F471963

General Info

Members Datasets Scaffolds Average Seq Length
643 356 1284 243

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10168115|Ga0307405_101681152
Length 273
Sequence LRPGRIFLYVTYTDPFTYERMSITGNGVIVGKLDGKVAVITGGSTGLALAGAKLFVDEGAYVFIQARRQEALDDAVKLIGRNVTAVQGDAAELDDLDRLFDTVKREKGSIDVLWASAGMGEPAVLGEITEEQFHRAFSLNARGTLFTVQKALPLINDNGSILMTGSNASLGAFPGWSLYAGSKAVQQAWARVWLNELRDRRIRVNVLTPGQVATAKQQELFDEATRSAFESLIPRGEMGRPEEIASIALFLASDDSSYVNGLELVADGGTTAL

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
207 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
291 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
294 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
295 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
298 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
300 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
301 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
302 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
303 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
304 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
310 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
311 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
312 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
313 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
317 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
318 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 2508501039 Frankia saprophytica CN3 Isolate Nodule
322 2517572101 Frankia sp. DC12 Isolate Nodule
323 2558860280 Kutzneria sp. 744 Isolate Unclassified
324 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
325 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
326 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
327 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
328 2643221607 Rhizobium sp. Root73 Isolate Unclassified
329 2643221647 Streptomyces sp. Root369 Isolate Unclassified
330 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
331 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
332 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
333 2687453737 Frankia sp. BMG5.36 Isolate Nodule
334 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
335 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
336 2738541293 Rhizobium sp. GV031 Isolate Unclassified
337 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
338 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
339 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
340 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
341 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
342 2862574272 Streptomyces sp. AcE210 Isolate Nodule
343 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
344 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
345 2919085039 Luteibacter sp. 1214 Isolate Unclassified
346 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
347 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
348 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
349 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
350 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
351 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
352 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
353 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
354 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
355 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
356 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 1.09
Isolates 5.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 1.71
Rhizoplane 6.22
Rhizosphere 69.36
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10168115 3300031731 Bacteria 1561
2 JGI24739J22299_10002752 3300001989 Bacteria 6762
3 JGI24737J22298_10027289 3300001990 Bacteria 1801
4 JGI24751J29686_10015835 3300002459 Bacteria 1555
5 JGI25151J46595_10098038 3300003187 Unclassified 797
6 rootH1_10079142 3300003316 Bacteria 7746
7 rootH2_10230140 3300003320 Unclassified 2291
8 rootH2_10267319 3300003320 Bacteria 1517
9 rootH1_10071420 3300003323 Bacteria 3528
10 rootH1_10165931 3300003323 Unclassified 3845
11 rootH1_10286776 3300003323 Bacteria 3651
12 Ga0007416J51690_1009241 3300003577 Bacteria 813
13 Ga0007411J51799_106219 3300003611 Bacteria 825
14 Ga0055542_1000439 3300003762 Bacteria 39835
15 Ga0065714_10030916 3300005288 Bacteria 1356
16 Ga0070683_100326623 3300005329 Bacteria 1460
17 Ga0070666_10010743 3300005335 Bacteria 5729
18 Ga0070671_100000949 3300005355 Bacteria 21211
19 Ga0070674_100409687 3300005356 Bacteria 1110
20 Ga0070667_100000308 3300005367 Bacteria 54638
21 Ga0070714_100019981 3300005435 Bacteria 5465
22 Ga0070714_100054094 3300005435 Bacteria 3429
23 Ga0070714_100063694 3300005435 Bacteria 3171
24 Ga0070714_100339925 3300005435 Bacteria 1408
25 Ga0070714_100497129 3300005435 Bacteria 1163
26 Ga0070713_100128517 3300005436 Bacteria 2232
27 Ga0070713_100576844 3300005436 Bacteria 1067
28 Ga0070710_10288389 3300005437 Bacteria 1067
29 Ga0070711_100111142 3300005439 Bacteria 2012
30 Ga0070700_100328262 3300005441 Bacteria 1127
31 Ga0070663_100118299 3300005455 Bacteria 1999
32 Ga0070663_100189552 3300005455 Bacteria 1599
33 Ga0070678_100516959 3300005456 Bacteria 1056
34 Ga0070679_100005317 3300005530 Bacteria 11917
35 Ga0070679_100136007 3300005530 Bacteria 2439
36 Ga0070679_100554525 3300005530 Bacteria 1093
37 Ga0070665_100108097 3300005548 Bacteria 2784
38 Ga0070665_100179527 3300005548 Bacteria 2118
39 Ga0068855_100042178 3300005563 Bacteria 5406
40 Ga0068855_100669726 3300005563 Bacteria 1113
41 Ga0070664_100136957 3300005564 Bacteria 2153
42 Ga0068856_100525393 3300005614 Bacteria 1205
43 Ga0068852_100050125 3300005616 Bacteria 3575
44 Ga0068852_100101469 3300005616 Bacteria 2598
45 Ga0068859_100006027 3300005617 Bacteria 12313
46 Ga0068864_100320816 3300005618 Bacteria 1455
47 Ga0068858_100002726 3300005842 Bacteria 17777
48 Ga0068860_100000155 3300005843 Bacteria 111737
49 Ga0068862_100000096 3300005844 Bacteria 104906
50 Ga0081540_1022853 3300005983 Bacteria 3680
51 Ga0070717_10136297 3300006028 Unclassified 2114
52 Ga0075365_10012747 3300006038 Bacteria 5004
53 Ga0075365_10032306 3300006038 Bacteria 3363
54 Ga0075363_100058089 3300006048 Bacteria 2077
55 Ga0075364_10037286 3300006051 Bacteria 3147
56 Ga0070716_100035357 3300006173 Bacteria 2746
57 Ga0070712_100033901 3300006175 Bacteria 3457
58 Ga0070712_100178141 3300006175 Bacteria 1654
59 Ga0075362_10013512 3300006177 Bacteria 3270
60 Ga0075369_10089581 3300006186 Bacteria 1372
61 Ga0075370_10014473 3300006353 Bacteria 4209
62 Ga0075434_100918859 3300006871 Bacteria 890
63 Ga0097620_100006027 3300006931 Bacteria 12313
64 Ga0099826_10268791 3300006948 Bacteria 888
65 Ga0099795_10010741 3300007788 Bacteria 2709
66 Ga0099795_10094914 3300007788 Bacteria 1161
67 Ga0105240_10201565 3300009093 Bacteria 2331
68 Ga0105240_10743114 3300009093 Bacteria 1067
69 Ga0105240_10780583 3300009093 Bacteria 1036
70 Ga0105245_10590819 3300009098 Bacteria 1136
71 Ga0105247_10000040 3300009101 Bacteria 158975
72 Ga0105241_10313280 3300009174 Bacteria 1351
73 Ga0105241_10406454 3300009174 Bacteria 1195
74 Ga0105248_10000095 3300009177 Bacteria 98093
75 Ga0105248_10137550 3300009177 Bacteria 2756
76 Ga0105248_10963290 3300009177 Bacteria 964
77 Ga0105237_10148880 3300009545 Bacteria 2336
78 Ga0105237_10232907 3300009545 Bacteria 1843
79 Ga0105237_10728712 3300009545 Bacteria 998
80 Ga0105238_10151181 3300009551 Bacteria 2297
81 Ga0105238_10152586 3300009551 Bacteria 2285
82 Ga0105238_10283619 3300009551 Bacteria 1638
83 Ga0105238_10714340 3300009551 Bacteria 1015
84 Ga0105249_10000069 3300009553 Bacteria 148118
85 Ga0099796_10066653 3300010159 Bacteria 1290
86 Ga0105239_10181186 3300010375 Bacteria 2357
87 Ga0105239_10363307 3300010375 Bacteria 1635
88 Ga0105239_10578964 3300010375 Bacteria 1280
89 Ga0105246_10033294 3300011119 Bacteria 3424
90 Ga0157342_1014844 3300012507 Bacteria 847
91 Ga0157370_10000317 3300013104 Bacteria 60594
92 Ga0157370_10026255 3300013104 Bacteria 5754
93 Ga0157370_10157873 3300013104 Bacteria 2110
94 Ga0157369_10407593 3300013105 Bacteria 1410
95 Ga0157369_10409534 3300013105 Bacteria 1406
96 Ga0157374_10278718 3300013296 Bacteria 1650
97 Ga0163162_10105490 3300013306 Bacteria 2913
98 Ga0163162_10170835 3300013306 Bacteria 2299
99 Ga0163162_10181355 3300013306 Bacteria 2232
100 Ga0157375_10077352 3300013308 Bacteria 3357
101 Ga0157375_10240458 3300013308 Bacteria 1970
102 Ga0163163_10014016 3300014325 Bacteria 7355
103 Ga0163163_10580939 3300014325 Bacteria 1184
104 Ga0157380_10835954 3300014326 Bacteria 941
105 Ga0157379_10025856 3300014968 Bacteria 5219
106 Ga0182005_1000004 3300015265 Bacteria 609645
107 Ga0206356_11243581 3300020070 Bacteria 861
108 Ga0206353_11300916 3300020082 Bacteria 818
109 Ga0224712_10193976 3300022467 Bacteria 921
110 Ga0209233_1008225 3300025261 Bacteria 3241
111 Ga0209025_1001389 3300025294 Bacteria 32297
112 Ga0207655_1032430 3300025728 Bacteria 2387
113 Ga0207692_10050411 3300025898 Bacteria 2105
114 Ga0207642_10320638 3300025899 Bacteria 905
115 Ga0207710_10000050 3300025900 Bacteria 186453
116 Ga0207688_10136566 3300025901 Bacteria 1440
117 Ga0207647_10025551 3300025904 Bacteria 3878
118 Ga0207647_10033454 3300025904 Bacteria 3292
119 Ga0207647_10124806 3300025904 Bacteria 1516
120 Ga0207699_10059943 3300025906 Bacteria 2283
121 Ga0207699_10499563 3300025906 Bacteria 878
122 Ga0207645_10113300 3300025907 Bacteria 1757
123 Ga0207705_10338020 3300025909 Bacteria 1159
124 Ga0207654_10002481 3300025911 Bacteria 9375
125 Ga0207707_10123483 3300025912 Bacteria 2264
126 Ga0207695_10014892 3300025913 Bacteria 9179
127 Ga0207671_10001125 3300025914 Bacteria 32185
128 Ga0207671_10122616 3300025914 Bacteria 1987
129 Ga0207671_10265473 3300025914 Bacteria 1351
130 Ga0207671_10594749 3300025914 Bacteria 882
131 Ga0207693_10043227 3300025915 Bacteria 3546
132 Ga0207693_10295167 3300025915 Bacteria 1270
133 Ga0207693_10533809 3300025915 Bacteria 915
134 Ga0207663_10077835 3300025916 Bacteria 2160
135 Ga0207663_10081704 3300025916 Bacteria 2117
136 Ga0207660_10580727 3300025917 Bacteria 912
137 Ga0207657_10606321 3300025919 Bacteria 854
138 Ga0207652_10067625 3300025921 Bacteria 3098
139 Ga0207652_10512592 3300025921 Bacteria 1079
140 Ga0207681_10002841 3300025923 Bacteria 10957
141 Ga0207694_10101413 3300025924 Bacteria 2281
142 Ga0207694_10288478 3300025924 Bacteria 1349
143 Ga0207650_10091927 3300025925 Bacteria 2320
144 Ga0207687_10069301 3300025927 Bacteria 2515
145 Ga0207687_10120347 3300025927 Bacteria 1962
146 Ga0207700_10280462 3300025928 Bacteria 1433
147 Ga0207664_10002394 3300025929 Bacteria 12407
148 Ga0207664_10022536 3300025929 Bacteria 4706
149 Ga0207664_10108015 3300025929 Bacteria 2310
150 Ga0207664_10190169 3300025929 Bacteria 1767
151 Ga0207664_10321894 3300025929 Bacteria 1365
152 Ga0207644_10089307 3300025931 Bacteria 2293
153 Ga0207709_10560423 3300025935 Bacteria 900
154 Ga0207665_10051276 3300025939 Bacteria 2776
155 Ga0207691_10080042 3300025940 Bacteria 2940
156 Ga0207691_10107009 3300025940 Bacteria 2490
157 Ga0207711_10000082 3300025941 Bacteria 102386
158 Ga0207689_10218716 3300025942 Bacteria 1574
159 Ga0207661_10477584 3300025944 Bacteria 1138
160 Ga0207679_10144966 3300025945 Bacteria 1925
161 Ga0207679_10608861 3300025945 Bacteria 985
162 Ga0207712_10000084 3300025961 Bacteria 107789
163 Ga0207640_10111051 3300025981 Bacteria 1943
164 Ga0207658_10000868 3300025986 Bacteria 25220
165 Ga0207703_11038697 3300026035 Bacteria 787
166 Ga0207678_10018048 3300026067 Bacteria 6199
167 Ga0207678_10195735 3300026067 Bacteria 1728
168 Ga0207678_10413101 3300026067 Bacteria 1170
169 Ga0207676_10513251 3300026095 Bacteria 1140
170 Ga0207674_10405816 3300026116 Bacteria 1317
171 Ga0207683_10121955 3300026121 Bacteria 2341
172 Ga0207698_10073403 3300026142 Bacteria 2724
173 Ga0268266_10059382 3300028379 Bacteria 3295
174 Ga0268266_10464642 3300028379 Bacteria 1204
175 Ga0268265_10000106 3300028380 Bacteria 104924
176 Ga0268264_10000219 3300028381 Bacteria 111751
177 Ga0268264_10700813 3300028381 Bacteria 1006
178 Ga0265319_1017014 3300028563 Bacteria 2776
179 Ga0265336_10005155 3300028666 Bacteria 4856
180 Ga0265336_10045147 3300028666 Bacteria 1340
181 Ga0265336_10049927 3300028666 Bacteria 1266
182 Ga0307517_10044770 3300028786 Bacteria 4670
183 Ga0307517_10113193 3300028786 Bacteria 2049
184 Ga0307515_10000846 3300028794 Bacteria 70343
185 Ga0307515_10049581 3300028794 Bacteria 6311
186 Ga0307515_10061669 3300028794 Bacteria 5313
187 Ga0265338_10003900 3300028800 Bacteria 20610
188 Ga0265338_10017188 3300028800 Bacteria 7813
189 Ga0265338_10021357 3300028800 Bacteria 6755
190 Ga0265338_10042925 3300028800 Bacteria 4203
191 Ga0265338_10107746 3300028800 Bacteria 2252
192 Ga0307511_10003090 3300030521 Bacteria 17155
193 Ga0307511_10141165 3300030521 Bacteria 1415
194 Ga0307512_10004311 3300030522 Bacteria 15692
195 Ga0307512_10007896 3300030522 Bacteria 10457
196 Ga0265760_10076694 3300031090 Bacteria 1031
197 Ga0265330_10027609 3300031235 Bacteria 2564
198 Ga0307513_10001603 3300031456 Bacteria 32478
199 Ga0307513_10069471 3300031456 Bacteria 3686
200 Ga0307513_10331367 3300031456 Bacteria 1276
201 Ga0307509_10013229 3300031507 Bacteria 9791
202 Ga0307509_10023765 3300031507 Bacteria 6872
203 Ga0307509_10093453 3300031507 Bacteria 3069
204 Ga0307508_10001782 3300031616 Bacteria 23942
205 Ga0307508_10009013 3300031616 Bacteria 9193
206 Ga0307508_10139501 3300031616 Bacteria 2028
207 Ga0307508_10156550 3300031616 Bacteria 1882
208 Ga0307508_10352832 3300031616 Bacteria 1062
209 Ga0307514_10023311 3300031649 Bacteria 5022
210 Ga0307516_10051225 3300031730 Bacteria 4047
211 Ga0307507_10001954 3300033179 Bacteria 44758
212 Ga0307507_10027336 3300033179 Bacteria 6119
213 Ga0307507_10036156 3300033179 Bacteria 5055
214 Ga0307507_10053550 3300033179 Bacteria 3854
215 Ga0307510_10004939 3300033180 Bacteria 15782
216 Ga0307510_10049355 3300033180 Bacteria 4477
217 Ga0307510_10152891 3300033180 Bacteria 1922
218 Ga0373934_0096245 3300035086 Bacteria 1195
219 Ga0373951_0000086 3300035091 Bacteria 36308
220 Ga0373923_0201848 3300035111 Bacteria 919
221 Ga0373936_0005116 3300035113 Bacteria 4936
222 Ga0373954_0017921 3300035118 Bacteria 3185
223 Ga0373957_0085805 3300035120 Bacteria 1246
224 Ga0373924_0043622 3300035410 Bacteria 1842
225 Ga0373931_0083630 3300035691 Bacteria 1766
226 Ga0373935_0539601 3300035692 Bacteria 849
227 Ga0373947_0472048 3300035725 Bacteria 851
228 Ga0373937_0814442 3300036401 Bacteria 882
229 Ga0372808_005661 3300036459 Bacteria 1656
230 Ga0373925_0000101 3300037068 Bacteria 92997
231 Ga0373925_0016708 3300037068 Bacteria 5314
232 Ga0373925_0026933 3300037068 Bacteria 4208
233 Ga0373925_0320429 3300037068 Bacteria 1254
234 Ga0395900_0308999 3300037418 Bacteria 1565
235 Ga0395905_0556059 3300037471 Bacteria 1049
236 Ga0436361_0991054 3300039447 Bacteria 1543
237 Ga0451793_0467648 3300041452 Bacteria 850
238 Ga0451807_1482729 3300041486 Bacteria 855
239 Ga0451843_0099427 3300041509 Bacteria 1008
240 Ga0451853_0325620 3300041512 Bacteria 7501
241 Ga0466968_0070735 3300044735 Bacteria 1519
242 Ga0466960_0220887 3300044901 Bacteria 1043
243 Ga0495617_060796 3300046452 Bacteria 1250
244 Ga0495627_012618 3300046453 Bacteria 2993
245 Ga0495592_0009428 3300046454 Bacteria 7339
246 Ga0495592_0078488 3300046454 Bacteria 2391
247 Ga0495592_0204218 3300046454 Bacteria 1331
248 Ga0495603_0012178 3300046455 Bacteria 5208
249 Ga0495603_0018918 3300046455 Bacteria 4168
250 Ga0495603_0030542 3300046455 Bacteria 3244
251 Ga0495629_0011173 3300046459 Bacteria 6519
252 Ga0495629_0018578 3300046459 Bacteria 4972
253 Ga0495629_0038123 3300046459 Bacteria 3386
254 Ga0495629_0199901 3300046459 Bacteria 1382
255 Ga0495638_0023029 3300046460 Bacteria 4080
256 Ga0495638_0090222 3300046460 Bacteria 1848
257 Ga0495638_0122447 3300046460 Bacteria 1535
258 Ga0495651_0001042 3300046462 Bacteria 21445
259 Ga0495651_0161204 3300046462 Bacteria 1606
260 Ga0495651_0305234 3300046462 Bacteria 1066
261 Ga0495580_0234560 3300046472 Bacteria 1259
262 Ga0495605_0052376 3300046474 Bacteria 1983
263 Ga0495639_0239535 3300046475 Bacteria 895
264 Ga0495662_0009485 3300046476 Bacteria 4775
265 Ga0495662_0082663 3300046476 Bacteria 1563
266 Ga0495664_0000287 3300046477 Bacteria 24123
267 Ga0495664_0015673 3300046477 Bacteria 4311
268 Ga0495664_0294054 3300046477 Bacteria 981
269 Ga0495584_0061044 3300046491 Bacteria 1895
270 Ga0495594_0018231 3300046499 Bacteria 3716
271 Ga0495594_0058148 3300046499 Bacteria 2135
272 Ga0495594_0249448 3300046499 Bacteria 1011
273 Ga0495596_0034238 3300046500 Bacteria 2018
274 Ga0495607_0000003 3300046501 Bacteria 366900
275 Ga0495607_0006428 3300046501 Bacteria 8275
276 Ga0495583_0052521 3300046506 Bacteria 1853
277 Ga0495606_0013143 3300046507 Bacteria 6571
278 Ga0495606_0158149 3300046507 Bacteria 1324
279 Ga0495610_0003962 3300046512 Bacteria 11204
280 Ga0495610_0048209 3300046512 Bacteria 2092
281 Ga0495620_0010680 3300046515 Bacteria 4833
282 Ga0495620_0042467 3300046515 Bacteria 1986
283 Ga0495628_0078892 3300046516 Bacteria 2560
284 Ga0495628_0083641 3300046516 Bacteria 2477
285 Ga0495628_0118907 3300046516 Bacteria 2028
286 Ga0495631_0013587 3300046518 Bacteria 3948
287 Ga0495632_0000011 3300046519 Bacteria 266804
288 Ga0495632_0045284 3300046519 Bacteria 2192
289 Ga0495637_0142884 3300046520 Bacteria 907
290 Ga0495643_0064488 3300046522 Bacteria 1935
291 Ga0495644_0084886 3300046523 Bacteria 1194
292 Ga0495648_0015660 3300046524 Bacteria 5492
293 Ga0495648_0021550 3300046524 Bacteria 4459
294 Ga0495666_0007678 3300046526 Bacteria 5396
295 Ga0495666_0011577 3300046526 Bacteria 4397
296 Ga0495652_0008645 3300046529 Bacteria 9279
297 Ga0495652_0162927 3300046529 Bacteria 1729
298 Ga0495665_0007483 3300046531 Bacteria 5909
299 Ga0495640_0039687 3300046533 Bacteria 3301
300 Ga0495640_0085391 3300046533 Bacteria 2092
301 Ga0495640_0133563 3300046533 Bacteria 1604
302 Ga0495586_0108428 3300046535 Bacteria 1544
303 Ga0495587_0002208 3300046536 Bacteria 13009
304 Ga0495597_0082090 3300046542 Bacteria 1377
305 Ga0495645_0017306 3300046543 Bacteria 5162
306 Ga0495622_0005125 3300046557 Bacteria 6071
307 Ga0495667_0082116 3300046559 Bacteria 2094
308 Ga0495656_0083826 3300046615 Bacteria 1444
309 Ga0495668_0086279 3300046616 Bacteria 1721
310 Ga0495668_0139747 3300046616 Bacteria 1325
311 Ga0495668_0224633 3300046616 Bacteria 1028
312 Ga0495634_0002799 3300046642 Bacteria 14330
313 Ga0495634_0015769 3300046642 Bacteria 5417
314 Ga0495634_0352747 3300046642 Bacteria 881
315 Ga0495611_0243369 3300046648 Bacteria 835
316 Ga0495625_0070173 3300046660 Bacteria 2460
317 Ga0495625_0131059 3300046660 Bacteria 1698
318 Ga0495635_0018136 3300046663 Bacteria 4914
319 Ga0495635_0027949 3300046663 Bacteria 3922
320 Ga0495635_0028962 3300046663 Bacteria 3850
321 Ga0495659_0128384 3300046664 Bacteria 1004
322 Ga0495657_0003480 3300046675 Bacteria 12840
323 Ga0495657_0149755 3300046675 Bacteria 1449
324 Ga0495599_0052346 3300046678 Bacteria 2557
325 Ga0495599_0151737 3300046678 Bacteria 1434
326 Ga0495646_0020602 3300046680 Bacteria 4172
327 Ga0495613_0000388 3300046689 Bacteria 37773
328 Ga0495613_0004110 3300046689 Bacteria 10885
329 Ga0495671_0007655 3300046692 Bacteria 6133
330 Ga0495649_0036301 3300046694 Bacteria 2707
331 Ga0495649_0068614 3300046694 Bacteria 1902
332 Ga0495649_0070671 3300046694 Bacteria 1871
333 Ga0495589_0015740 3300046794 Bacteria 3888
334 Ga0495589_0059236 3300046794 Bacteria 1882
335 Ga0495600_0010883 3300046809 Bacteria 5658
336 Ga0495600_0011870 3300046809 Bacteria 5439
337 Ga0495660_0004309 3300046810 Bacteria 8627
338 Ga0495660_0142233 3300046810 Bacteria 1192
339 Ga0495581_0069558 3300047315 Bacteria 2035
340 Ga0495604_0000545 3300047317 Bacteria 33154
341 Ga0495604_0005331 3300047317 Bacteria 10194
342 Ga0495604_0180506 3300047317 Bacteria 1477
343 Ga0495604_0244205 3300047317 Bacteria 1226
344 Ga0495636_0064025 3300047318 Bacteria 1559
345 Ga0495674_0079786 3300047319 Bacteria 2809
346 Ga0495672_0003747 3300047320 Bacteria 12818
347 Ga0495676_0000488 3300047321 Bacteria 32524
348 Ga0495676_0000537 3300047321 Bacteria 31037
349 Ga0495676_0051310 3300047321 Bacteria 3301
350 Ga0495676_0105662 3300047321 Bacteria 2075
351 Ga0495683_0002011 3300047323 Bacteria 12617
352 Ga0495683_0092272 3300047323 Bacteria 1465
353 Ga0495687_002019 3300047443 Bacteria 17185
354 Ga0495687_015680 3300047443 Bacteria 3843
355 Ga0495687_017402 3300047443 Bacteria 3588
356 Ga0495687_047628 3300047443 Bacteria 1843
357 Ga0495675_0044013 3300047444 Bacteria 2843
358 Ga0495677_0018742 3300047445 Bacteria 2509
359 Ga0495685_004037 3300047447 Bacteria 4720
360 Ga0495685_006708 3300047447 Bacteria 3778
361 Ga0495685_043554 3300047447 Bacteria 1531
362 Ga0495673_0011418 3300047469 Bacteria 4775
363 Ga0495681_0002530 3300047470 Bacteria 13023
364 Ga0495681_0016827 3300047470 Bacteria 4080
365 Ga0495686_0063234 3300047472 Bacteria 2294
366 Ga0495686_0129789 3300047472 Bacteria 1495
367 Ga0495593_0000258 3300047673 Bacteria 28592
368 Ga0495602_0075504 3300048088 Bacteria 2860
369 Ga0495614_0002843 3300048089 Bacteria 7703
370 Ga0495614_0005593 3300048089 Bacteria 5666
371 Ga0495614_0100204 3300048089 Bacteria 1265
372 Ga0496100_0348756 3300048903 Bacteria 1117
373 Ga0496101_0000130 3300048904 Bacteria 70026
374 Ga0496101_0091574 3300048904 Bacteria 2263
375 Ga0496102_0000014 3300048905 Bacteria 310241
376 Ga0496102_0000716 3300048905 Bacteria 32822
377 Ga0496102_0027571 3300048905 Bacteria 5072
378 Ga0496102_0284295 3300048905 Bacteria 1559
379 Ga0496102_0523791 3300048905 Bacteria 1108
380 Ga0496103_0000004 3300048906 Bacteria 510080
381 Ga0496103_0000767 3300048906 Bacteria 23698
382 Ga0496103_0148920 3300048906 Bacteria 1499
383 Ga0496104_0133734 3300048907 Bacteria 2382
384 Ga0496104_0387593 3300048907 Bacteria 1310
385 Ga0496105_0056792 3300048908 Bacteria 3231
386 Ga0496105_0073852 3300048908 Bacteria 2817
387 Ga0496106_0058828 3300048909 Bacteria 2910
388 Ga0496106_0090731 3300048909 Bacteria 2358
389 Ga0496106_0640388 3300048909 Bacteria 850
390 Ga0496106_0738621 3300048909 Bacteria 783
391 Ga0496107_0019547 3300048910 Bacteria 4779
392 Ga0496107_0066239 3300048910 Bacteria 2619
393 Ga0496107_0088217 3300048910 Bacteria 2264
394 Ga0496108_0024849 3300048911 Bacteria 4933
395 Ga0496108_0140686 3300048911 Bacteria 2079
396 Ga0496109_0092370 3300048912 Bacteria 2799
397 Ga0496109_0345965 3300048912 Bacteria 1404
398 Ga0496109_0372284 3300048912 Bacteria 1349
399 Ga0496109_0377733 3300048912 Bacteria 1339
400 Ga0496110_0162349 3300048913 Bacteria 2025
401 Ga0496111_0006478 3300048914 Bacteria 7606
402 Ga0496111_0176789 3300048914 Bacteria 1587
403 Ga0496111_0246255 3300048914 Bacteria 1327
404 Ga0496112_0005279 3300048915 Bacteria 11142
405 Ga0496112_0121764 3300048915 Bacteria 2579
406 Ga0496112_0158609 3300048915 Bacteria 2229
407 Ga0496114_0119792 3300048917 Bacteria 2263
408 Ga0496115_0010369 3300048918 Bacteria 6961
409 Ga0496116_0000069 3300048919 Bacteria 252643
410 Ga0496116_0069768 3300048919 Bacteria 2233
411 Ga0496117_0000003 3300048920 Bacteria 1881097
412 Ga0496117_0000687 3300048920 Bacteria 54044
413 Ga0496117_0001629 3300048920 Bacteria 31716
414 Ga0496118_0000001 3300048921 Bacteria 1881100
415 Ga0496118_0001732 3300048921 Bacteria 31716
416 Ga0496118_0003018 3300048921 Bacteria 21736
417 Ga0496119_0000588 3300048922 Bacteria 49189
418 Ga0496119_0031696 3300048922 Bacteria 3537
419 Ga0496119_0038081 3300048922 Bacteria 3113
420 Ga0496120_0000085 3300048923 Bacteria 155343
421 Ga0496120_0014771 3300048923 Bacteria 5183
422 Ga0496121_0000032 3300048924 Bacteria 378997
423 Ga0496121_0006420 3300048924 Bacteria 14611
424 Ga0496121_0058734 3300048924 Bacteria 3177
425 Ga0496121_0120791 3300048924 Bacteria 1979
426 Ga0496122_0000495 3300048925 Bacteria 81902
427 Ga0496124_0001784 3300048927 Bacteria 29937
428 Ga0496124_0096079 3300048927 Bacteria 2407
429 Ga0496125_0090825 3300048928 Bacteria 2290
430 Ga0496126_0000006 3300048929 Bacteria 798804
431 Ga0496126_0000007 3300048929 Bacteria 787364
432 Ga0496126_0000067 3300048929 Bacteria 249091
433 Ga0496126_0044285 3300048929 Bacteria 4099
434 Ga0496126_0143568 3300048929 Bacteria 2052
435 Ga0496126_0243130 3300048929 Bacteria 1503
436 Ga0496126_0268072 3300048929 Bacteria 1418
437 Ga0495678_070981 3300049459 Bacteria 1277
438 Ga0495678_083088 3300049459 Bacteria 1145
439 Ga0501031_0001335 3300049568 Bacteria 15192
440 Ga0501031_0017651 3300049568 Bacteria 4640
441 Ga0501031_0018173 3300049568 Bacteria 4575
442 Ga0501031_0025900 3300049568 Bacteria 3826
443 Ga0501031_0105735 3300049568 Bacteria 1837
444 Ga0501031_0113300 3300049568 Bacteria 1771
445 Ga0501031_0126986 3300049568 Bacteria 1666
446 Ga0501031_0149952 3300049568 Bacteria 1523
447 Ga0501032_0003786 3300049569 Bacteria 11478
448 Ga0501032_0005456 3300049569 Bacteria 9440
449 Ga0501032_0049802 3300049569 Bacteria 2826
450 Ga0501032_0070417 3300049569 Bacteria 2332
451 Ga0501032_0083467 3300049569 Bacteria 2125
452 Ga0501032_0123993 3300049569 Bacteria 1707
453 Ga0501032_0158460 3300049569 Bacteria 1486
454 Ga0501033_0001264 3300049570 Bacteria 22583
455 Ga0501033_0003278 3300049570 Bacteria 13390
456 Ga0501033_0006971 3300049570 Bacteria 8823
457 Ga0501033_0036673 3300049570 Bacteria 3672
458 Ga0501033_0044526 3300049570 Bacteria 3304
459 Ga0501033_0103818 3300049570 Bacteria 2072
460 Ga0501033_0265387 3300049570 Bacteria 1214
461 Ga0501034_0005213 3300049571 Bacteria 14259
462 Ga0501034_0006755 3300049571 Bacteria 12278
463 Ga0501034_0010784 3300049571 Bacteria 9491
464 Ga0501034_0012929 3300049571 Bacteria 8606
465 Ga0501034_0083866 3300049571 Bacteria 3189
466 Ga0501034_0205101 3300049571 Bacteria 1928
467 Ga0501034_0315739 3300049571 Bacteria 1496
468 Ga0501036_0001005 3300049572 Bacteria 21286
469 Ga0501036_0006405 3300049572 Bacteria 9553
470 Ga0501036_0011299 3300049572 Bacteria 7386
471 Ga0501036_0017921 3300049572 Bacteria 5928
472 Ga0501036_0273334 3300049572 Bacteria 1414
473 Ga0501037_0005145 3300049573 Bacteria 9514
474 Ga0501037_0008402 3300049573 Bacteria 7573
475 Ga0501037_0056835 3300049573 Bacteria 2857
476 Ga0501038_0005437 3300049574 Bacteria 11835
477 Ga0501038_0007464 3300049574 Bacteria 10089
478 Ga0501038_0007801 3300049574 Bacteria 9864
479 Ga0501038_0024746 3300049574 Bacteria 5352
480 Ga0501038_0082868 3300049574 Bacteria 2700
481 Ga0501038_0103810 3300049574 Bacteria 2363
482 Ga0501039_0057593 3300049575 Bacteria 3009
483 Ga0501039_0113780 3300049575 Bacteria 2116
484 Ga0501039_0155099 3300049575 Bacteria 1799
485 Ga0501040_0145671 3300049576 Bacteria 1670
486 Ga0501040_0173011 3300049576 Bacteria 1529
487 Ga0501042_0001445 3300049578 Bacteria 13978
488 Ga0501042_0026449 3300049578 Bacteria 4077
489 Ga0501043_0006022 3300049579 Bacteria 9750
490 Ga0501043_0007957 3300049579 Bacteria 8375
491 Ga0501043_0010419 3300049579 Bacteria 7283
492 Ga0501043_0067766 3300049579 Bacteria 2802
493 Ga0501043_0084665 3300049579 Bacteria 2492
494 Ga0501043_0134259 3300049579 Bacteria 1939
495 Ga0501043_0287764 3300049579 Bacteria 1258
496 Ga0501046_0000091 3300049580 Bacteria 98095
497 Ga0501046_0002395 3300049580 Bacteria 17614
498 Ga0501046_0007551 3300049580 Bacteria 9535
499 Ga0501046_0037499 3300049580 Bacteria 3894
500 Ga0501047_0000575 3300049581 Bacteria 39087
501 Ga0501047_0002966 3300049581 Bacteria 16087
502 Ga0501047_0003526 3300049581 Bacteria 14766
503 Ga0501047_0004553 3300049581 Bacteria 13036
504 Ga0501047_0007490 3300049581 Bacteria 10271
505 Ga0501047_0013474 3300049581 Bacteria 7749
506 Ga0501047_0111883 3300049581 Bacteria 2613
507 Ga0501047_0180172 3300049581 Bacteria 1979
508 Ga0501047_0236047 3300049581 Bacteria 1680
509 Ga0501048_0003067 3300049582 Bacteria 12733
510 Ga0501048_0005624 3300049582 Bacteria 9532
511 Ga0501048_0031140 3300049582 Bacteria 3859
512 Ga0501070_0007297 3300049586 Bacteria 9387
513 Ga0501070_0061016 3300049586 Bacteria 3125
514 Ga0501070_0118730 3300049586 Bacteria 2185
515 Ga0501070_0220822 3300049586 Bacteria 1554
516 Ga0501071_0519030 3300049587 Bacteria 914
517 Ga0501073_0005674 3300049589 Bacteria 9336
518 Ga0501073_0029923 3300049589 Bacteria 3889
519 Ga0501073_0035832 3300049589 Bacteria 3525
520 Ga0501073_0176902 3300049589 Bacteria 1477
521 Ga0501074_0033129 3300049590 Bacteria 3744
522 Ga0501074_0073364 3300049590 Bacteria 2458
523 Ga0501074_0172377 3300049590 Bacteria 1544
524 Ga0501079_0059947 3300049741 Bacteria 2935
525 Ga0501079_0237167 3300049741 Bacteria 1425
526 Ga0501080_0082989 3300049742 Bacteria 2977
527 Ga0501080_0184073 3300049742 Bacteria 1921
528 Ga0501080_0229752 3300049742 Bacteria 1696
529 Ga0501083_0005021 3300049744 Bacteria 9373
530 Ga0501083_0007399 3300049744 Bacteria 7788
531 Ga0501083_0043593 3300049744 Bacteria 3039
532 Ga0501083_0277868 3300049744 Bacteria 1089
533 Ga0501035_0000248 3300049822 Bacteria 65046
534 Ga0501035_0002666 3300049822 Bacteria 17365
535 Ga0501035_0003898 3300049822 Bacteria 14232
536 Ga0501035_0101308 3300049822 Bacteria 2527
537 Ga0501035_0251519 3300049822 Bacteria 1500
538 Ga0501044_0003376 3300049823 Bacteria 17996
539 Ga0501044_0003625 3300049823 Bacteria 17374
540 Ga0501044_0004950 3300049823 Bacteria 14901
541 Ga0501044_0006686 3300049823 Bacteria 12711
542 Ga0501044_0018070 3300049823 Bacteria 7562
543 Ga0501044_0259717 3300049823 Bacteria 1675
544 Ga0501044_0276307 3300049823 Bacteria 1614
545 Ga0501044_0445345 3300049823 Bacteria 1202
546 Ga0501044_0605383 3300049823 Bacteria 988
547 Ga0501045_0291370 3300049824 Bacteria 1215
548 nmdc:mga03n38_1856_c2 3300050490 Bacteria 5633
549 nmdc:mga03n38_48390_c1 3300050490 Bacteria 1886
550 nmdc:mga00v17_7166_c1 3300050491 Bacteria 5941
551 nmdc:mga0yw44_5415_c1 3300050492 Bacteria 6026
552 nmdc:mga06z11_420152_c1 3300050494 Bacteria 806
553 nmdc:mga07m45_2025_c1 3300050496 Bacteria 4216
554 nmdc:mga08y16_745885_c1 3300050511 Bacteria 975
555 nmdc:mga0sz30_167564_c1 3300050516 Bacteria 974
556 nmdc:mga0sz30_91566_c1 3300050516 Bacteria 1323
557 Ga0495601_0000519 3300053077 Bacteria 20315
558 Ga0500635_0004864 3300053080 Bacteria 3488
559 Ga0495619_0044864 3300053085 Bacteria 2903
560 Ga0500578_0062317 3300053086 Bacteria 2380
561 Ga0500578_0227007 3300053086 Bacteria 1133
562 Ga0500644_0102111 3300053088 Bacteria 1091
563 Ga0500583_0101740 3300053092 Bacteria 1408
564 Ga0500640_007318 3300053095 Bacteria 4286
565 Ga0500650_0061242 3300053098 Bacteria 1757
566 Ga0500650_0234462 3300053098 Bacteria 827
567 Ga0500654_046623 3300053099 Bacteria 2388
568 Ga0500654_112087 3300053099 Bacteria 1112
569 Ga0500660_107726 3300053100 Bacteria 1197
570 Ga0500553_030046 3300053101 Bacteria 2720
571 Ga0500556_0000400 3300053104 Bacteria 31735
572 Ga0500560_004220 3300053107 Bacteria 3027
573 Ga0500569_012505 3300053109 Bacteria 2055
574 Ga0500572_007340 3300053111 Bacteria 2552
575 Ga0500594_0005978 3300053118 Bacteria 2716
576 Ga0500594_0091823 3300053118 Bacteria 923
577 Ga0500608_096599 3300053122 Bacteria 1374
578 Ga0500614_047212 3300053123 Bacteria 1118
579 Ga0500628_004523 3300053129 Bacteria 2303
580 Ga0500652_000402 3300053131 Bacteria 15494
581 Ga0500652_009669 3300053131 Bacteria 3272
582 Ga0500652_115005 3300053131 Bacteria 1124
583 Ga0500658_0037842 3300053134 Bacteria 1920
584 Ga0500658_0245062 3300053134 Bacteria 823
585 Ga0500559_0000719 3300053136 Bacteria 21761
586 Ga0500561_0013747 3300053137 Bacteria 1761
587 Ga0500568_0000579 3300053139 Bacteria 26786
588 Ga0500579_048915 3300053143 Bacteria 2599
589 Ga0500600_0029597 3300053149 Bacteria 3230
590 Ga0500600_0151971 3300053149 Bacteria 1150
591 Ga0500616_0000483 3300053153 Bacteria 51655
592 Ga0500616_0000930 3300053153 Bacteria 32033
593 Ga0500616_0002364 3300053153 Bacteria 15860
594 Ga0500616_0007128 3300053153 Bacteria 7155
595 Ga0500616_0035701 3300053153 Bacteria 2702
596 Ga0500627_0003406 3300053158 Bacteria 4909
597 Ga0500633_0020650 3300053160 Bacteria 1990
598 Ga0500636_0208114 3300053177 Bacteria 1029
599 Ga0500645_000017 3300053730 Bacteria 146045
600 Ga0500656_000122 3300053732 Bacteria 4545
601 Ga0500599_008279 3300053736 Bacteria 1347
602 Ga0500587_002769 3300053739 Bacteria 2477
603 Ga0501084_0422920 3300054114 Bacteria 1126
604 Ga0501082_0029555 3300060353 Bacteria 4721
605 Ga0501082_0161486 3300060353 Bacteria 1947
606 2508671208 2508501039 Bacteria 9978592
607 2517760077 2517572101 Bacteria 6884336
608 2559432358 2558860280 Bacteria 11429938
609 2585315205 2582581314 Bacteria 11452267
610 2600203789 2599185354 Bacteria 4398675
611 2616701626 2616644814 Bacteria 11555299
612 2643830466 2643221562 Bacteria 4048635
613 2644048953 2643221607 Bacteria 6314006
614 2644262429 2643221647 Bacteria 10741251
615 2644481703 2643221686 Bacteria 6310811
616 2644501022 2643221689 Bacteria 6042950
617 2676204080 2675902999 Bacteria 9438463
618 2689962453 2687453737 Bacteria 11203906
619 2689963724 2687453737 Bacteria 11203906
620 2689992796 2687453743 Bacteria 8361025
621 2728748584 2728368998 Bacteria 8720350
622 2738805121 2738541293 Bacteria 7065685
623 2760306631 2758568522 Bacteria 5953541
624 2760624490 2758568621 Bacteria 5967089
625 2774848656 2773857921 Bacteria 9435764
626 2816507448 2816332139 Bacteria 9138787
627 2858901503 2858895516 Bacteria 7378898
628 2862582216 2862574272 Bacteria 10567477
629 2870725419 2870721527 Bacteria 9689237
630 2880491127 2880489317 Bacteria 7096270
631 2919085189 2919085039 Bacteria 4532964
632 2945945106 2945941187 Bacteria 4682474
633 2945969394 2945968032 Bacteria 4111363
634 2954709894 2954701450 Bacteria 10834262
635 8001786280 8001781756 Bacteria 9586736
636 8023630181 8023623736 Bacteria 8593882
637 8047717869 8047710418 Bacteria 11023148
638 8048136042 8048127548 Bacteria 11053136
639 8054307023 8054302542 Bacteria 5698134
640 8054728028 8054727385 Bacteria 7558670
641 8055068609 8055066027 Bacteria 9479577
642 8056583570 8056579771 Bacteria 5840325
643 Ga0307405_10168115
644 JGI24739J22299_10002752
645 JGI24737J22298_10027289
646 JGI24751J29686_10015835
647 JGI25151J46595_10098038
648 rootH1_10079142
649 rootH2_10230140
650 rootH2_10267319
651 rootH1_10071420
652 rootH1_10165931
653 rootH1_10286776
654 Ga0007416J51690_1009241
655 Ga0007411J51799_106219
656 Ga0055542_1000439
657 Ga0065714_10030916
658 Ga0070683_100326623
659 Ga0070666_10010743
660 Ga0070671_100000949
661 Ga0070674_100409687
662 Ga0070667_100000308
663 Ga0070714_100019981
664 Ga0070714_100054094
665 Ga0070714_100063694
666 Ga0070714_100339925
667 Ga0070714_100497129
668 Ga0070713_100128517
669 Ga0070713_100576844
670 Ga0070710_10288389
671 Ga0070711_100111142
672 Ga0070700_100328262
673 Ga0070663_100118299
674 Ga0070663_100189552
675 Ga0070678_100516959
676 Ga0070679_100005317
677 Ga0070679_100136007
678 Ga0070679_100554525
679 Ga0070665_100108097
680 Ga0070665_100179527
681 Ga0068855_100042178
682 Ga0068855_100669726
683 Ga0070664_100136957
684 Ga0068856_100525393
685 Ga0068852_100050125
686 Ga0068852_100101469
687 Ga0068859_100006027
688 Ga0068864_100320816
689 Ga0068858_100002726
690 Ga0068860_100000155
691 Ga0068862_100000096
692 Ga0081540_1022853
693 Ga0070717_10136297
694 Ga0075365_10012747
695 Ga0075365_10032306
696 Ga0075363_100058089
697 Ga0075364_10037286
698 Ga0070716_100035357
699 Ga0070712_100033901
700 Ga0070712_100178141
701 Ga0075362_10013512
702 Ga0075369_10089581
703 Ga0075370_10014473
704 Ga0075434_100918859
705 Ga0097620_100006027
706 Ga0099826_10268791
707 Ga0099795_10010741
708 Ga0099795_10094914
709 Ga0105240_10201565
710 Ga0105240_10743114
711 Ga0105240_10780583
712 Ga0105245_10590819
713 Ga0105247_10000040
714 Ga0105241_10313280
715 Ga0105241_10406454
716 Ga0105248_10000095
717 Ga0105248_10137550
718 Ga0105248_10963290
719 Ga0105237_10148880
720 Ga0105237_10232907
721 Ga0105237_10728712
722 Ga0105238_10151181
723 Ga0105238_10152586
724 Ga0105238_10283619
725 Ga0105238_10714340
726 Ga0105249_10000069
727 Ga0099796_10066653
728 Ga0105239_10181186
729 Ga0105239_10363307
730 Ga0105239_10578964
731 Ga0105246_10033294
732 Ga0157342_1014844
733 Ga0157370_10000317
734 Ga0157370_10026255
735 Ga0157370_10157873
736 Ga0157369_10407593
737 Ga0157369_10409534
738 Ga0157374_10278718
739 Ga0163162_10105490
740 Ga0163162_10170835
741 Ga0163162_10181355
742 Ga0157375_10077352
743 Ga0157375_10240458
744 Ga0163163_10014016
745 Ga0163163_10580939
746 Ga0157380_10835954
747 Ga0157379_10025856
748 Ga0182005_1000004
749 Ga0206356_11243581
750 Ga0206353_11300916
751 Ga0224712_10193976
752 Ga0209233_1008225
753 Ga0209025_1001389
754 Ga0207655_1032430
755 Ga0207692_10050411
756 Ga0207642_10320638
757 Ga0207710_10000050
758 Ga0207688_10136566
759 Ga0207647_10025551
760 Ga0207647_10033454
761 Ga0207647_10124806
762 Ga0207699_10059943
763 Ga0207699_10499563
764 Ga0207645_10113300
765 Ga0207705_10338020
766 Ga0207654_10002481
767 Ga0207707_10123483
768 Ga0207695_10014892
769 Ga0207671_10001125
770 Ga0207671_10122616
771 Ga0207671_10265473
772 Ga0207671_10594749
773 Ga0207693_10043227
774 Ga0207693_10295167
775 Ga0207693_10533809
776 Ga0207663_10077835
777 Ga0207663_10081704
778 Ga0207660_10580727
779 Ga0207657_10606321
780 Ga0207652_10067625
781 Ga0207652_10512592
782 Ga0207681_10002841
783 Ga0207694_10101413
784 Ga0207694_10288478
785 Ga0207650_10091927
786 Ga0207687_10069301
787 Ga0207687_10120347
788 Ga0207700_10280462
789 Ga0207664_10002394
790 Ga0207664_10022536
791 Ga0207664_10108015
792 Ga0207664_10190169
793 Ga0207664_10321894
794 Ga0207644_10089307
795 Ga0207709_10560423
796 Ga0207665_10051276
797 Ga0207691_10080042
798 Ga0207691_10107009
799 Ga0207711_10000082
800 Ga0207689_10218716
801 Ga0207661_10477584
802 Ga0207679_10144966
803 Ga0207679_10608861
804 Ga0207712_10000084
805 Ga0207640_10111051
806 Ga0207658_10000868
807 Ga0207703_11038697
808 Ga0207678_10018048
809 Ga0207678_10195735
810 Ga0207678_10413101
811 Ga0207676_10513251
812 Ga0207674_10405816
813 Ga0207683_10121955
814 Ga0207698_10073403
815 Ga0268266_10059382
816 Ga0268266_10464642
817 Ga0268265_10000106
818 Ga0268264_10000219
819 Ga0268264_10700813
820 Ga0265319_1017014
821 Ga0265336_10005155
822 Ga0265336_10045147
823 Ga0265336_10049927
824 Ga0307517_10044770
825 Ga0307517_10113193
826 Ga0307515_10000846
827 Ga0307515_10049581
828 Ga0307515_10061669
829 Ga0265338_10003900
830 Ga0265338_10017188
831 Ga0265338_10021357
832 Ga0265338_10042925
833 Ga0265338_10107746
834 Ga0307511_10003090
835 Ga0307511_10141165
836 Ga0307512_10004311
837 Ga0307512_10007896
838 Ga0265760_10076694
839 Ga0265330_10027609
840 Ga0307513_10001603
841 Ga0307513_10069471
842 Ga0307513_10331367
843 Ga0307509_10013229
844 Ga0307509_10023765
845 Ga0307509_10093453
846 Ga0307508_10001782
847 Ga0307508_10009013
848 Ga0307508_10139501
849 Ga0307508_10156550
850 Ga0307508_10352832
851 Ga0307514_10023311
852 Ga0307516_10051225
853 Ga0307507_10001954
854 Ga0307507_10027336
855 Ga0307507_10036156
856 Ga0307507_10053550
857 Ga0307510_10004939
858 Ga0307510_10049355
859 Ga0307510_10152891
860 Ga0373934_0096245
861 Ga0373951_0000086
862 Ga0373923_0201848
863 Ga0373936_0005116
864 Ga0373954_0017921
865 Ga0373957_0085805
866 Ga0373924_0043622
867 Ga0373931_0083630
868 Ga0373935_0539601
869 Ga0373947_0472048
870 Ga0373937_0814442
871 Ga0372808_005661
872 Ga0373925_0000101
873 Ga0373925_0016708
874 Ga0373925_0026933
875 Ga0373925_0320429
876 Ga0395900_0308999
877 Ga0395905_0556059
878 Ga0436361_0991054
879 Ga0451793_0467648
880 Ga0451807_1482729
881 Ga0451843_0099427
882 Ga0451853_0325620
883 Ga0466968_0070735
884 Ga0466960_0220887
885 Ga0495617_060796
886 Ga0495627_012618
887 Ga0495592_0009428
888 Ga0495592_0078488
889 Ga0495592_0204218
890 Ga0495603_0012178
891 Ga0495603_0018918
892 Ga0495603_0030542
893 Ga0495629_0011173
894 Ga0495629_0018578
895 Ga0495629_0038123
896 Ga0495629_0199901
897 Ga0495638_0023029
898 Ga0495638_0090222
899 Ga0495638_0122447
900 Ga0495651_0001042
901 Ga0495651_0161204
902 Ga0495651_0305234
903 Ga0495580_0234560
904 Ga0495605_0052376
905 Ga0495639_0239535
906 Ga0495662_0009485
907 Ga0495662_0082663
908 Ga0495664_0000287
909 Ga0495664_0015673
910 Ga0495664_0294054
911 Ga0495584_0061044
912 Ga0495594_0018231
913 Ga0495594_0058148
914 Ga0495594_0249448
915 Ga0495596_0034238
916 Ga0495607_0000003
917 Ga0495607_0006428
918 Ga0495583_0052521
919 Ga0495606_0013143
920 Ga0495606_0158149
921 Ga0495610_0003962
922 Ga0495610_0048209
923 Ga0495620_0010680
924 Ga0495620_0042467
925 Ga0495628_0078892
926 Ga0495628_0083641
927 Ga0495628_0118907
928 Ga0495631_0013587
929 Ga0495632_0000011
930 Ga0495632_0045284
931 Ga0495637_0142884
932 Ga0495643_0064488
933 Ga0495644_0084886
934 Ga0495648_0015660
935 Ga0495648_0021550
936 Ga0495666_0007678
937 Ga0495666_0011577
938 Ga0495652_0008645
939 Ga0495652_0162927
940 Ga0495665_0007483
941 Ga0495640_0039687
942 Ga0495640_0085391
943 Ga0495640_0133563
944 Ga0495586_0108428
945 Ga0495587_0002208
946 Ga0495597_0082090
947 Ga0495645_0017306
948 Ga0495622_0005125
949 Ga0495667_0082116
950 Ga0495656_0083826
951 Ga0495668_0086279
952 Ga0495668_0139747
953 Ga0495668_0224633
954 Ga0495634_0002799
955 Ga0495634_0015769
956 Ga0495634_0352747
957 Ga0495611_0243369
958 Ga0495625_0070173
959 Ga0495625_0131059
960 Ga0495635_0018136
961 Ga0495635_0027949
962 Ga0495635_0028962
963 Ga0495659_0128384
964 Ga0495657_0003480
965 Ga0495657_0149755
966 Ga0495599_0052346
967 Ga0495599_0151737
968 Ga0495646_0020602
969 Ga0495613_0000388
970 Ga0495613_0004110
971 Ga0495671_0007655
972 Ga0495649_0036301
973 Ga0495649_0068614
974 Ga0495649_0070671
975 Ga0495589_0015740
976 Ga0495589_0059236
977 Ga0495600_0010883
978 Ga0495600_0011870
979 Ga0495660_0004309
980 Ga0495660_0142233
981 Ga0495581_0069558
982 Ga0495604_0000545
983 Ga0495604_0005331
984 Ga0495604_0180506
985 Ga0495604_0244205
986 Ga0495636_0064025
987 Ga0495674_0079786
988 Ga0495672_0003747
989 Ga0495676_0000488
990 Ga0495676_0000537
991 Ga0495676_0051310
992 Ga0495676_0105662
993 Ga0495683_0002011
994 Ga0495683_0092272
995 Ga0495687_002019
996 Ga0495687_015680
997 Ga0495687_017402
998 Ga0495687_047628
999 Ga0495675_0044013
1000 Ga0495677_0018742
1001 Ga0495685_004037
1002 Ga0495685_006708
1003 Ga0495685_043554
1004 Ga0495673_0011418
1005 Ga0495681_0002530
1006 Ga0495681_0016827
1007 Ga0495686_0063234
1008 Ga0495686_0129789
1009 Ga0495593_0000258
1010 Ga0495602_0075504
1011 Ga0495614_0002843
1012 Ga0495614_0005593
1013 Ga0495614_0100204
1014 Ga0496100_0348756
1015 Ga0496101_0000130
1016 Ga0496101_0091574
1017 Ga0496102_0000014
1018 Ga0496102_0000716
1019 Ga0496102_0027571
1020 Ga0496102_0284295
1021 Ga0496102_0523791
1022 Ga0496103_0000004
1023 Ga0496103_0000767
1024 Ga0496103_0148920
1025 Ga0496104_0133734
1026 Ga0496104_0387593
1027 Ga0496105_0056792
1028 Ga0496105_0073852
1029 Ga0496106_0058828
1030 Ga0496106_0090731
1031 Ga0496106_0640388
1032 Ga0496106_0738621
1033 Ga0496107_0019547
1034 Ga0496107_0066239
1035 Ga0496107_0088217
1036 Ga0496108_0024849
1037 Ga0496108_0140686
1038 Ga0496109_0092370
1039 Ga0496109_0345965
1040 Ga0496109_0372284
1041 Ga0496109_0377733
1042 Ga0496110_0162349
1043 Ga0496111_0006478
1044 Ga0496111_0176789
1045 Ga0496111_0246255
1046 Ga0496112_0005279
1047 Ga0496112_0121764
1048 Ga0496112_0158609
1049 Ga0496114_0119792
1050 Ga0496115_0010369
1051 Ga0496116_0000069
1052 Ga0496116_0069768
1053 Ga0496117_0000003
1054 Ga0496117_0000687
1055 Ga0496117_0001629
1056 Ga0496118_0000001
1057 Ga0496118_0001732
1058 Ga0496118_0003018
1059 Ga0496119_0000588
1060 Ga0496119_0031696
1061 Ga0496119_0038081
1062 Ga0496120_0000085
1063 Ga0496120_0014771
1064 Ga0496121_0000032
1065 Ga0496121_0006420
1066 Ga0496121_0058734
1067 Ga0496121_0120791
1068 Ga0496122_0000495
1069 Ga0496124_0001784
1070 Ga0496124_0096079
1071 Ga0496125_0090825
1072 Ga0496126_0000006
1073 Ga0496126_0000007
1074 Ga0496126_0000067
1075 Ga0496126_0044285
1076 Ga0496126_0143568
1077 Ga0496126_0243130
1078 Ga0496126_0268072
1079 Ga0495678_070981
1080 Ga0495678_083088
1081 Ga0501031_0001335
1082 Ga0501031_0017651
1083 Ga0501031_0018173
1084 Ga0501031_0025900
1085 Ga0501031_0105735
1086 Ga0501031_0113300
1087 Ga0501031_0126986
1088 Ga0501031_0149952
1089 Ga0501032_0003786
1090 Ga0501032_0005456
1091 Ga0501032_0049802
1092 Ga0501032_0070417
1093 Ga0501032_0083467
1094 Ga0501032_0123993
1095 Ga0501032_0158460
1096 Ga0501033_0001264
1097 Ga0501033_0003278
1098 Ga0501033_0006971
1099 Ga0501033_0036673
1100 Ga0501033_0044526
1101 Ga0501033_0103818
1102 Ga0501033_0265387
1103 Ga0501034_0005213
1104 Ga0501034_0006755
1105 Ga0501034_0010784
1106 Ga0501034_0012929
1107 Ga0501034_0083866
1108 Ga0501034_0205101
1109 Ga0501034_0315739
1110 Ga0501036_0001005
1111 Ga0501036_0006405
1112 Ga0501036_0011299
1113 Ga0501036_0017921
1114 Ga0501036_0273334
1115 Ga0501037_0005145
1116 Ga0501037_0008402
1117 Ga0501037_0056835
1118 Ga0501038_0005437
1119 Ga0501038_0007464
1120 Ga0501038_0007801
1121 Ga0501038_0024746
1122 Ga0501038_0082868
1123 Ga0501038_0103810
1124 Ga0501039_0057593
1125 Ga0501039_0113780
1126 Ga0501039_0155099
1127 Ga0501040_0145671
1128 Ga0501040_0173011
1129 Ga0501042_0001445
1130 Ga0501042_0026449
1131 Ga0501043_0006022
1132 Ga0501043_0007957
1133 Ga0501043_0010419
1134 Ga0501043_0067766
1135 Ga0501043_0084665
1136 Ga0501043_0134259
1137 Ga0501043_0287764
1138 Ga0501046_0000091
1139 Ga0501046_0002395
1140 Ga0501046_0007551
1141 Ga0501046_0037499
1142 Ga0501047_0000575
1143 Ga0501047_0002966
1144 Ga0501047_0003526
1145 Ga0501047_0004553
1146 Ga0501047_0007490
1147 Ga0501047_0013474
1148 Ga0501047_0111883
1149 Ga0501047_0180172
1150 Ga0501047_0236047
1151 Ga0501048_0003067
1152 Ga0501048_0005624
1153 Ga0501048_0031140
1154 Ga0501070_0007297
1155 Ga0501070_0061016
1156 Ga0501070_0118730
1157 Ga0501070_0220822
1158 Ga0501071_0519030
1159 Ga0501073_0005674
1160 Ga0501073_0029923
1161 Ga0501073_0035832
1162 Ga0501073_0176902
1163 Ga0501074_0033129
1164 Ga0501074_0073364
1165 Ga0501074_0172377
1166 Ga0501079_0059947
1167 Ga0501079_0237167
1168 Ga0501080_0082989
1169 Ga0501080_0184073
1170 Ga0501080_0229752
1171 Ga0501083_0005021
1172 Ga0501083_0007399
1173 Ga0501083_0043593
1174 Ga0501083_0277868
1175 Ga0501035_0000248
1176 Ga0501035_0002666
1177 Ga0501035_0003898
1178 Ga0501035_0101308
1179 Ga0501035_0251519
1180 Ga0501044_0003376
1181 Ga0501044_0003625
1182 Ga0501044_0004950
1183 Ga0501044_0006686
1184 Ga0501044_0018070
1185 Ga0501044_0259717
1186 Ga0501044_0276307
1187 Ga0501044_0445345
1188 Ga0501044_0605383
1189 Ga0501045_0291370
1190 nmdc:mga03n38_1856_c2
1191 nmdc:mga03n38_48390_c1
1192 nmdc:mga00v17_7166_c1
1193 nmdc:mga0yw44_5415_c1
1194 nmdc:mga06z11_420152_c1
1195 nmdc:mga07m45_2025_c1
1196 nmdc:mga08y16_745885_c1
1197 nmdc:mga0sz30_167564_c1
1198 nmdc:mga0sz30_91566_c1
1199 Ga0495601_0000519
1200 Ga0500635_0004864
1201 Ga0495619_0044864
1202 Ga0500578_0062317
1203 Ga0500578_0227007
1204 Ga0500644_0102111
1205 Ga0500583_0101740
1206 Ga0500640_007318
1207 Ga0500650_0061242
1208 Ga0500650_0234462
1209 Ga0500654_046623
1210 Ga0500654_112087
1211 Ga0500660_107726
1212 Ga0500553_030046
1213 Ga0500556_0000400
1214 Ga0500560_004220
1215 Ga0500569_012505
1216 Ga0500572_007340
1217 Ga0500594_0005978
1218 Ga0500594_0091823
1219 Ga0500608_096599
1220 Ga0500614_047212
1221 Ga0500628_004523
1222 Ga0500652_000402
1223 Ga0500652_009669
1224 Ga0500652_115005
1225 Ga0500658_0037842
1226 Ga0500658_0245062
1227 Ga0500559_0000719
1228 Ga0500561_0013747
1229 Ga0500568_0000579
1230 Ga0500579_048915
1231 Ga0500600_0029597
1232 Ga0500600_0151971
1233 Ga0500616_0000483
1234 Ga0500616_0000930
1235 Ga0500616_0002364
1236 Ga0500616_0007128
1237 Ga0500616_0035701
1238 Ga0500627_0003406
1239 Ga0500633_0020650
1240 Ga0500636_0208114
1241 Ga0500645_000017
1242 Ga0500656_000122
1243 Ga0500599_008279
1244 Ga0500587_002769
1245 Ga0501084_0422920
1246 Ga0501082_0029555
1247 Ga0501082_0161486
1248 2508671208
1249 2517760077
1250 2559432358
1251 2585315205
1252 2600203789
1253 2616701626
1254 2643830466
1255 2644048953
1256 2644262429
1257 2644481703
1258 2644501022
1259 2676204080
1260 2689962453
1261 2689963724
1262 2689992796
1263 2728748584
1264 2738805121
1265 2760306631
1266 2760624490
1267 2774848656
1268 2816507448
1269 2858901503
1270 2862582216
1271 2870725419
1272 2880491127
1273 2919085189
1274 2945945106
1275 2945969394
1276 2954709894
1277 8001786280
1278 8023630181
1279 8047717869
1280 8048136042
1281 8054307023
1282 8054728028
1283 8055068609
1284 8056583570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

225

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

271

0.94

PF08659

KR

KR domain

37

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9824 4 243
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9789 1 243
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9787 1 243
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9776 3 243
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.976 3 243
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9655 3 243 3.40.50.720
3rihC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 3 241 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9532 7 84 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 4 242 3.40.50.720
af_I6YCF0_1_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9499 1 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A832MUH5-F1-model_v4 SDR family oxidoreductase 0.9832 1 184 GO:0016491
AF-A0A7Y3J8K4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9781 3 185 GO:0016491
AF-A0A328AS06-F1-model_v4 Oxidoreductase 0.9627 3 243 GO:0006633
GO:0016616
GO:0048038
AF-A0A4R7MS84-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9605 2 243 GO:0006633
GO:0016616
GO:0048038
AF-A0A2U1T022-F1-model_v4 Short-chain dehydrogenase 0.9601 2 243 GO:0016616
GO:0030497

Map