F471920

General Info

Members Datasets Scaffolds Average Seq Length
643 209 1286 186

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10014981|JGI24737J22298_100149813
Length 234
Sequence LVCVGAMRTKINWTLAAGLAVFLAGCETAPPPKIAQAPVSMLPYHWTQGNAPKAHEDAVAEFGPVALKPGQYLWAAAIPEAPKDTRIVVDLLSQLFYVYDGDKLVGVSTISSGKKGKETPLGFWSVIXKKKLGXSRKYDNAPMPYMQMYDSKGIAFHAGPNPGHPASHGCIRLPLKFAARLYGMTSVGTKLIXEGXXPVDASVARAASSTALGLDRGXVPSDRLTVRTRRSWRT

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
178 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
179 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
205 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
206 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 1.71
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10014981 3300001990 Bacteria 2512
2 JGI24736J21556_1000837 3300001904 Bacteria 5677
3 JGI24736J21556_1006172 3300001904 Bacteria 2020
4 JGI24741J21665_1016253 3300001915 Bacteria 1217
5 JGI24740J21852_10015137 3300001979 Bacteria 2823
6 JGI24739J22299_10001929 3300001989 Bacteria 7932
7 JGI24739J22299_10010471 3300001989 Bacteria 3444
8 JGI24737J22298_10000009 3300001990 Bacteria 58784
9 JGI24737J22298_10014081 3300001990 Bacteria 2598
10 JGI24737J22298_10034217 3300001990 Bacteria 1576
11 JGI24750J21931_1016910 3300002070 Bacteria 993
12 JGI24738J21930_10000253 3300002075 Bacteria 14535
13 JGI24035J26624_1008194 3300002126 Bacteria 1021
14 JGI24034J26672_10011657 3300002239 Bacteria 1319
15 Ga0065712_10523278 3300005290 Bacteria 634
16 Ga0065715_10063630 3300005293 Unclassified 765
17 Ga0065715_10233251 3300005293 Bacteria 1226
18 Ga0065715_10243197 3300005293 Bacteria 1192
19 Ga0070658_10003625 3300005327 Bacteria 12653
20 Ga0070658_10027439 3300005327 Bacteria 4569
21 Ga0070658_10069201 3300005327 Bacteria 2887
22 Ga0070658_10109670 3300005327 Bacteria 2285
23 Ga0070658_10260960 3300005327 Bacteria 1471
24 Ga0070658_10284715 3300005327 Bacteria 1407
25 Ga0070658_10315925 3300005327 Bacteria 1333
26 Ga0070658_10332317 3300005327 Bacteria 1299
27 Ga0070658_10625441 3300005327 Bacteria 934
28 Ga0070676_10000682 3300005328 Bacteria 16629
29 Ga0070676_10001819 3300005328 Bacteria 10846
30 Ga0070683_100064121 3300005329 Bacteria 3419
31 Ga0070670_100031717 3300005331 Bacteria 4552
32 Ga0070670_100048480 3300005331 Bacteria 3655
33 Ga0070670_100113728 3300005331 Bacteria 2333
34 Ga0068869_100000292 3300005334 Bacteria 26686
35 Ga0068869_100080302 3300005334 Bacteria 2433
36 Ga0068869_100432704 3300005334 Bacteria 1088
37 Ga0070666_10011535 3300005335 Bacteria 5549
38 Ga0070666_10038107 3300005335 Bacteria 3198
39 Ga0070680_100260838 3300005336 Bacteria 1466
40 Ga0070682_100283156 3300005337 Bacteria 1209
41 Ga0068868_100000321 3300005338 Bacteria 32236
42 Ga0070660_100000787 3300005339 Bacteria 21082
43 Ga0070660_100009451 3300005339 Bacteria 6858
44 Ga0070660_100020315 3300005339 Bacteria 4879
45 Ga0070660_100062569 3300005339 Bacteria 2891
46 Ga0070660_100277700 3300005339 Bacteria 1370
47 Ga0070660_100394232 3300005339 Bacteria 1144
48 Ga0070687_100510230 3300005343 Unclassified 811
49 Ga0070661_100010470 3300005344 Bacteria 6452
50 Ga0070661_100194077 3300005344 Bacteria 1549
51 Ga0070661_100250922 3300005344 Bacteria 1365
52 Ga0070661_100317856 3300005344 Bacteria 1215
53 Ga0070661_100483865 3300005344 Bacteria 989
54 Ga0070692_10004587 3300005345 Bacteria 5786
55 Ga0070692_10015285 3300005345 Bacteria 3628
56 Ga0070692_10199501 3300005345 Bacteria 1171
57 Ga0070668_100005718 3300005347 Bacteria 9221
58 Ga0070668_100011865 3300005347 Bacteria 6492
59 Ga0070668_100012237 3300005347 Bacteria 6393
60 Ga0070668_100113149 3300005347 Bacteria 2162
61 Ga0070668_100280733 3300005347 Bacteria 1391
62 Ga0070669_100000605 3300005353 Bacteria 26684
63 Ga0070669_100031423 3300005353 Bacteria 3836
64 Ga0070669_100066707 3300005353 Bacteria 2653
65 Ga0070669_100096990 3300005353 Bacteria 2219
66 Ga0070669_100823733 3300005353 Bacteria 790
67 Ga0070675_100019379 3300005354 Bacteria 5421
68 Ga0070675_100075959 3300005354 Bacteria 2794
69 Ga0070675_100087131 3300005354 Bacteria 2611
70 Ga0070675_100244934 3300005354 Bacteria 1567
71 Ga0070671_100035841 3300005355 Bacteria 4111
72 Ga0070671_100045985 3300005355 Bacteria 3630
73 Ga0070671_100065877 3300005355 Bacteria 3018
74 Ga0070673_100000569 3300005364 Bacteria 19934
75 Ga0070673_100021850 3300005364 Bacteria 4648
76 Ga0070673_100044749 3300005364 Bacteria 3429
77 Ga0070673_100140940 3300005364 Bacteria 2033
78 Ga0070673_100334410 3300005364 Unclassified 1341
79 Ga0070659_100000469 3300005366 Bacteria 29784
80 Ga0070659_100007716 3300005366 Bacteria 7823
81 Ga0070659_100016674 3300005366 Bacteria 5517
82 Ga0070659_100047690 3300005366 Bacteria 3362
83 Ga0070659_100138074 3300005366 Bacteria 1983
84 Ga0070659_100297766 3300005366 Bacteria 1344
85 Ga0070659_100805592 3300005366 Bacteria 817
86 Ga0070667_100006049 3300005367 Bacteria 10053
87 Ga0070667_100009802 3300005367 Bacteria 7941
88 Ga0070667_100027604 3300005367 Bacteria 4723
89 Ga0070667_100048131 3300005367 Bacteria 3588
90 Ga0070667_100067525 3300005367 Bacteria 3040
91 Ga0070694_100007767 3300005444 Bacteria 6542
92 Ga0070663_100003840 3300005455 Bacteria 8744
93 Ga0070663_100009228 3300005455 Bacteria 6102
94 Ga0070663_100066755 3300005455 Bacteria 2607
95 Ga0070663_100069115 3300005455 Bacteria 2565
96 Ga0070663_100522007 3300005455 Bacteria 989
97 Ga0070663_100547223 3300005455 Bacteria 967
98 Ga0070678_100209369 3300005456 Bacteria 1615
99 Ga0070678_100618855 3300005456 Unclassified 968
100 Ga0070662_100000146 3300005457 Bacteria 40344
101 Ga0070662_100000625 3300005457 Bacteria 21385
102 Ga0070662_100007041 3300005457 Bacteria 7275
103 Ga0070662_100030328 3300005457 Bacteria 3782
104 Ga0070662_100034084 3300005457 Bacteria 3588
105 Ga0070662_100179833 3300005457 Bacteria 1667
106 Ga0070681_10150961 3300005458 Bacteria 2249
107 Ga0068867_100000045 3300005459 Bacteria 75898
108 Ga0068867_100018109 3300005459 Bacteria 5005
109 Ga0068867_100096502 3300005459 Bacteria 2251
110 Ga0068867_100353356 3300005459 Bacteria 1227
111 Ga0070685_10205730 3300005466 Bacteria 1282
112 Ga0070706_100258186 3300005467 Bacteria 1627
113 Ga0070679_100111452 3300005530 Bacteria 2723
114 Ga0070679_100321041 3300005530 Bacteria 1498
115 Ga0068853_100000162 3300005539 Bacteria 45622
116 Ga0068853_100101480 3300005539 Bacteria 2545
117 Ga0068853_100267628 3300005539 Bacteria 1573
118 Ga0068853_100290595 3300005539 Bacteria 1509
119 Ga0068853_100403275 3300005539 Bacteria 1280
120 Ga0070672_100000041 3300005543 Bacteria 56886
121 Ga0070672_100064740 3300005543 Bacteria 2889
122 Ga0070672_100067286 3300005543 Bacteria 2838
123 Ga0070672_100174446 3300005543 Unclassified 1789
124 Ga0070672_100218468 3300005543 Bacteria 1598
125 Ga0070686_100216416 3300005544 Bacteria 1382
126 Ga0070696_100006917 3300005546 Bacteria 7570
127 Ga0070693_100051506 3300005547 Bacteria 2358
128 Ga0070693_100356524 3300005547 Bacteria 1002
129 Ga0070665_100001627 3300005548 Bacteria 25878
130 Ga0070665_100002713 3300005548 Bacteria 19193
131 Ga0070665_100020194 3300005548 Bacteria 6688
132 Ga0070665_100065524 3300005548 Bacteria 3644
133 Ga0070665_101196137 3300005548 Bacteria 771
134 Ga0068855_100011617 3300005563 Bacteria 10641
135 Ga0068855_100049424 3300005563 Bacteria 4960
136 Ga0068855_100072813 3300005563 Bacteria 3993
137 Ga0068855_100268531 3300005563 Bacteria 1898
138 Ga0068855_100579110 3300005563 Bacteria 1212
139 Ga0068855_101257617 3300005563 Bacteria 768
140 Ga0070664_100013986 3300005564 Bacteria 6544
141 Ga0070664_100053065 3300005564 Bacteria 3435
142 Ga0070664_100467622 3300005564 Unclassified 1159
143 Ga0068857_100001494 3300005577 Bacteria 18623
144 Ga0068857_100020446 3300005577 Bacteria 5822
145 Ga0068857_100052857 3300005577 Bacteria 3603
146 Ga0068857_100063138 3300005577 Bacteria 3292
147 Ga0068857_100555732 3300005577 Bacteria 1082
148 Ga0068854_100000234 3300005578 Bacteria 37807
149 Ga0068854_100005397 3300005578 Bacteria 8070
150 Ga0068854_100021446 3300005578 Bacteria 4384
151 Ga0068856_100121263 3300005614 Bacteria 2616
152 Ga0068856_100153234 3300005614 Bacteria 2314
153 Ga0070702_100225703 3300005615 Bacteria 1255
154 Ga0068852_100000803 3300005616 Bacteria 20671
155 Ga0068852_100013867 3300005616 Bacteria 6181
156 Ga0068852_100018832 3300005616 Bacteria 5448
157 Ga0068852_100030474 3300005616 Bacteria 4441
158 Ga0068852_100050698 3300005616 Bacteria 3558
159 Ga0068852_100273766 3300005616 Bacteria 1625
160 Ga0068859_100000088 3300005617 Bacteria 84390
161 Ga0068859_100000709 3300005617 Bacteria 33516
162 Ga0068859_100005111 3300005617 Bacteria 13329
163 Ga0068859_100266100 3300005617 Bacteria 1806
164 Ga0068859_100502409 3300005617 Bacteria 1308
165 Ga0068864_100000092 3300005618 Bacteria 94499
166 Ga0068864_100000484 3300005618 Bacteria 34533
167 Ga0068864_100003437 3300005618 Bacteria 13093
168 Ga0068864_100353270 3300005618 Bacteria 1387
169 Ga0068866_10016554 3300005718 Bacteria 3298
170 Ga0068866_10045693 3300005718 Bacteria 2198
171 Ga0068866_10524135 3300005718 Unclassified 788
172 Ga0068861_100065464 3300005719 Bacteria 2800
173 Ga0068861_100100331 3300005719 Bacteria 2301
174 Ga0068851_10165037 3300005834 Bacteria 1219
175 Ga0068851_10171045 3300005834 Bacteria 1199
176 Ga0068870_10508663 3300005840 Bacteria 804
177 Ga0068863_100001372 3300005841 Bacteria 24176
178 Ga0068863_100006606 3300005841 Bacteria 11383
179 Ga0068863_100014719 3300005841 Bacteria 7528
180 Ga0068863_100038431 3300005841 Bacteria 4553
181 Ga0068863_100147126 3300005841 Bacteria 2254
182 Ga0068858_100000063 3300005842 Bacteria 111811
183 Ga0068858_100004386 3300005842 Bacteria 13846
184 Ga0068858_100018374 3300005842 Bacteria 6547
185 Ga0068858_100028491 3300005842 Bacteria 5188
186 Ga0068858_100406511 3300005842 Bacteria 1308
187 Ga0068858_100443713 3300005842 Bacteria 1250
188 Ga0068860_100001353 3300005843 Bacteria 26631
189 Ga0068860_100013708 3300005843 Bacteria 7948
190 Ga0068860_100020068 3300005843 Bacteria 6474
191 Ga0068860_100050702 3300005843 Bacteria 3950
192 Ga0068860_100107926 3300005843 Bacteria 2660
193 Ga0068860_100420566 3300005843 Bacteria 1325
194 Ga0068862_100001114 3300005844 Bacteria 25468
195 Ga0068862_100001902 3300005844 Bacteria 18953
196 Ga0068862_100009104 3300005844 Bacteria 8218
197 Ga0068862_100054114 3300005844 Bacteria 3436
198 Ga0068862_100082848 3300005844 Bacteria 2785
199 Ga0068862_100083972 3300005844 Bacteria 2766
200 Ga0068862_100101043 3300005844 Bacteria 2522
201 Ga0068862_100133996 3300005844 Bacteria 2194
202 Ga0068862_100346889 3300005844 Bacteria 1376
203 Ga0068862_100494852 3300005844 Bacteria 1159
204 Ga0097621_100043495 3300006237 Bacteria 3621
205 Ga0097621_100067851 3300006237 Bacteria 2940
206 Ga0097621_100082423 3300006237 Bacteria 2678
207 Ga0068871_100039025 3300006358 Bacteria 3797
208 Ga0068871_100044603 3300006358 Bacteria 3567
209 Ga0068871_100348627 3300006358 Bacteria 1309
210 Ga0075428_100100496 3300006844 Bacteria 3154
211 Ga0075431_100699235 3300006847 Bacteria 991
212 Ga0075433_10003509 3300006852 Bacteria 12116
213 Ga0068865_100007472 3300006881 Bacteria 6726
214 Ga0068865_100198134 3300006881 Bacteria 1557
215 Ga0097620_100000088 3300006931 Bacteria 84390
216 Ga0097620_100000709 3300006931 Bacteria 33516
217 Ga0097620_100005111 3300006931 Bacteria 13329
218 Ga0097620_100266120 3300006931 Bacteria 1806
219 Ga0097620_100502390 3300006931 Bacteria 1308
220 Ga0075435_100902465 3300007076 Bacteria 771
221 Ga0105250_10037764 3300009092 Bacteria 1938
222 Ga0105240_10014883 3300009093 Bacteria 10601
223 Ga0105240_10134707 3300009093 Bacteria 2959
224 Ga0105245_10000062 3300009098 Bacteria 115179
225 Ga0105247_10070468 3300009101 Bacteria 2184
226 Ga0105247_10151255 3300009101 Bacteria 1529
227 Ga0105243_10317129 3300009148 Bacteria 1419
228 Ga0105241_10044983 3300009174 Bacteria 3347
229 Ga0105242_10096286 3300009176 Bacteria 2500
230 Ga0105242_10124748 3300009176 Bacteria 2215
231 Ga0105248_10000122 3300009177 Bacteria 89560
232 Ga0105248_10000169 3300009177 Bacteria 75948
233 Ga0105248_10074910 3300009177 Bacteria 3804
234 Ga0105248_10716999 3300009177 Bacteria 1129
235 Ga0105237_10058758 3300009545 Bacteria 3849
236 Ga0105237_10536083 3300009545 Bacteria 1177
237 Ga0105238_10004520 3300009551 Bacteria 13783
238 Ga0105238_10271684 3300009551 Bacteria 1676
239 Ga0105249_10048401 3300009553 Bacteria 3875
240 Ga0105249_10118535 3300009553 Bacteria 2512
241 Ga0105032_102943 3300009979 Bacteria 1499
242 Ga0105239_10055715 3300010375 Bacteria 4336
243 Ga0105239_10415258 3300010375 Bacteria 1524
244 Ga0105246_10005136 3300011119 Bacteria 7959
245 Ga0105246_10071387 3300011119 Bacteria 2445
246 Ga0157373_10007055 3300013100 Bacteria 8373
247 Ga0157373_10017853 3300013100 Bacteria 5168
248 Ga0157373_10037585 3300013100 Bacteria 3470
249 Ga0157373_10040110 3300013100 Bacteria 3351
250 Ga0157373_10041793 3300013100 Bacteria 3279
251 Ga0157373_10063214 3300013100 Bacteria 2622
252 Ga0157373_10689358 3300013100 Bacteria 748
253 Ga0157371_10001576 3300013102 Bacteria 23409
254 Ga0157371_10012795 3300013102 Bacteria 6397
255 Ga0157371_10055171 3300013102 Bacteria 2819
256 Ga0157371_10070854 3300013102 Bacteria 2468
257 Ga0157371_10132348 3300013102 Bacteria 1775
258 Ga0157371_10414275 3300013102 Bacteria 987
259 Ga0157370_10066225 3300013104 Bacteria 3417
260 Ga0157370_10069885 3300013104 Bacteria 3316
261 Ga0157370_10260778 3300013104 Bacteria 1602
262 Ga0157369_10032158 3300013105 Bacteria 5771
263 Ga0157369_10225683 3300013105 Bacteria 1960
264 Ga0157378_10000242 3300013297 Bacteria 53256
265 Ga0157378_10941186 3300013297 Bacteria 896
266 Ga0163162_10148366 3300013306 Bacteria 2462
267 Ga0163162_10372739 3300013306 Bacteria 1561
268 Ga0163162_10472442 3300013306 Bacteria 1385
269 Ga0157372_10127374 3300013307 Bacteria 2928
270 Ga0157372_10190012 3300013307 Bacteria 2379
271 Ga0157372_10225794 3300013307 Bacteria 2171
272 Ga0157372_10560289 3300013307 Bacteria 1332
273 Ga0157372_10712943 3300013307 Bacteria 1167
274 Ga0157372_10932169 3300013307 Bacteria 1007
275 Ga0157375_10125711 3300013308 Bacteria 2679
276 Ga0157375_10171420 3300013308 Bacteria 2318
277 Ga0157375_10229296 3300013308 Bacteria 2016
278 Ga0157375_10366944 3300013308 Bacteria 1606
279 Ga0163163_10000080 3300014325 Bacteria 106006
280 Ga0163163_10261983 3300014325 Bacteria 1780
281 Ga0157380_10198807 3300014326 Bacteria 1777
282 Ga0157380_10911866 3300014326 Bacteria 906
283 Ga0157377_10041438 3300014745 Bacteria 2555
284 Ga0157379_10000979 3300014968 Bacteria 23169
285 Ga0157379_10003979 3300014968 Bacteria 12596
286 Ga0163161_10275018 3300017792 Bacteria 1319
287 Ga0206354_10444197 3300020081 Bacteria 710
288 Ga0213875_10005718 3300021388 Bacteria 6623
289 Ga0207673_1003360 3300025290 Bacteria 1869
290 Ga0207697_10000002 3300025315 Bacteria 92560
291 Ga0207656_10165612 3300025321 Bacteria 1054
292 Ga0207642_10046967 3300025899 Bacteria 1927
293 Ga0207710_10115242 3300025900 Bacteria 1279
294 Ga0207688_10000493 3300025901 Bacteria 18994
295 Ga0207688_10055837 3300025901 Bacteria 2217
296 Ga0207680_10015740 3300025903 Bacteria 3954
297 Ga0207647_10000095 3300025904 Bacteria 67884
298 Ga0207647_10000304 3300025904 Bacteria 40516
299 Ga0207647_10007324 3300025904 Bacteria 7980
300 Ga0207645_10002830 3300025907 Bacteria 13470
301 Ga0207645_10005035 3300025907 Bacteria 9679
302 Ga0207645_10008706 3300025907 Bacteria 7064
303 Ga0207645_10038485 3300025907 Bacteria 3067
304 Ga0207643_10046768 3300025908 Bacteria 2446
305 Ga0207705_10007826 3300025909 Bacteria 7847
306 Ga0207705_10008141 3300025909 Bacteria 7677
307 Ga0207705_10012192 3300025909 Bacteria 6212
308 Ga0207705_10034383 3300025909 Bacteria 3624
309 Ga0207705_10564123 3300025909 Bacteria 885
310 Ga0207705_10903153 3300025909 Bacteria 684
311 Ga0207684_10195691 3300025910 Bacteria 1744
312 Ga0207654_10078399 3300025911 Bacteria 1982
313 Ga0207654_10186282 3300025911 Bacteria 1357
314 Ga0207695_10001271 3300025913 Bacteria 42892
315 Ga0207695_10006302 3300025913 Bacteria 15443
316 Ga0207671_10024208 3300025914 Bacteria 4569
317 Ga0207657_10002150 3300025919 Bacteria 21362
318 Ga0207657_10003663 3300025919 Bacteria 16359
319 Ga0207657_10004622 3300025919 Bacteria 14538
320 Ga0207657_10014398 3300025919 Bacteria 7724
321 Ga0207657_10017078 3300025919 Bacteria 6978
322 Ga0207657_10017592 3300025919 Bacteria 6848
323 Ga0207649_10000176 3300025920 Bacteria 52479
324 Ga0207649_10013030 3300025920 Bacteria 4635
325 Ga0207649_10272742 3300025920 Bacteria 1227
326 Ga0207681_10001335 3300025923 Bacteria 15913
327 Ga0207681_10009578 3300025923 Bacteria 5921
328 Ga0207681_10064311 3300025923 Bacteria 2533
329 Ga0207681_10155675 3300025923 Bacteria 1717
330 Ga0207681_10185925 3300025923 Unclassified 1586
331 Ga0207681_10217917 3300025923 Bacteria 1475
332 Ga0207681_10240721 3300025923 Bacteria 1408
333 Ga0207681_10245664 3300025923 Bacteria 1395
334 Ga0207694_10018909 3300025924 Bacteria 5209
335 Ga0207694_10130885 3300025924 Bacteria 2011
336 Ga0207650_10046104 3300025925 Bacteria 3209
337 Ga0207650_10095835 3300025925 Bacteria 2275
338 Ga0207650_10563428 3300025925 Bacteria 956
339 Ga0207659_10014880 3300025926 Bacteria 5029
340 Ga0207659_10090961 3300025926 Bacteria 2279
341 Ga0207659_10750507 3300025926 Bacteria 837
342 Ga0207687_10007316 3300025927 Bacteria 7280
343 Ga0207687_10232762 3300025927 Bacteria 1456
344 Ga0207644_10013630 3300025931 Bacteria 5424
345 Ga0207644_10014092 3300025931 Bacteria 5346
346 Ga0207644_10028233 3300025931 Bacteria 3882
347 Ga0207644_10242759 3300025931 Bacteria 1435
348 Ga0207690_10002193 3300025932 Bacteria 11904
349 Ga0207690_10017149 3300025932 Bacteria 4418
350 Ga0207690_10019414 3300025932 Bacteria 4185
351 Ga0207690_10038109 3300025932 Bacteria 3126
352 Ga0207690_10042160 3300025932 Bacteria 2996
353 Ga0207690_10152880 3300025932 Bacteria 1712
354 Ga0207706_10001976 3300025933 Bacteria 20116
355 Ga0207706_10043323 3300025933 Bacteria 3989
356 Ga0207706_10052024 3300025933 Bacteria 3616
357 Ga0207706_10053933 3300025933 Bacteria 3548
358 Ga0207706_10068186 3300025933 Bacteria 3130
359 Ga0207706_10324530 3300025933 Bacteria 1340
360 Ga0207686_10504119 3300025934 Bacteria 939
361 Ga0207709_10071068 3300025935 Bacteria 2209
362 Ga0207670_10245319 3300025936 Bacteria 1382
363 Ga0207669_10504901 3300025937 Bacteria 968
364 Ga0207704_10030622 3300025938 Bacteria 3019
365 Ga0207691_10000133 3300025940 Bacteria 68368
366 Ga0207691_10023380 3300025940 Bacteria 5817
367 Ga0207691_10059576 3300025940 Bacteria 3471
368 Ga0207691_10060280 3300025940 Bacteria 3448
369 Ga0207691_10206167 3300025940 Bacteria 1710
370 Ga0207711_10000543 3300025941 Bacteria 38517
371 Ga0207711_10098260 3300025941 Bacteria 2586
372 Ga0207689_10000002 3300025942 Bacteria 198437
373 Ga0207689_10024146 3300025942 Bacteria 5100
374 Ga0207689_10131983 3300025942 Bacteria 2056
375 Ga0207661_10186579 3300025944 Unclassified 1815
376 Ga0207679_10016457 3300025945 Bacteria 4912
377 Ga0207679_10270777 3300025945 Bacteria 1452
378 Ga0207679_10396822 3300025945 Unclassified 1213
379 Ga0207679_11076846 3300025945 Bacteria 737
380 Ga0207667_10015149 3300025949 Bacteria 8768
381 Ga0207667_10020691 3300025949 Bacteria 7312
382 Ga0207667_10029434 3300025949 Bacteria 5956
383 Ga0207667_10091767 3300025949 Bacteria 3137
384 Ga0207667_10114384 3300025949 Bacteria 2781
385 Ga0207667_10313459 3300025949 Bacteria 1602
386 Ga0207651_10000761 3300025960 Bacteria 13852
387 Ga0207651_10342172 3300025960 Bacteria 1257
388 Ga0207651_10418464 3300025960 Bacteria 1143
389 Ga0207651_10485652 3300025960 Bacteria 1065
390 Ga0207651_10772483 3300025960 Bacteria 850
391 Ga0207712_10046019 3300025961 Bacteria 3023
392 Ga0207712_10085485 3300025961 Bacteria 2309
393 Ga0207712_10354790 3300025961 Bacteria 1220
394 Ga0207668_10000176 3300025972 Bacteria 43587
395 Ga0207668_10004436 3300025972 Bacteria 8243
396 Ga0207668_10021164 3300025972 Bacteria 4145
397 Ga0207668_10038667 3300025972 Bacteria 3205
398 Ga0207668_10104238 3300025972 Bacteria 2114
399 Ga0207668_10184754 3300025972 Bacteria 1647
400 Ga0207668_10276511 3300025972 Bacteria 1375
401 Ga0207668_10416962 3300025972 Bacteria 1139
402 Ga0207640_10001097 3300025981 Bacteria 14953
403 Ga0207640_10015834 3300025981 Bacteria 4374
404 Ga0207640_10025092 3300025981 Bacteria 3604
405 Ga0207640_10038460 3300025981 Bacteria 3019
406 Ga0207640_10194753 3300025981 Bacteria 1530
407 Ga0207640_10368470 3300025981 Bacteria 1160
408 Ga0207658_10002392 3300025986 Bacteria 13758
409 Ga0207658_10003231 3300025986 Bacteria 11580
410 Ga0207658_10028391 3300025986 Bacteria 3940
411 Ga0207658_10065164 3300025986 Bacteria 2735
412 Ga0207658_10071148 3300025986 Bacteria 2633
413 Ga0207658_10110539 3300025986 Bacteria 2171
414 Ga0207658_10541820 3300025986 Bacteria 1040
415 Ga0207677_10056763 3300026023 Bacteria 2684
416 Ga0207677_10188122 3300026023 Bacteria 1631
417 Ga0207703_10002878 3300026035 Bacteria 14647
418 Ga0207703_10003215 3300026035 Bacteria 13738
419 Ga0207703_10015939 3300026035 Bacteria 5861
420 Ga0207703_10019655 3300026035 Bacteria 5279
421 Ga0207639_10123686 3300026041 Bacteria 2130
422 Ga0207639_10176929 3300026041 Bacteria 1812
423 Ga0207639_10237139 3300026041 Bacteria 1584
424 Ga0207639_10305982 3300026041 Bacteria 1407
425 Ga0207639_10364787 3300026041 Bacteria 1293
426 Ga0207678_10001437 3300026067 Bacteria 21856
427 Ga0207678_10002737 3300026067 Bacteria 15971
428 Ga0207678_10016526 3300026067 Bacteria 6480
429 Ga0207678_10237657 3300026067 Bacteria 1560
430 Ga0207678_10252648 3300026067 Bacteria 1510
431 Ga0207678_10447589 3300026067 Bacteria 1122
432 Ga0207702_10004984 3300026078 Bacteria 11663
433 Ga0207702_10012720 3300026078 Bacteria 7002
434 Ga0207702_10065279 3300026078 Bacteria 3117
435 Ga0207702_10485167 3300026078 Bacteria 1203
436 Ga0207641_10000138 3300026088 Bacteria 106531
437 Ga0207641_10019138 3300026088 Bacteria 5616
438 Ga0207641_10066366 3300026088 Bacteria 3088
439 Ga0207641_10235348 3300026088 Bacteria 1704
440 Ga0207648_10000088 3300026089 Bacteria 86596
441 Ga0207648_10001235 3300026089 Bacteria 28702
442 Ga0207648_10111646 3300026089 Bacteria 2400
443 Ga0207648_10349833 3300026089 Bacteria 1332
444 Ga0207676_10000245 3300026095 Bacteria 47297
445 Ga0207676_10001781 3300026095 Bacteria 15791
446 Ga0207676_10002000 3300026095 Bacteria 14846
447 Ga0207676_10054821 3300026095 Bacteria 3125
448 Ga0207676_10261618 3300026095 Bacteria 1562
449 Ga0207674_10000742 3300026116 Bacteria 42731
450 Ga0207674_10001363 3300026116 Bacteria 31621
451 Ga0207674_10001622 3300026116 Bacteria 28942
452 Ga0207674_10008869 3300026116 Bacteria 11570
453 Ga0207674_10027930 3300026116 Bacteria 5962
454 Ga0207674_10050994 3300026116 Bacteria 4224
455 Ga0207674_10322481 3300026116 Bacteria 1494
456 Ga0207675_100123805 3300026118 Bacteria 2448
457 Ga0207675_100336443 3300026118 Bacteria 1477
458 Ga0207675_100396990 3300026118 Bacteria 1358
459 Ga0207675_100421689 3300026118 Bacteria 1318
460 Ga0207675_101159036 3300026118 Bacteria 793
461 Ga0207683_10687315 3300026121 Bacteria 948
462 Ga0207698_10002332 3300026142 Bacteria 11243
463 Ga0207698_10011901 3300026142 Bacteria 5665
464 Ga0207698_10020626 3300026142 Bacteria 4540
465 Ga0207698_10021859 3300026142 Bacteria 4432
466 Ga0207698_10094813 3300026142 Bacteria 2455
467 Ga0209974_10014113 3300027876 Bacteria 2662
468 Ga0268266_10000998 3300028379 Bacteria 35702
469 Ga0268266_10014168 3300028379 Bacteria 6860
470 Ga0268266_10070173 3300028379 Bacteria 3036
471 Ga0268266_10678426 3300028379 Bacteria 992
472 Ga0268265_10000904 3300028380 Bacteria 27551
473 Ga0268265_10001512 3300028380 Bacteria 19417
474 Ga0268265_10003742 3300028380 Bacteria 10817
475 Ga0268265_10048556 3300028380 Bacteria 3186
476 Ga0268265_10061381 3300028380 Bacteria 2884
477 Ga0268265_10064024 3300028380 Bacteria 2831
478 Ga0268265_10100879 3300028380 Bacteria 2331
479 Ga0268265_10105797 3300028380 Bacteria 2284
480 Ga0268265_10108113 3300028380 Bacteria 2263
481 Ga0268265_10156085 3300028380 Bacteria 1931
482 Ga0268264_10000644 3300028381 Bacteria 41159
483 Ga0268264_10001156 3300028381 Bacteria 25715
484 Ga0268264_10016372 3300028381 Bacteria 6070
485 Ga0268264_10147111 3300028381 Bacteria 2108
486 Ga0268264_10209544 3300028381 Bacteria 1788
487 Ga0268264_10413119 3300028381 Bacteria 1300
488 Ga0307513_10253707 3300031456 Bacteria 1554
489 Ga0307408_100057951 3300031548 Bacteria 2814
490 Ga0307408_100167777 3300031548 Bacteria 1750
491 Ga0307408_100220419 3300031548 Bacteria 1547
492 Ga0307408_100390291 3300031548 Bacteria 1192
493 Ga0307405_10004653 3300031731 Bacteria 6516
494 Ga0307405_10026647 3300031731 Bacteria 3338
495 Ga0307405_10063313 3300031731 Bacteria 2345
496 Ga0307405_10064745 3300031731 Bacteria 2324
497 Ga0307405_10278475 3300031731 Bacteria 1258
498 Ga0307405_10305962 3300031731 Bacteria 1208
499 Ga0307413_10003269 3300031824 Bacteria 6794
500 Ga0307413_10019488 3300031824 Bacteria 3586
501 Ga0307413_10059103 3300031824 Bacteria 2354
502 Ga0307413_10081363 3300031824 Bacteria 2076
503 Ga0307413_10353782 3300031824 Bacteria 1134
504 Ga0307413_10398516 3300031824 Bacteria 1077
505 Ga0307413_10494617 3300031824 Bacteria 981
506 Ga0307410_10008709 3300031852 Bacteria 5643
507 Ga0307410_10049242 3300031852 Bacteria 2827
508 Ga0307410_10064847 3300031852 Bacteria 2511
509 Ga0307410_10306702 3300031852 Bacteria 1254
510 Ga0307410_10511498 3300031852 Bacteria 989
511 Ga0307410_10720315 3300031852 Bacteria 842
512 Ga0307406_10012458 3300031901 Bacteria 4849
513 Ga0307406_10097789 3300031901 Bacteria 1991
514 Ga0307406_10109010 3300031901 Bacteria 1902
515 Ga0307406_10116074 3300031901 Bacteria 1851
516 Ga0307406_10219695 3300031901 Bacteria 1411
517 Ga0307406_10220990 3300031901 Bacteria 1408
518 Ga0307406_10299710 3300031901 Bacteria 1234
519 Ga0307406_10521166 3300031901 Bacteria 967
520 Ga0307407_10002051 3300031903 Bacteria 7703
521 Ga0307407_10018369 3300031903 Bacteria 3535
522 Ga0307407_10022165 3300031903 Bacteria 3290
523 Ga0307407_10037113 3300031903 Bacteria 2690
524 Ga0307407_10268022 3300031903 Bacteria 1177
525 Ga0307407_10391044 3300031903 Bacteria 995
526 Ga0307407_10533228 3300031903 Bacteria 865
527 Ga0307412_10005326 3300031911 Bacteria 7220
528 Ga0307412_10022110 3300031911 Bacteria 3893
529 Ga0307412_10086792 3300031911 Bacteria 2178
530 Ga0307412_10181396 3300031911 Bacteria 1584
531 Ga0307412_10272271 3300031911 Bacteria 1325
532 Ga0307412_10364851 3300031911 Bacteria 1164
533 Ga0307412_10411318 3300031911 Bacteria 1104
534 Ga0307412_10502622 3300031911 Bacteria 1009
535 Ga0307409_100007495 3300031995 Bacteria 6534
536 Ga0307409_100007807 3300031995 Bacteria 6438
537 Ga0307409_100095529 3300031995 Bacteria 2449
538 Ga0307409_100213473 3300031995 Bacteria 1736
539 Ga0307409_100731813 3300031995 Bacteria 991
540 Ga0307409_101182958 3300031995 Bacteria 787
541 Ga0307416_100005298 3300032002 Bacteria 7904
542 Ga0307416_100090928 3300032002 Bacteria 2619
543 Ga0307416_100306127 3300032002 Bacteria 1583
544 Ga0307416_100355521 3300032002 Bacteria 1484
545 Ga0307416_100888822 3300032002 Bacteria 990
546 Ga0307416_101052810 3300032002 Bacteria 917
547 Ga0307416_101236736 3300032002 Bacteria 852
548 Ga0307414_10025193 3300032004 Bacteria 3806
549 Ga0307414_10053067 3300032004 Bacteria 2825
550 Ga0307414_10063583 3300032004 Bacteria 2623
551 Ga0307414_10073003 3300032004 Bacteria 2480
552 Ga0307414_10246817 3300032004 Bacteria 1481
553 Ga0307414_10274259 3300032004 Bacteria 1414
554 Ga0307414_10356217 3300032004 Bacteria 1257
555 Ga0307414_10442041 3300032004 Bacteria 1138
556 Ga0307414_10471274 3300032004 Bacteria 1105
557 Ga0307414_10863247 3300032004 Bacteria 828
558 Ga0307411_10003751 3300032005 Bacteria 7127
559 Ga0307411_10008328 3300032005 Bacteria 5363
560 Ga0307411_10010970 3300032005 Bacteria 4861
561 Ga0307411_10046528 3300032005 Bacteria 2798
562 Ga0307411_10060964 3300032005 Bacteria 2508
563 Ga0307411_10170733 3300032005 Bacteria 1639
564 Ga0307411_10423507 3300032005 Bacteria 1106
565 Ga0307411_10674536 3300032005 Bacteria 897
566 Ga0307415_100004960 3300032126 Bacteria 7002
567 Ga0307415_100086680 3300032126 Bacteria 2253
568 Ga0307415_100090757 3300032126 Bacteria 2211
569 Ga0307415_100154860 3300032126 Bacteria 1768
570 Ga0307415_100360446 3300032126 Bacteria 1227
571 Ga0307415_101091600 3300032126 Bacteria 746
572 Ga0395899_0000352 3300037312 Bacteria 56166
573 Ga0395899_0013148 3300037312 Bacteria 6329
574 Ga0395899_0027246 3300037312 Bacteria 4309
575 Ga0395899_0084144 3300037312 Bacteria 2312
576 Ga0395899_0713334 3300037312 Bacteria 628
577 Ga0395900_0000944 3300037418 Bacteria 37904
578 Ga0395900_0028743 3300037418 Bacteria 5700
579 Ga0395900_0037739 3300037418 Bacteria 4980
580 Ga0395900_0047572 3300037418 Bacteria 4416
581 Ga0395900_0096770 3300037418 Bacteria 3033
582 Ga0395900_0148028 3300037418 Bacteria 2400
583 Ga0395900_0160822 3300037418 Bacteria 2290
584 Ga0395900_0193272 3300037418 Bacteria 2063
585 Ga0395900_0538853 3300037418 Unclassified 1113
586 Ga0395898_0003377 3300037466 Bacteria 17885
587 Ga0395898_0039238 3300037466 Bacteria 4688
588 Ga0395898_0136754 3300037466 Bacteria 2346
589 Ga0395898_0178177 3300037466 Bacteria 2031
590 Ga0395898_0190168 3300037466 Bacteria 1961
591 Ga0395898_0801718 3300037466 Bacteria 882
592 Ga0395905_0011129 3300037471 Bacteria 8701
593 Ga0395905_0069108 3300037471 Bacteria 3308
594 Ga0395905_0140814 3300037471 Bacteria 2269
595 Ga0395905_0188137 3300037471 Bacteria 1937
596 Ga0395905_0300669 3300037471 Bacteria 1492
597 Ga0395905_0542135 3300037471 Bacteria 1064
598 Ga0395905_0569378 3300037471 Bacteria 1034
599 Ga0436364_0072780 3300037853 Bacteria 17767
600 Ga0395901_0000047 3300038443 Bacteria 175221
601 Ga0395901_0062886 3300038443 Bacteria 3862
602 Ga0395901_0096499 3300038443 Bacteria 3098
603 Ga0395901_0108455 3300038443 Bacteria 2915
604 Ga0395901_0519377 3300038443 Bacteria 1210
605 Ga0395901_0705018 3300038443 Bacteria 1006
606 Ga0450890_010158 3300042127 Bacteria 1210
607 Ga0450905_002018 3300042142 Bacteria 2588
608 Ga0450889_000168 3300042144 Bacteria 6945
609 Ga0439464_0003608 3300042439 Bacteria 3921
610 Ga0466969_0002712 3300044656 Bacteria 9458
611 Ga0466966_0013669 3300044684 Bacteria 5371
612 Ga0466963_0022868 3300044694 Bacteria 3963
613 Ga0466963_0054287 3300044694 Bacteria 2662
614 Ga0466964_0006134 3300044706 Bacteria 4480
615 Ga0466971_0020939 3300044719 Bacteria 2907
616 Ga0466970_0007971 3300044765 Bacteria 5318
617 Ga0466957_0021119 3300044842 Bacteria 3834
618 Ga0466960_0120420 3300044901 Bacteria 1374
619 Ga0466959_0020961 3300045049 Bacteria 4818
620 Ga0466959_0068337 3300045049 Bacteria 2575
621 Ga0466958_0002133 3300045836 Bacteria 9838
622 Ga0495598_0008531 3300046537 Bacteria 2391
623 Ga0495669_0022903 3300046684 Bacteria 2715
624 Ga0495669_0178836 3300046684 Bacteria 1011
625 Ga0496100_0771542 3300048903 Bacteria 752
626 Ga0496101_0370300 3300048904 Bacteria 1127
627 Ga0496102_0044495 3300048905 Bacteria 4029
628 Ga0496103_0113088 3300048906 Bacteria 1725
629 Ga0496104_0134011 3300048907 Bacteria 2380
630 Ga0496107_0056919 3300048910 Bacteria 2826
631 Ga0496107_0340149 3300048910 Bacteria 1116
632 Ga0496108_0448469 3300048911 Bacteria 1127
633 Ga0496110_0010854 3300048913 Bacteria 7428
634 Ga0496111_0026061 3300048914 Bacteria 4126
635 Ga0496113_0010953 3300048916 Bacteria 6022
636 Ga0501068_0280258 3300049584 Bacteria 1065
637 Ga0501249_071132 3300049679 Bacteria 813
638 Ga0501268_027428 3300049765 Bacteria 1012
639 Ga0501268_074900 3300049765 Bacteria 690
640 Ga0501270_011605 3300049767 Bacteria 1186
641 nmdc:mga0a205_696_c1 3300050515 Bacteria 26947
642 Ga0500658_0000022 3300053134 Bacteria 129341
643 Ga0466962_0003586 3300061719 Bacteria 7399
644 JGI24737J22298_10014981
645 JGI24736J21556_1000837
646 JGI24736J21556_1006172
647 JGI24741J21665_1016253
648 JGI24740J21852_10015137
649 JGI24739J22299_10001929
650 JGI24739J22299_10010471
651 JGI24737J22298_10000009
652 JGI24737J22298_10014081
653 JGI24737J22298_10034217
654 JGI24750J21931_1016910
655 JGI24738J21930_10000253
656 JGI24035J26624_1008194
657 JGI24034J26672_10011657
658 Ga0065712_10523278
659 Ga0065715_10063630
660 Ga0065715_10233251
661 Ga0065715_10243197
662 Ga0070658_10003625
663 Ga0070658_10027439
664 Ga0070658_10069201
665 Ga0070658_10109670
666 Ga0070658_10260960
667 Ga0070658_10284715
668 Ga0070658_10315925
669 Ga0070658_10332317
670 Ga0070658_10625441
671 Ga0070676_10000682
672 Ga0070676_10001819
673 Ga0070683_100064121
674 Ga0070670_100031717
675 Ga0070670_100048480
676 Ga0070670_100113728
677 Ga0068869_100000292
678 Ga0068869_100080302
679 Ga0068869_100432704
680 Ga0070666_10011535
681 Ga0070666_10038107
682 Ga0070680_100260838
683 Ga0070682_100283156
684 Ga0068868_100000321
685 Ga0070660_100000787
686 Ga0070660_100009451
687 Ga0070660_100020315
688 Ga0070660_100062569
689 Ga0070660_100277700
690 Ga0070660_100394232
691 Ga0070687_100510230
692 Ga0070661_100010470
693 Ga0070661_100194077
694 Ga0070661_100250922
695 Ga0070661_100317856
696 Ga0070661_100483865
697 Ga0070692_10004587
698 Ga0070692_10015285
699 Ga0070692_10199501
700 Ga0070668_100005718
701 Ga0070668_100011865
702 Ga0070668_100012237
703 Ga0070668_100113149
704 Ga0070668_100280733
705 Ga0070669_100000605
706 Ga0070669_100031423
707 Ga0070669_100066707
708 Ga0070669_100096990
709 Ga0070669_100823733
710 Ga0070675_100019379
711 Ga0070675_100075959
712 Ga0070675_100087131
713 Ga0070675_100244934
714 Ga0070671_100035841
715 Ga0070671_100045985
716 Ga0070671_100065877
717 Ga0070673_100000569
718 Ga0070673_100021850
719 Ga0070673_100044749
720 Ga0070673_100140940
721 Ga0070673_100334410
722 Ga0070659_100000469
723 Ga0070659_100007716
724 Ga0070659_100016674
725 Ga0070659_100047690
726 Ga0070659_100138074
727 Ga0070659_100297766
728 Ga0070659_100805592
729 Ga0070667_100006049
730 Ga0070667_100009802
731 Ga0070667_100027604
732 Ga0070667_100048131
733 Ga0070667_100067525
734 Ga0070694_100007767
735 Ga0070663_100003840
736 Ga0070663_100009228
737 Ga0070663_100066755
738 Ga0070663_100069115
739 Ga0070663_100522007
740 Ga0070663_100547223
741 Ga0070678_100209369
742 Ga0070678_100618855
743 Ga0070662_100000146
744 Ga0070662_100000625
745 Ga0070662_100007041
746 Ga0070662_100030328
747 Ga0070662_100034084
748 Ga0070662_100179833
749 Ga0070681_10150961
750 Ga0068867_100000045
751 Ga0068867_100018109
752 Ga0068867_100096502
753 Ga0068867_100353356
754 Ga0070685_10205730
755 Ga0070706_100258186
756 Ga0070679_100111452
757 Ga0070679_100321041
758 Ga0068853_100000162
759 Ga0068853_100101480
760 Ga0068853_100267628
761 Ga0068853_100290595
762 Ga0068853_100403275
763 Ga0070672_100000041
764 Ga0070672_100064740
765 Ga0070672_100067286
766 Ga0070672_100174446
767 Ga0070672_100218468
768 Ga0070686_100216416
769 Ga0070696_100006917
770 Ga0070693_100051506
771 Ga0070693_100356524
772 Ga0070665_100001627
773 Ga0070665_100002713
774 Ga0070665_100020194
775 Ga0070665_100065524
776 Ga0070665_101196137
777 Ga0068855_100011617
778 Ga0068855_100049424
779 Ga0068855_100072813
780 Ga0068855_100268531
781 Ga0068855_100579110
782 Ga0068855_101257617
783 Ga0070664_100013986
784 Ga0070664_100053065
785 Ga0070664_100467622
786 Ga0068857_100001494
787 Ga0068857_100020446
788 Ga0068857_100052857
789 Ga0068857_100063138
790 Ga0068857_100555732
791 Ga0068854_100000234
792 Ga0068854_100005397
793 Ga0068854_100021446
794 Ga0068856_100121263
795 Ga0068856_100153234
796 Ga0070702_100225703
797 Ga0068852_100000803
798 Ga0068852_100013867
799 Ga0068852_100018832
800 Ga0068852_100030474
801 Ga0068852_100050698
802 Ga0068852_100273766
803 Ga0068859_100000088
804 Ga0068859_100000709
805 Ga0068859_100005111
806 Ga0068859_100266100
807 Ga0068859_100502409
808 Ga0068864_100000092
809 Ga0068864_100000484
810 Ga0068864_100003437
811 Ga0068864_100353270
812 Ga0068866_10016554
813 Ga0068866_10045693
814 Ga0068866_10524135
815 Ga0068861_100065464
816 Ga0068861_100100331
817 Ga0068851_10165037
818 Ga0068851_10171045
819 Ga0068870_10508663
820 Ga0068863_100001372
821 Ga0068863_100006606
822 Ga0068863_100014719
823 Ga0068863_100038431
824 Ga0068863_100147126
825 Ga0068858_100000063
826 Ga0068858_100004386
827 Ga0068858_100018374
828 Ga0068858_100028491
829 Ga0068858_100406511
830 Ga0068858_100443713
831 Ga0068860_100001353
832 Ga0068860_100013708
833 Ga0068860_100020068
834 Ga0068860_100050702
835 Ga0068860_100107926
836 Ga0068860_100420566
837 Ga0068862_100001114
838 Ga0068862_100001902
839 Ga0068862_100009104
840 Ga0068862_100054114
841 Ga0068862_100082848
842 Ga0068862_100083972
843 Ga0068862_100101043
844 Ga0068862_100133996
845 Ga0068862_100346889
846 Ga0068862_100494852
847 Ga0097621_100043495
848 Ga0097621_100067851
849 Ga0097621_100082423
850 Ga0068871_100039025
851 Ga0068871_100044603
852 Ga0068871_100348627
853 Ga0075428_100100496
854 Ga0075431_100699235
855 Ga0075433_10003509
856 Ga0068865_100007472
857 Ga0068865_100198134
858 Ga0097620_100000088
859 Ga0097620_100000709
860 Ga0097620_100005111
861 Ga0097620_100266120
862 Ga0097620_100502390
863 Ga0075435_100902465
864 Ga0105250_10037764
865 Ga0105240_10014883
866 Ga0105240_10134707
867 Ga0105245_10000062
868 Ga0105247_10070468
869 Ga0105247_10151255
870 Ga0105243_10317129
871 Ga0105241_10044983
872 Ga0105242_10096286
873 Ga0105242_10124748
874 Ga0105248_10000122
875 Ga0105248_10000169
876 Ga0105248_10074910
877 Ga0105248_10716999
878 Ga0105237_10058758
879 Ga0105237_10536083
880 Ga0105238_10004520
881 Ga0105238_10271684
882 Ga0105249_10048401
883 Ga0105249_10118535
884 Ga0105032_102943
885 Ga0105239_10055715
886 Ga0105239_10415258
887 Ga0105246_10005136
888 Ga0105246_10071387
889 Ga0157373_10007055
890 Ga0157373_10017853
891 Ga0157373_10037585
892 Ga0157373_10040110
893 Ga0157373_10041793
894 Ga0157373_10063214
895 Ga0157373_10689358
896 Ga0157371_10001576
897 Ga0157371_10012795
898 Ga0157371_10055171
899 Ga0157371_10070854
900 Ga0157371_10132348
901 Ga0157371_10414275
902 Ga0157370_10066225
903 Ga0157370_10069885
904 Ga0157370_10260778
905 Ga0157369_10032158
906 Ga0157369_10225683
907 Ga0157378_10000242
908 Ga0157378_10941186
909 Ga0163162_10148366
910 Ga0163162_10372739
911 Ga0163162_10472442
912 Ga0157372_10127374
913 Ga0157372_10190012
914 Ga0157372_10225794
915 Ga0157372_10560289
916 Ga0157372_10712943
917 Ga0157372_10932169
918 Ga0157375_10125711
919 Ga0157375_10171420
920 Ga0157375_10229296
921 Ga0157375_10366944
922 Ga0163163_10000080
923 Ga0163163_10261983
924 Ga0157380_10198807
925 Ga0157380_10911866
926 Ga0157377_10041438
927 Ga0157379_10000979
928 Ga0157379_10003979
929 Ga0163161_10275018
930 Ga0206354_10444197
931 Ga0213875_10005718
932 Ga0207673_1003360
933 Ga0207697_10000002
934 Ga0207656_10165612
935 Ga0207642_10046967
936 Ga0207710_10115242
937 Ga0207688_10000493
938 Ga0207688_10055837
939 Ga0207680_10015740
940 Ga0207647_10000095
941 Ga0207647_10000304
942 Ga0207647_10007324
943 Ga0207645_10002830
944 Ga0207645_10005035
945 Ga0207645_10008706
946 Ga0207645_10038485
947 Ga0207643_10046768
948 Ga0207705_10007826
949 Ga0207705_10008141
950 Ga0207705_10012192
951 Ga0207705_10034383
952 Ga0207705_10564123
953 Ga0207705_10903153
954 Ga0207684_10195691
955 Ga0207654_10078399
956 Ga0207654_10186282
957 Ga0207695_10001271
958 Ga0207695_10006302
959 Ga0207671_10024208
960 Ga0207657_10002150
961 Ga0207657_10003663
962 Ga0207657_10004622
963 Ga0207657_10014398
964 Ga0207657_10017078
965 Ga0207657_10017592
966 Ga0207649_10000176
967 Ga0207649_10013030
968 Ga0207649_10272742
969 Ga0207681_10001335
970 Ga0207681_10009578
971 Ga0207681_10064311
972 Ga0207681_10155675
973 Ga0207681_10185925
974 Ga0207681_10217917
975 Ga0207681_10240721
976 Ga0207681_10245664
977 Ga0207694_10018909
978 Ga0207694_10130885
979 Ga0207650_10046104
980 Ga0207650_10095835
981 Ga0207650_10563428
982 Ga0207659_10014880
983 Ga0207659_10090961
984 Ga0207659_10750507
985 Ga0207687_10007316
986 Ga0207687_10232762
987 Ga0207644_10013630
988 Ga0207644_10014092
989 Ga0207644_10028233
990 Ga0207644_10242759
991 Ga0207690_10002193
992 Ga0207690_10017149
993 Ga0207690_10019414
994 Ga0207690_10038109
995 Ga0207690_10042160
996 Ga0207690_10152880
997 Ga0207706_10001976
998 Ga0207706_10043323
999 Ga0207706_10052024
1000 Ga0207706_10053933
1001 Ga0207706_10068186
1002 Ga0207706_10324530
1003 Ga0207686_10504119
1004 Ga0207709_10071068
1005 Ga0207670_10245319
1006 Ga0207669_10504901
1007 Ga0207704_10030622
1008 Ga0207691_10000133
1009 Ga0207691_10023380
1010 Ga0207691_10059576
1011 Ga0207691_10060280
1012 Ga0207691_10206167
1013 Ga0207711_10000543
1014 Ga0207711_10098260
1015 Ga0207689_10000002
1016 Ga0207689_10024146
1017 Ga0207689_10131983
1018 Ga0207661_10186579
1019 Ga0207679_10016457
1020 Ga0207679_10270777
1021 Ga0207679_10396822
1022 Ga0207679_11076846
1023 Ga0207667_10015149
1024 Ga0207667_10020691
1025 Ga0207667_10029434
1026 Ga0207667_10091767
1027 Ga0207667_10114384
1028 Ga0207667_10313459
1029 Ga0207651_10000761
1030 Ga0207651_10342172
1031 Ga0207651_10418464
1032 Ga0207651_10485652
1033 Ga0207651_10772483
1034 Ga0207712_10046019
1035 Ga0207712_10085485
1036 Ga0207712_10354790
1037 Ga0207668_10000176
1038 Ga0207668_10004436
1039 Ga0207668_10021164
1040 Ga0207668_10038667
1041 Ga0207668_10104238
1042 Ga0207668_10184754
1043 Ga0207668_10276511
1044 Ga0207668_10416962
1045 Ga0207640_10001097
1046 Ga0207640_10015834
1047 Ga0207640_10025092
1048 Ga0207640_10038460
1049 Ga0207640_10194753
1050 Ga0207640_10368470
1051 Ga0207658_10002392
1052 Ga0207658_10003231
1053 Ga0207658_10028391
1054 Ga0207658_10065164
1055 Ga0207658_10071148
1056 Ga0207658_10110539
1057 Ga0207658_10541820
1058 Ga0207677_10056763
1059 Ga0207677_10188122
1060 Ga0207703_10002878
1061 Ga0207703_10003215
1062 Ga0207703_10015939
1063 Ga0207703_10019655
1064 Ga0207639_10123686
1065 Ga0207639_10176929
1066 Ga0207639_10237139
1067 Ga0207639_10305982
1068 Ga0207639_10364787
1069 Ga0207678_10001437
1070 Ga0207678_10002737
1071 Ga0207678_10016526
1072 Ga0207678_10237657
1073 Ga0207678_10252648
1074 Ga0207678_10447589
1075 Ga0207702_10004984
1076 Ga0207702_10012720
1077 Ga0207702_10065279
1078 Ga0207702_10485167
1079 Ga0207641_10000138
1080 Ga0207641_10019138
1081 Ga0207641_10066366
1082 Ga0207641_10235348
1083 Ga0207648_10000088
1084 Ga0207648_10001235
1085 Ga0207648_10111646
1086 Ga0207648_10349833
1087 Ga0207676_10000245
1088 Ga0207676_10001781
1089 Ga0207676_10002000
1090 Ga0207676_10054821
1091 Ga0207676_10261618
1092 Ga0207674_10000742
1093 Ga0207674_10001363
1094 Ga0207674_10001622
1095 Ga0207674_10008869
1096 Ga0207674_10027930
1097 Ga0207674_10050994
1098 Ga0207674_10322481
1099 Ga0207675_100123805
1100 Ga0207675_100336443
1101 Ga0207675_100396990
1102 Ga0207675_100421689
1103 Ga0207675_101159036
1104 Ga0207683_10687315
1105 Ga0207698_10002332
1106 Ga0207698_10011901
1107 Ga0207698_10020626
1108 Ga0207698_10021859
1109 Ga0207698_10094813
1110 Ga0209974_10014113
1111 Ga0268266_10000998
1112 Ga0268266_10014168
1113 Ga0268266_10070173
1114 Ga0268266_10678426
1115 Ga0268265_10000904
1116 Ga0268265_10001512
1117 Ga0268265_10003742
1118 Ga0268265_10048556
1119 Ga0268265_10061381
1120 Ga0268265_10064024
1121 Ga0268265_10100879
1122 Ga0268265_10105797
1123 Ga0268265_10108113
1124 Ga0268265_10156085
1125 Ga0268264_10000644
1126 Ga0268264_10001156
1127 Ga0268264_10016372
1128 Ga0268264_10147111
1129 Ga0268264_10209544
1130 Ga0268264_10413119
1131 Ga0307513_10253707
1132 Ga0307408_100057951
1133 Ga0307408_100167777
1134 Ga0307408_100220419
1135 Ga0307408_100390291
1136 Ga0307405_10004653
1137 Ga0307405_10026647
1138 Ga0307405_10063313
1139 Ga0307405_10064745
1140 Ga0307405_10278475
1141 Ga0307405_10305962
1142 Ga0307413_10003269
1143 Ga0307413_10019488
1144 Ga0307413_10059103
1145 Ga0307413_10081363
1146 Ga0307413_10353782
1147 Ga0307413_10398516
1148 Ga0307413_10494617
1149 Ga0307410_10008709
1150 Ga0307410_10049242
1151 Ga0307410_10064847
1152 Ga0307410_10306702
1153 Ga0307410_10511498
1154 Ga0307410_10720315
1155 Ga0307406_10012458
1156 Ga0307406_10097789
1157 Ga0307406_10109010
1158 Ga0307406_10116074
1159 Ga0307406_10219695
1160 Ga0307406_10220990
1161 Ga0307406_10299710
1162 Ga0307406_10521166
1163 Ga0307407_10002051
1164 Ga0307407_10018369
1165 Ga0307407_10022165
1166 Ga0307407_10037113
1167 Ga0307407_10268022
1168 Ga0307407_10391044
1169 Ga0307407_10533228
1170 Ga0307412_10005326
1171 Ga0307412_10022110
1172 Ga0307412_10086792
1173 Ga0307412_10181396
1174 Ga0307412_10272271
1175 Ga0307412_10364851
1176 Ga0307412_10411318
1177 Ga0307412_10502622
1178 Ga0307409_100007495
1179 Ga0307409_100007807
1180 Ga0307409_100095529
1181 Ga0307409_100213473
1182 Ga0307409_100731813
1183 Ga0307409_101182958
1184 Ga0307416_100005298
1185 Ga0307416_100090928
1186 Ga0307416_100306127
1187 Ga0307416_100355521
1188 Ga0307416_100888822
1189 Ga0307416_101052810
1190 Ga0307416_101236736
1191 Ga0307414_10025193
1192 Ga0307414_10053067
1193 Ga0307414_10063583
1194 Ga0307414_10073003
1195 Ga0307414_10246817
1196 Ga0307414_10274259
1197 Ga0307414_10356217
1198 Ga0307414_10442041
1199 Ga0307414_10471274
1200 Ga0307414_10863247
1201 Ga0307411_10003751
1202 Ga0307411_10008328
1203 Ga0307411_10010970
1204 Ga0307411_10046528
1205 Ga0307411_10060964
1206 Ga0307411_10170733
1207 Ga0307411_10423507
1208 Ga0307411_10674536
1209 Ga0307415_100004960
1210 Ga0307415_100086680
1211 Ga0307415_100090757
1212 Ga0307415_100154860
1213 Ga0307415_100360446
1214 Ga0307415_101091600
1215 Ga0395899_0000352
1216 Ga0395899_0013148
1217 Ga0395899_0027246
1218 Ga0395899_0084144
1219 Ga0395899_0713334
1220 Ga0395900_0000944
1221 Ga0395900_0028743
1222 Ga0395900_0037739
1223 Ga0395900_0047572
1224 Ga0395900_0096770
1225 Ga0395900_0148028
1226 Ga0395900_0160822
1227 Ga0395900_0193272
1228 Ga0395900_0538853
1229 Ga0395898_0003377
1230 Ga0395898_0039238
1231 Ga0395898_0136754
1232 Ga0395898_0178177
1233 Ga0395898_0190168
1234 Ga0395898_0801718
1235 Ga0395905_0011129
1236 Ga0395905_0069108
1237 Ga0395905_0140814
1238 Ga0395905_0188137
1239 Ga0395905_0300669
1240 Ga0395905_0542135
1241 Ga0395905_0569378
1242 Ga0436364_0072780
1243 Ga0395901_0000047
1244 Ga0395901_0062886
1245 Ga0395901_0096499
1246 Ga0395901_0108455
1247 Ga0395901_0519377
1248 Ga0395901_0705018
1249 Ga0450890_010158
1250 Ga0450905_002018
1251 Ga0450889_000168
1252 Ga0439464_0003608
1253 Ga0466969_0002712
1254 Ga0466966_0013669
1255 Ga0466963_0022868
1256 Ga0466963_0054287
1257 Ga0466964_0006134
1258 Ga0466971_0020939
1259 Ga0466970_0007971
1260 Ga0466957_0021119
1261 Ga0466960_0120420
1262 Ga0466959_0020961
1263 Ga0466959_0068337
1264 Ga0466958_0002133
1265 Ga0495598_0008531
1266 Ga0495669_0022903
1267 Ga0495669_0178836
1268 Ga0496100_0771542
1269 Ga0496101_0370300
1270 Ga0496102_0044495
1271 Ga0496103_0113088
1272 Ga0496104_0134011
1273 Ga0496107_0056919
1274 Ga0496107_0340149
1275 Ga0496108_0448469
1276 Ga0496110_0010854
1277 Ga0496111_0026061
1278 Ga0496113_0010953
1279 Ga0501068_0280258
1280 Ga0501249_071132
1281 Ga0501268_027428
1282 Ga0501268_074900
1283 Ga0501270_011605
1284 nmdc:mga0a205_696_c1
1285 Ga0500658_0000022
1286 Ga0466962_0003586

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

84

194

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uwv-assembly5.cif.gz_C crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8972 68 177
5uwv-assembly2.cif.gz_A crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8938 68 177
5uwv-assembly1.cif.gz_B crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8929 69 177
5uwv-assembly4.cif.gz_E crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.8929 68 177
4gsq-assembly1.cif.gz_A structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains 0.8872 68 177
ID Description Score Start End Superfamily
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8812 69 177 2.40.440.10
6iywC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8753 68 177 2.40.440.10
4jmxA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8677 69 177 2.40.440.10
6d5aA03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8542 68 179 2.40.440.10
6d51A02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8451 69 177 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A429V8V9-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9764 27 179 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A1H2QZ09-F1-model_v4 L,D-transpeptidase catalytic domain 0.9589 68 179 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A4Q2XAZ6-F1-model_v4 deleted 0.9578 66 177
AF-A0A520YEC3-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9568 54 179 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972
AF-A0A1X7GTC5-F1-model_v4 Lipoprotein-anchoring transpeptidase ErfK/SrfK 0.9565 51 177 GO:0005576
GO:0008360
GO:0016740
GO:0018104
GO:0071555
GO:0071972

Map