630 2738853001 2738541302 Bacteria 5944758
631 2739586371 2739367651 Bacteria 6359826
632 2739617756 2739367656 Bacteria 5152243
633 2739644860 2739367663 Bacteria 5040914
634 2819549123 2818991437 Bacteria 5805520
635 2842725627 2842722452 Bacteria 6263924
636 2842903889 2842903701 Bacteria 6986368
637 2842914443 2842909656 Bacteria 6185908
638 2849283015 2849281842 Bacteria 6065644
639 2946001146 2945997725 Bacteria 6404843
640 2954018046 2954016120 Bacteria 6446024
641 2971416569 2971410472 Bacteria 8311090
642 Ga0496111_1317364
643 JGI25152J39213_1000867
644 JGI25150J39212_1000008
645 JGI25159J45721_1002854
646 JGI25159J45721_1010898
647 JGI25159J45721_1019285
648 JGI25159J45721_1028602
649 JGI25151J46595_10000009
650 JGI25151J46595_10000014
651 JGI25151J46595_10000995
652 JGI25151J46595_10001946
653 JGI25151J46595_10002449
654 JGI25151J46595_10005677
655 JGI25151J46595_10008092
656 JGI25151J46595_10014184
657 JGI25151J46595_10017189
658 JGI25151J46595_10017353
659 JGI25151J46595_10018872
660 JGI25151J46595_10023751
661 JGI25151J46595_10052039
662 JGI25153J46596_10000020
663 rootH1_10000468
664 rootH1_10002180
665 rootL2_10056323
666 rootL2_10195243
667 Ga0006562J51391_1000133
668 Ga0055538_1000384
669 Ga0055532_1000088
670 Ga0055532_1007874
671 Ga0055532_1015471
672 Ga0055536_1000226
673 Ga0055536_1036255
674 Ga0055528_1001866
675 Ga0055528_1017989
676 Ga0055530_10003368
677 Ga0055530_10122690
678 Ga0065165_1095519
679 Ga0065714_10081440
680 Ga0070670_100547616
681 Ga0070677_10321272
682 Ga0070691_11033150
683 Ga0070669_100187705
684 Ga0070669_100916458
685 Ga0070675_100650047
686 Ga0070675_101303823
687 Ga0070671_100573741
688 Ga0070671_100705786
689 Ga0070659_100204291
690 Ga0070714_100791651
691 Ga0070708_101104958
692 Ga0070706_101091224
693 Ga0068852_100948308
694 Ga0068864_100754058
695 Ga0068870_10586543
696 Ga0068863_101537555
697 Ga0070715_10265694
698 Ga0070715_11057505
699 Ga0075431_100869435
700 Ga0075431_101090811
701 Ga0099794_10056940
702 Ga0105251_10009354
703 Ga0105251_10027444
704 Ga0105251_10065266
705 Ga0105251_10147559
706 Ga0105251_10150055
707 Ga0105251_10220100
708 Ga0105244_10033080
709 Ga0105244_10050015
710 Ga0105244_10051980
711 Ga0105244_10100296
712 Ga0105244_10108870
713 Ga0105244_10137690
714 Ga0105244_10216786
715 Ga0105244_10506265
716 Ga0105250_10000972
717 Ga0105250_10001672
718 Ga0105250_10050740
719 Ga0105250_10061743
720 Ga0105250_10086969
721 Ga0105250_10194057
722 Ga0105250_10244575
723 Ga0105250_10315493
724 Ga0105245_13137182
725 Ga0105247_10044820
726 Ga0114129_11006675
727 Ga0114129_12004420
728 Ga0105243_10022074
729 Ga0105243_12781938
730 Ga0105242_10051280
731 Ga0105242_10052645
732 Ga0105248_12054350
733 Ga0105237_10004656
734 Ga0105249_10722686
735 Ga0105239_10809108
736 Ga0105239_11127562
737 Ga0105246_10000485
738 Ga0105246_10089462
739 Ga0105246_10107969
740 Ga0105246_10281027
741 Ga0157371_10003000
742 Ga0157370_10000207
743 Ga0157370_10018370
744 Ga0157370_10019227
745 Ga0157370_11289423
746 Ga0157369_10000071
747 Ga0157369_11616035
748 Ga0157374_10056360
749 Ga0157374_10937897
750 Ga0157378_10022291
751 Ga0157378_10241627
752 Ga0157372_10681016
753 Ga0157372_10877555
754 Ga0157375_12821651
755 Ga0182008_10001007
756 Ga0157377_10128646
757 Ga0182006_1000218
758 Ga0182006_1000332
759 Ga0182007_10000006
760 Ga0183373_1001
761 Ga0163161_10000309
762 Ga0163161_10000394
763 Ga0163161_10001366
764 Ga0163161_10004577
765 Ga0163161_10036311
766 Ga0163161_10247121
767 Ga0209784_100075
768 Ga0209566_100163
769 Ga0209566_101967
770 Ga0209147_100058
771 Ga0209147_100101
772 Ga0209147_100804
773 Ga0209147_101577
774 Ga0209147_101979
775 Ga0209147_103674
776 Ga0209147_106030
777 Ga0209147_107772
778 Ga0209437_100453
779 Ga0207425_1000007
780 Ga0209129_1000006
781 Ga0209673_1003112
782 Ga0209673_1025919
783 Ga0209130_1000339
784 Ga0209130_1001601
785 Ga0209130_1005233
786 Ga0209130_1026007
787 Ga0209130_1061687
788 Ga0209676_1000090
789 Ga0209676_1002149
790 Ga0209676_1065880
791 Ga0209025_1000001
792 Ga0209025_1000089
793 Ga0209025_1000448
794 Ga0209025_1000517
795 Ga0209025_1001072
796 Ga0209025_1002054
797 Ga0209025_1002063
798 Ga0209025_1003433
799 Ga0209025_1005366
800 Ga0209025_1008647
801 Ga0209025_1008729
802 Ga0209025_1020338
803 Ga0209025_1028431
804 Ga0209025_1038582
805 Ga0209025_1050381
806 Ga0209025_1072334
807 Ga0209025_1106974
808 Ga0209025_1109016
809 Ga0209025_1135416
810 Ga0209564_1041980
811 Ga0209758_1000016
812 Ga0209050_1000091
813 Ga0209050_1029751
814 Ga0207426_1012595
815 Ga0207696_1000759
816 Ga0207696_1000957
817 Ga0207696_1005278
818 Ga0207696_1006172
819 Ga0207696_1014863
820 Ga0207696_1064745
821 Ga0207655_1002615
822 Ga0207655_1031303
823 Ga0207655_1033182
824 Ga0207655_1073849
825 Ga0207655_1074361
826 Ga0207655_1087716
827 Ga0207655_1088728
828 Ga0207655_1100710
829 Ga0207713_1002533
830 Ga0207713_1021180
831 Ga0207713_1028893
832 Ga0207713_1103844
833 Ga0207713_1133394
834 Ga0207713_1171541
835 Ga0207713_1257845
836 Ga0207710_10106730
837 Ga0207710_10455497
838 Ga0207643_10228281
839 Ga0207671_10011917
840 Ga0207681_10203798
841 Ga0207681_10522044
842 Ga0207681_11318323
843 Ga0207650_10697353
844 Ga0207659_10601039
845 Ga0207690_11122075
846 Ga0207686_10493300
847 Ga0207709_10337117
848 Ga0207703_11460158
849 Ga0207676_11449038
850 Ga0207698_11568204
851 Ga0209371_1023695
852 Ga0265336_10050893
853 Ga0237817_10116
854 Ga0237817_10185
855 Ga0237817_10225
856 Ga0268256_1026858
857 Ga0316177_1077413
858 Ga0316176_1040115
859 Ga0314311_1138905
860 Ga0316183_1058968
861 Ga0316181_1195464
862 Ga0316181_1278082
863 Ga0316182_1070017
864 Ga0307408_100020895
865 Ga0307408_100029296
866 Ga0307408_100494431
867 Ga0307408_100543009
868 Ga0307408_100789827
869 Ga0307405_10000012
870 Ga0307405_11060768
871 Ga0307405_11961522
872 Ga0307410_11893244
873 Ga0307406_11153987
874 Ga0307407_10000038
875 Ga0307407_10964945
876 Ga0307412_10103523
877 Ga0307412_10597100
878 Ga0307409_100018796
879 Ga0307409_100088814
880 Ga0307409_100130985
881 Ga0307409_101193913
882 Ga0307409_101413213
883 Ga0307416_100000007
884 Ga0307416_100030544
885 Ga0307416_100045485
886 Ga0307416_100143998
887 Ga0307416_100152940
888 Ga0307416_101133367
889 Ga0307416_101352499
890 Ga0307414_10202896
891 Ga0316593_10178595
892 Ga0395899_0481788
893 Ga0395898_0411741
894 Ga0395898_0977656
895 Ga0395898_1379592
896 Ga0395898_1504428
897 Ga0395901_0072903
898 Ga0395901_1285939
899 Ga0395901_1669199
900 Ga0237819_00033
901 Ga0237819_00069
902 Ga0237819_00222
903 Ga0451787_150981
904 Ga0451789_0488552
905 Ga0451855_1918519
906 Ga0451577_0933433
907 Ga0466972_0301390
908 Ga0466972_0337291
909 Ga0466961_0170223
910 Ga0453684_0000797
911 Ga0453684_0072937
912 Ga0453684_0147397
913 Ga0453684_0154297
914 Ga0466970_0466320
915 Ga0466959_0577989
916 Ga0451576_0184301
917 Ga0451576_0682827
918 Ga0466967_0000150
919 Ga0466967_0085795
920 Ga0466967_0323350
921 Ga0466967_2423182
922 Ga0495627_189492
923 Ga0495603_0022270
924 Ga0495603_0252353
925 Ga0495580_0919818
926 Ga0495605_0172769
927 Ga0495605_0346574
928 Ga0495584_0165989
929 Ga0495584_0187701
930 Ga0495585_0033639
931 Ga0495585_0052367
932 Ga0495594_0626071
933 Ga0495607_0458796
934 Ga0495610_0000060
935 Ga0495610_0017632
936 Ga0495631_0045430
937 Ga0495631_0141199
938 Ga0495637_0348827
939 Ga0495609_0114665
940 Ga0495597_0252399
941 Ga0495597_0262800
942 Ga0495622_0033765
943 Ga0495622_0195864
944 Ga0495622_0268125
945 Ga0495633_0230786
946 Ga0495633_0349195
947 Ga0495668_0703620
948 Ga0495661_0096745
949 Ga0495661_0145126
950 Ga0495661_0426606
951 Ga0495670_0499077
952 Ga0495670_0765073
953 Ga0495589_0016929
954 Ga0495589_0225896
955 Ga0495589_0356570
956 Ga0495676_0223928
957 Ga0495676_0288437
958 Ga0495683_0016063
959 Ga0495683_0066595
960 Ga0495681_0204614
961 Ga0495614_0115636
962 Ga0495614_0215910
963 Ga0495626_0156768
964 Ga0496100_0000291
965 Ga0496100_0002948
966 Ga0496101_0023551
967 Ga0496101_0263882
968 Ga0496101_0560757
969 Ga0496102_0010426
970 Ga0496102_0091916
971 Ga0496102_0096109
972 Ga0496102_0335245
973 Ga0496102_1039593
974 Ga0496102_1365013
975 Ga0496103_0007550
976 Ga0496103_0021121
977 Ga0496103_0272074
978 Ga0496103_1044118
979 Ga0496104_0001238
980 Ga0496104_0001710
981 Ga0496105_0000655
982 Ga0496105_0000827
983 Ga0496106_0012848
984 Ga0496106_0017084
985 Ga0496106_0856241
986 Ga0496106_1177276
987 Ga0496106_1185455
988 Ga0496107_0000296
989 Ga0496107_0000352
990 Ga0496107_0346649
991 Ga0496107_0356117
992 Ga0496108_0005976
993 Ga0496108_0071598
994 Ga0496109_0021753
995 Ga0496109_0036427
996 Ga0496110_0093518
997 Ga0496110_0135677
998 Ga0496110_0189345
999 Ga0496110_0525592
1000 Ga0496110_1664651
1001 Ga0496111_0024128
1002 Ga0496111_0098615
1003 Ga0496111_0576637
1004 Ga0496112_0002110
1005 Ga0496112_0106574
1006 Ga0496112_0204457
1007 Ga0496113_0028055
1008 Ga0496113_0049705
1009 Ga0496114_0669443
1010 Ga0496114_0983038
1011 Ga0496115_0735610
1012 Ga0496115_0874403
1013 Ga0496116_0002717
1014 Ga0496116_0004309
1015 Ga0496116_0014479
1016 Ga0496116_0048312
1017 Ga0496116_0078423
1018 Ga0496116_0107289
1019 Ga0496116_0181560
1020 Ga0496116_0342219
1021 Ga0496117_0012885
1022 Ga0496117_0562349
1023 Ga0496118_0070306
1024 Ga0496118_0085671
1025 Ga0496119_0007723
1026 Ga0496119_0047423
1027 Ga0496120_0012145
1028 Ga0496120_0254003
1029 Ga0496120_0489252
1030 Ga0496121_0054016
1031 Ga0496121_0086698
1032 Ga0496121_0784075
1033 Ga0496122_0000041
1034 Ga0496122_0001846
1035 Ga0496122_0003541
1036 Ga0496122_0005848
1037 Ga0496122_0114838
1038 Ga0496122_0125266
1039 Ga0496122_0141277
1040 Ga0496122_0315574
1041 Ga0496123_0002062
1042 Ga0496123_0010099
1043 Ga0496123_0498646
1044 Ga0496124_0103024
1045 Ga0496124_0300703
1046 Ga0496124_0589940
1047 Ga0496124_0693278
1048 Ga0496125_0006817
1049 Ga0496125_0037225
1050 Ga0496125_0296042
1051 Ga0496126_0001264
1052 Ga0496126_0031949
1053 Ga0496126_0076002
1054 Ga0496126_1122022
1055 Ga0501306_022650
1056 Ga0501306_029234
1057 Ga0501306_066841
1058 Ga0501306_091474
1059 Ga0501308_018014
1060 Ga0501308_041116
1061 Ga0501308_045061
1062 Ga0501308_074506
1063 Ga0501309_051234
1064 Ga0501309_060125
1065 Ga0501309_068602
1066 Ga0501309_088196
1067 Ga0501310_028539
1068 Ga0501310_039124
1069 Ga0501310_042666
1070 Ga0501310_044026
1071 Ga0501341_02594
1072 Ga0501341_07426
1073 Ga0501341_08197
1074 Ga0501341_13250
1075 Ga0501341_14847
1076 Ga0501343_004310
1077 Ga0501343_012692
1078 Ga0501343_013953
1079 Ga0501343_020553
1080 Ga0501343_022700
1081 Ga0501343_024544
1082 Ga0501344_01950
1083 Ga0501344_03700
1084 Ga0501344_07041
1085 Ga0501344_10959
1086 Ga0501345_01406
1087 Ga0501345_03833
1088 Ga0501304_014418
1089 Ga0501304_017582
1090 Ga0501304_021743
1091 Ga0501305_001129
1092 Ga0501305_001192
1093 Ga0501305_012428
1094 Ga0501305_016385
1095 Ga0501305_030730
1096 Ga0501305_045837
1097 Ga0501305_081101
1098 Ga0501305_117485
1099 Ga0501307_027013
1100 Ga0501307_029146
1101 Ga0501307_041820
1102 Ga0501342_02295
1103 Ga0501342_04017
1104 Ga0501290_037886
1105 Ga0501300_057544
1106 Ga0501311_003131
1107 Ga0501311_018971
1108 Ga0501311_034666
1109 Ga0501311_055595
1110 Ga0501311_072220
1111 Ga0501311_073773
1112 Ga0501312_001813
1113 Ga0501312_004756
1114 Ga0501312_012147
1115 Ga0501312_015380
1116 Ga0501312_030417
1117 Ga0501312_041840
1118 Ga0501312_053845
1119 Ga0501313_014762
1120 Ga0501313_028022
1121 Ga0501313_028189
1122 Ga0501313_030745
1123 Ga0501313_062458
1124 Ga0501314_008322
1125 Ga0501314_024388
1126 Ga0501314_024600
1127 Ga0501314_046228
1128 Ga0501315_014823
1129 Ga0501315_027490
1130 Ga0501315_041586
1131 Ga0501315_042763
1132 Ga0501315_050881
1133 Ga0501315_084435
1134 Ga0501315_098125
1135 Ga0501316_004985
1136 Ga0501316_031056
1137 Ga0501316_035900
1138 Ga0501316_079642
1139 Ga0501317_016328
1140 Ga0501317_027870
1141 Ga0501317_028186
1142 Ga0501317_045467
1143 Ga0501317_045531
1144 Ga0501317_046651
1145 Ga0501317_056789
1146 Ga0501317_100163
1147 Ga0501317_101264
1148 Ga0501318_008895
1149 Ga0501318_023834
1150 Ga0501318_037387
1151 Ga0501319_006303
1152 Ga0501319_013869
1153 Ga0501319_033359
1154 Ga0501320_003370
1155 Ga0501320_028390
1156 Ga0501320_028950
1157 Ga0501320_035660
1158 Ga0501321_001115
1159 Ga0501321_028899
1160 Ga0501321_034372
1161 Ga0501321_074175
1162 Ga0501321_080451
1163 Ga0501322_010136
1164 Ga0501322_014565
1165 Ga0501322_015011
1166 Ga0501322_022371
1167 Ga0501323_004873
1168 Ga0501323_008799
1169 Ga0501323_016580
1170 Ga0501323_024182
1171 Ga0501323_040249
1172 Ga0501323_051709
1173 Ga0501324_006366
1174 Ga0501324_012194
1175 Ga0501324_020623
1176 Ga0501324_034340
1177 Ga0501325_004678
1178 Ga0501325_025440
1179 Ga0501325_045804
1180 Ga0501326_02415
1181 Ga0501326_05121
1182 Ga0501326_09218
1183 Ga0501326_12175
1184 Ga0501327_00525
1185 Ga0501327_04273
1186 Ga0501327_04558
1187 Ga0501327_08558
1188 Ga0501327_10501
1189 Ga0501327_14431
1190 Ga0501328_03259
1191 Ga0501328_04710
1192 Ga0501328_10646
1193 Ga0501329_00588
1194 Ga0501329_08450
1195 Ga0501329_09124
1196 Ga0501329_11035
1197 Ga0501330_000757
1198 Ga0501330_003240
1199 Ga0501330_004880
1200 Ga0501330_012793
1201 Ga0501330_016818
1202 Ga0501330_020977
1203 Ga0501331_04063
1204 Ga0501331_05972
1205 Ga0501331_10700
1206 Ga0501332_02033
1207 Ga0501332_07927
1208 Ga0501333_007860
1209 Ga0501333_009428
1210 Ga0501333_009531
1211 Ga0501333_009940
1212 Ga0501333_019556
1213 Ga0501333_019589
1214 Ga0501333_021003
1215 Ga0501334_02380
1216 Ga0501334_06149
1217 Ga0501334_07415
1218 Ga0501334_10261
1219 Ga0501334_11215
1220 Ga0501334_11544
1221 Ga0501334_17855
1222 Ga0501335_005475
1223 Ga0501335_007703
1224 Ga0501335_024288
1225 Ga0501335_034936
1226 Ga0501335_036214
1227 Ga0501335_040272
1228 Ga0501335_041362
1229 Ga0501335_045404
1230 Ga0501336_014187
1231 Ga0501336_020839
1232 Ga0501336_023431
1233 Ga0501337_007801
1234 Ga0501337_008453
1235 Ga0501337_009701
1236 Ga0501337_012083
1237 Ga0501337_015044
1238 Ga0501338_02460
1239 Ga0501338_04009
1240 Ga0501338_05148
1241 Ga0501338_07580
1242 Ga0501338_08308
1243 Ga0501338_14627
1244 Ga0501338_18970
1245 Ga0501340_003564
1246 Ga0501340_007562
1247 Ga0501340_011652
1248 Ga0501340_023682
1249 Ga0501041_0346837
1250 Ga0501071_1482414
1251 Ga0501072_1466400
1252 Ga0501208_090222
1253 Ga0501217_113167
1254 Ga0501227_249114
1255 Ga0501243_119493
1256 Ga0501252_062523
1257 Ga0501234_046557
1258 Ga0501245_100362
1259 Ga0501245_146298
1260 Ga0501079_0745701
1261 Ga0501278_012389
1262 Ga0501212_021103
1263 nmdc:mga0qj67_1496047_c1
1264 Ga0500634_0320466
1265 Ga0500645_167784
1266 Ga0587070_135606
1267 Ga0587067_084987
1268 Ga0587072_154891
1269 2586208596
1270 2738757182
1271 2738853001
1272 2739586371
1273 2739617756
1274 2739644860
1275 2819549123
1276 2842725627
1277 2842903889
1278 2842914443
1279 2849283015
1280 2946001146
1281 2954018046
1282 2971416569

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

15

79

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ktc-assembly1.cif.gz_A crystal structure of ybx1 csd with m5c rna 0.9368 2 62
5ytx-assembly1.cif.gz_A crystal structure of yb1 cold-shock domain in complex with ucaacu 0.9366 2 62
5ytv-assembly1.cif.gz_A crystal structure of yb1 cold-shock domain in complex with ucaucu 0.936 2 62
6a6l-assembly1.cif.gz_A crystal structure of the cold shock domain of yb-1 in complex with m5c rna 0.9359 2 62
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9337 1 65
ID Description Score Start End Superfamily
5ytvA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.936 2 62 2.40.50.140
5jx4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.919 1 65 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9159 2 62 2.40.50.140
2haxB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9135 1 35 2.40.50.140
af_P0A976_2_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9076 2 62 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A497YCC2-F1-model_v4 Putative cold-shock DNA-binding protein 1.011 2 65 GO:0003677
GO:0005737
GO:0016020
AF-Q1AWL7-F1-model_v4 Cold-shock DNA-binding protein family 0.9856 2 65 GO:0003677
GO:0005737
AF-A0A1I3AA10-F1-model_v4 Cold-shock DNA-binding protein family 0.9819 1 65 GO:0003677
GO:0005737
AF-A0A838JVN6-F1-model_v4 Cold shock domain-containing protein 0.9802 4 65 GO:0003676
GO:0005737
AF-A0A6G8QF29-F1-model_v4 CSD domain-containing protein 0.98 2 65 GO:0003676
GO:0005737

Map