F472000

General Info

Members Datasets Scaffolds Average Seq Length
643 477 1287 389

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2821443989|2821451009
Length 455
Sequence IEVTGVDVLAPIQQEGTKAAVRSWFAAVGDTVREGDPLVELETDKVAVEVPAPASGVLTEILIPADQDATPGAVLGRIGAGAGEARSSLVPPPLAGGGQGEGVVDDSHPHPPIPDRTSGQFLSGSGGGNPLPLAPSREGRGDAKVADRSIADFDPALRLSPSVRKLLAETGLDPAGLTGSGKDGRLTRQDVEQEVARRRAPVETPVETSAPAAPPLRTSAPGGSRLIQHDGMRRRIAEHMAHSLATAPHVTAVFEADFTAVLAHRTASRAAFERQGVALTVTAYIVQACVAAMQAVPVVNSRWHADALEVFDDINIGIGTALGDKGLVVPVVHRAQALSLLGTAGRLQETTALARAGKLAPADVQGGTFTISNHGVSGSLLAAPIIINQPQTAILGIGKVEKRVVVREVAGSDAMLIRPMAYVSLSIDHRALDGAQTNAWLTRFVAALEDWPPIS

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
73 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
74 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
75 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
78 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
138 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
211 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
217 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
221 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
222 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
223 2509276019 Ensifer aridi TW10 Isolate Nodule
224 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
225 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
226 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
227 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
228 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
229 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
230 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
231 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
232 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
233 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
234 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
235 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
236 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
237 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
238 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
239 2516143018 Ensifer sp. BR816 Isolate Nodule
240 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
241 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
242 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
243 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
244 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
245 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
246 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
247 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
248 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
249 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
250 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
251 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
252 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
253 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
254 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
255 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
256 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
257 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
258 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
259 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
260 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
261 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
262 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
263 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
264 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
265 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
266 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
267 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
268 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
269 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
270 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
271 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
272 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
273 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
274 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
275 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
276 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
277 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
278 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
279 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
280 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
281 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
282 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
283 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
284 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
285 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
286 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
287 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
288 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
289 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
290 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
291 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
292 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
293 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
294 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
295 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
296 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
297 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
298 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
299 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
300 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
301 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
302 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
303 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
304 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
305 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
306 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
307 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
308 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
309 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
310 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
311 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
312 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
313 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
314 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
315 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
316 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
317 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
318 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
319 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
320 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
321 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
322 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
323 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
324 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
325 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
326 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
327 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
328 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
329 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
330 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
331 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
332 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
333 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
334 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
335 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
336 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
337 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
338 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
339 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
340 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
341 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
342 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
343 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
344 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
345 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
346 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
347 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
348 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
349 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
350 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
351 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
352 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
353 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
354 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
355 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
356 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
357 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
358 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
359 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
360 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
361 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
362 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
363 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
364 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
365 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
366 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
367 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
368 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
369 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
370 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
371 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
372 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
373 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
374 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
375 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
376 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
377 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
378 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
379 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
380 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
381 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
382 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
383 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
384 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
385 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
386 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
387 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
388 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
389 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
390 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
391 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
392 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
393 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
394 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
395 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
396 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
397 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
398 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
399 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
400 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
401 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
402 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
403 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
404 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
405 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
406 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
407 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
408 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
409 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
410 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
411 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
412 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
413 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
414 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
415 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
416 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
417 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
418 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
419 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
420 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
421 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
422 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
423 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
424 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
425 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
426 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
427 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
428 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
429 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
430 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
431 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
432 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
433 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
434 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
435 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
436 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
437 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
438 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
439 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
440 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
441 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
442 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
443 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
444 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
445 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
446 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
447 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
448 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
449 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
450 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
451 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
452 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
453 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
454 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
455 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
456 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
457 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
458 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
459 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
460 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
461 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
462 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
463 2996887358 Rhizobium sp. R711 Isolate Nodule
464 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
465 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
466 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
467 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
468 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
469 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
470 8005258706 Rhizobium sp. R693 Isolate Nodule
471 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
472 8005321885 Rhizobium sp. R72 Isolate Nodule
473 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
474 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
475 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
476 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
477 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.03
Metatranscriptomes 0
Isolates 39.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 37.01
Rhizoplane 0.47
Rhizosphere 47.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002088 3300001904 Bacteria 3549
2 JGI24740J21852_10002065 3300001979 Bacteria 9182
3 JGI24740J21852_10007846 3300001979 Bacteria 4307
4 JGI24739J22299_10003494 3300001989 Bacteria 5994
5 JGI24739J22299_10033070 3300001989 Bacteria 1773
6 JGI25155J39150_1000043 3300002704 Bacteria 87185
7 JGI25156J39149_1000056 3300002705 Bacteria 87185
8 JGI25162J39368_1000074 3300002737 Bacteria 121066
9 JGI25162J39368_1001761 3300002737 Bacteria 10300
10 JGI25154J39366_1000086 3300002738 Bacteria 87185
11 JGI25157J39369_1000086 3300002741 Bacteria 81114
12 JGI25152J39213_1000745 3300002773 Bacteria 16620
13 JGI25152J39213_1004117 3300002773 Bacteria 4696
14 JGI25151J46595_10000400 3300003187 Bacteria 45092
15 JGI25165J46597_1000068 3300003214 Bacteria 196201
16 JGI25165J46597_1000537 3300003214 Bacteria 35164
17 JGI25153J46596_10027636 3300003215 Bacteria 1983
18 rootH1_10018885 3300003316 Bacteria 9439
19 rootH1_10018885 3300003323 Bacteria 21610
20 rootH2_10003835 3300003320 Bacteria 12912
21 rootH2_10009015 3300003320 Bacteria 18262
22 rootL2_10012115 3300003322 Bacteria 43997
23 rootH1_10051830 3300003323 Bacteria 3596
24 rootH1_10070810 3300003323 Bacteria 7504
25 Ga0055524_1008339 3300003775 Bacteria 4310
26 Ga0055524_1010091 3300003775 Bacteria 3784
27 Ga0055528_1010360 3300003790 Bacteria 3795
28 Ga0070658_10000001 3300005327 Bacteria 856789
29 Ga0070658_10005984 3300005327 Bacteria 9859
30 Ga0070683_100039287 3300005329 Bacteria 4343
31 Ga0070670_100230551 3300005331 Bacteria 1611
32 Ga0068869_100020468 3300005334 Bacteria 4536
33 Ga0068868_100000001 3300005338 Bacteria 282170
34 Ga0070660_100000184 3300005339 Bacteria 41526
35 Ga0070660_100003723 3300005339 Bacteria 10534
36 Ga0070660_100006698 3300005339 Bacteria 7993
37 Ga0070661_100105148 3300005344 Bacteria 2104
38 Ga0070661_100153643 3300005344 Bacteria 1741
39 Ga0070692_10001068 3300005345 Bacteria 9508
40 Ga0070668_100131775 3300005347 Bacteria 2007
41 Ga0070669_100092494 3300005353 Bacteria 2270
42 Ga0070669_100136434 3300005353 Bacteria 1887
43 Ga0070671_100005893 3300005355 Bacteria 9766
44 Ga0070659_100000001 3300005366 Bacteria 576390
45 Ga0070659_100000984 3300005366 Bacteria 20941
46 Ga0070659_100001698 3300005366 Bacteria 15823
47 Ga0070659_100031264 3300005366 Bacteria 4123
48 Ga0070659_100060824 3300005366 Bacteria 2984
49 Ga0070667_100067074 3300005367 Bacteria 3050
50 Ga0070713_100016505 3300005436 Bacteria 5553
51 Ga0070663_100001497 3300005455 Bacteria 12844
52 Ga0070663_100031593 3300005455 Bacteria 3640
53 Ga0070663_100033565 3300005455 Bacteria 3547
54 Ga0070679_100207692 3300005530 Bacteria 1923
55 Ga0070684_100223228 3300005535 Bacteria 1719
56 Ga0068853_100067304 3300005539 Bacteria 3112
57 Ga0070686_100000194 3300005544 Bacteria 42189
58 Ga0070665_100006904 3300005548 Bacteria 11539
59 Ga0070665_100035910 3300005548 Bacteria 4986
60 Ga0068855_100341883 3300005563 Bacteria 1650
61 Ga0070664_100113106 3300005564 Bacteria 2371
62 Ga0068857_100065010 3300005577 Bacteria 3243
63 Ga0068854_100004180 3300005578 Bacteria 9084
64 Ga0068854_100109622 3300005578 Bacteria 2080
65 Ga0068854_100125592 3300005578 Bacteria 1953
66 Ga0068854_100211119 3300005578 Bacteria 1531
67 Ga0068856_100006069 3300005614 Bacteria 11869
68 Ga0068856_100011043 3300005614 Bacteria 8771
69 Ga0068856_100016897 3300005614 Bacteria 7072
70 Ga0068856_100024005 3300005614 Bacteria 5932
71 Ga0068856_100074238 3300005614 Bacteria 3367
72 Ga0068856_100125148 3300005614 Bacteria 2573
73 Ga0068852_100013467 3300005616 Bacteria 6262
74 Ga0068852_100068726 3300005616 Bacteria 3102
75 Ga0068852_100099006 3300005616 Bacteria 2627
76 Ga0068852_100109434 3300005616 Bacteria 2509
77 Ga0068864_100004726 3300005618 Bacteria 11154
78 Ga0068870_10083478 3300005840 Bacteria 1771
79 Ga0068863_100117729 3300005841 Bacteria 2532
80 Ga0068860_100040634 3300005843 Bacteria 4445
81 Ga0068860_100153007 3300005843 Bacteria 2222
82 Ga0068862_100009863 3300005844 Bacteria 7887
83 Ga0068862_100011017 3300005844 Bacteria 7471
84 Ga0068862_100073554 3300005844 Bacteria 2954
85 Ga0075367_10001856 3300006178 Bacteria 9328
86 Ga0075366_10020462 3300006195 Bacteria 3840
87 Ga0068871_100048960 3300006358 Bacteria 3414
88 Ga0075434_100061314 3300006871 Bacteria 3742
89 Ga0079104_1009785 3300006946 Bacteria 3220
90 Ga0105250_10083308 3300009092 Bacteria 1298
91 Ga0105240_10016809 3300009093 Bacteria 9894
92 Ga0105240_10052334 3300009093 Bacteria 5134
93 Ga0105240_10062030 3300009093 Bacteria 4656
94 Ga0105240_10120824 3300009093 Bacteria 3154
95 Ga0105245_10364339 3300009098 Bacteria 1435
96 Ga0105243_10000150 3300009148 Bacteria 79825
97 Ga0105241_10009912 3300009174 Bacteria 7001
98 Ga0105241_10030600 3300009174 Bacteria 4025
99 Ga0105248_10000005 3300009177 Bacteria 673111
100 Ga0105248_10001965 3300009177 Bacteria 22859
101 Ga0105248_10108184 3300009177 Bacteria 3135
102 Ga0105237_10019521 3300009545 Bacteria 7001
103 Ga0105237_10110555 3300009545 Bacteria 2740
104 Ga0105238_10046084 3300009551 Bacteria 4402
105 Ga0105238_10048684 3300009551 Bacteria 4270
106 Ga0123342_1004588 3300009766 Bacteria 20889
107 Ga0105239_10000300 3300010375 Bacteria 73306
108 Ga0105239_10024092 3300010375 Bacteria 6703
109 Ga0157373_10215976 3300013100 Bacteria 1352
110 Ga0157371_10000705 3300013102 Bacteria 39219
111 Ga0157371_10165399 3300013102 Bacteria 1580
112 Ga0157370_10044437 3300013104 Bacteria 4270
113 Ga0157370_10084977 3300013104 Bacteria 2973
114 Ga0157370_10116180 3300013104 Bacteria 2499
115 Ga0157370_10346663 3300013104 Bacteria 1369
116 Ga0157369_10000553 3300013105 Bacteria 49107
117 Ga0157369_10002565 3300013105 Bacteria 21747
118 Ga0157369_10009186 3300013105 Bacteria 11312
119 Ga0157369_10013284 3300013105 Bacteria 9318
120 Ga0157369_10107491 3300013105 Bacteria 2968
121 Ga0157369_10146826 3300013105 Bacteria 2494
122 Ga0171462_1018 3300013250 Bacteria 157875
123 Ga0157372_10157774 3300013307 Bacteria 2621
124 Ga0157372_10522377 3300013307 Bacteria 1384
125 Ga0163161_10004269 3300017792 Bacteria 9966
126 Ga0214544_1000130 3300021320 Bacteria 108844
127 Ga0214542_1000014 3300021321 Bacteria 233825
128 Ga0214542_1015520 3300021321 Bacteria 7896
129 Ga0214543_1000005 3300021327 Bacteria 454523
130 Ga0214543_1000146 3300021327 Bacteria 98609
131 Ga0213872_10018761 3300021361 Bacteria 3188
132 Ga0213876_10003603 3300021384 Bacteria 8810
133 Ga0213876_10024251 3300021384 Bacteria 3202
134 Ga0228711_1000009 3300022739 Bacteria 164684
135 Ga0228710_1000011 3300022740 Bacteria 154551
136 Ga0209435_100039 3300025206 Bacteria 116879
137 Ga0209437_100023 3300025233 Bacteria 614195
138 Ga0209437_100067 3300025233 Bacteria 317685
139 Ga0209646_1000137 3300025246 Bacteria 116791
140 Ga0209026_1000135 3300025250 Bacteria 117001
141 Ga0209759_1000154 3300025256 Bacteria 119427
142 Ga0209129_1001217 3300025258 Bacteria 14789
143 Ga0209233_1000088 3300025261 Bacteria 317980
144 Ga0209233_1000219 3300025261 Bacteria 104797
145 Ga0209673_1010743 3300025273 Bacteria 3834
146 Ga0209673_1013794 3300025273 Bacteria 3170
147 Ga0209025_1000486 3300025294 Bacteria 76804
148 Ga0209025_1029263 3300025294 Bacteria 2672
149 Ga0209564_1007884 3300025295 Bacteria 5388
150 Ga0209564_1015410 3300025295 Bacteria 3111
151 Ga0209758_1005395 3300025297 Bacteria 9889
152 Ga0209256_1004539 3300025299 Bacteria 8643
153 Ga0209256_1006393 3300025299 Bacteria 6263
154 Ga0207426_1000092 3300025302 Bacteria 278907
155 Ga0207426_1000730 3300025302 Bacteria 37639
156 Ga0209051_1000801 3300025303 Bacteria 33036
157 Ga0207647_10007269 3300025904 Bacteria 8015
158 Ga0207645_10067906 3300025907 Bacteria 2279
159 Ga0207705_10000002 3300025909 Bacteria 2046852
160 Ga0207705_10000050 3300025909 Bacteria 170078
161 Ga0207705_10000060 3300025909 Bacteria 152576
162 Ga0207705_10000274 3300025909 Bacteria 49320
163 Ga0207705_10006806 3300025909 Bacteria 8446
164 Ga0207705_10008785 3300025909 Bacteria 7365
165 Ga0207705_10089423 3300025909 Bacteria 2254
166 Ga0207654_10000442 3300025911 Bacteria 23622
167 Ga0207654_10004226 3300025911 Bacteria 7246
168 Ga0207707_10031948 3300025912 Bacteria 4608
169 Ga0207695_10003088 3300025913 Bacteria 23842
170 Ga0207695_10003338 3300025913 Bacteria 22726
171 Ga0207695_10042758 3300025913 Bacteria 4835
172 Ga0207695_10124933 3300025913 Bacteria 2537
173 Ga0207695_10153554 3300025913 Bacteria 2239
174 Ga0207671_10012484 3300025914 Bacteria 6825
175 Ga0207660_10003617 3300025917 Bacteria 10075
176 Ga0207657_10000210 3300025919 Bacteria 60425
177 Ga0207657_10000301 3300025919 Bacteria 52361
178 Ga0207657_10002610 3300025919 Bacteria 19473
179 Ga0207657_10009499 3300025919 Bacteria 9769
180 Ga0207649_10000826 3300025920 Bacteria 19904
181 Ga0207649_10042880 3300025920 Bacteria 2763
182 Ga0207649_10080598 3300025920 Bacteria 2106
183 Ga0207681_10026824 3300025923 Bacteria 3719
184 Ga0207694_10000230 3300025924 Bacteria 53897
185 Ga0207694_10010416 3300025924 Bacteria 7009
186 Ga0207694_10023287 3300025924 Bacteria 4701
187 Ga0207690_10000018 3300025932 Bacteria 238992
188 Ga0207690_10000052 3300025932 Bacteria 106112
189 Ga0207690_10006516 3300025932 Bacteria 6920
190 Ga0207690_10010071 3300025932 Bacteria 5615
191 Ga0207690_10033889 3300025932 Bacteria 3286
192 Ga0207706_10018713 3300025933 Bacteria 6230
193 Ga0207709_10000005 3300025935 Bacteria 806813
194 Ga0207689_10017877 3300025942 Bacteria 5988
195 Ga0207661_10134254 3300025944 Bacteria 2124
196 Ga0207667_10000327 3300025949 Bacteria 66205
197 Ga0207667_10004913 3300025949 Bacteria 16326
198 Ga0207667_10059054 3300025949 Bacteria 4019
199 Ga0207667_10080132 3300025949 Bacteria 3383
200 Ga0207640_10000668 3300025981 Bacteria 20054
201 Ga0207640_10001866 3300025981 Bacteria 11302
202 Ga0207640_10002879 3300025981 Bacteria 9230
203 Ga0207640_10031181 3300025981 Bacteria 3291
204 Ga0207640_10037021 3300025981 Bacteria 3067
205 Ga0207640_10102970 3300025981 Bacteria 2006
206 Ga0207658_10019218 3300025986 Bacteria 4724
207 Ga0207677_10000024 3300026023 Bacteria 127407
208 Ga0207639_10023974 3300026041 Bacteria 4409
209 Ga0207639_10027413 3300026041 Bacteria 4151
210 Ga0207639_10065772 3300026041 Bacteria 2815
211 Ga0207639_10084789 3300026041 Bacteria 2518
212 Ga0207678_10001868 3300026067 Bacteria 19215
213 Ga0207678_10017893 3300026067 Bacteria 6225
214 Ga0207678_10026057 3300026067 Bacteria 5102
215 Ga0207678_10191483 3300026067 Bacteria 1748
216 Ga0207702_10002001 3300026078 Bacteria 19755
217 Ga0207702_10002550 3300026078 Bacteria 17144
218 Ga0207702_10005497 3300026078 Bacteria 11083
219 Ga0207702_10054396 3300026078 Bacteria 3391
220 Ga0207702_10078685 3300026078 Bacteria 2855
221 Ga0207702_10098504 3300026078 Bacteria 2575
222 Ga0207641_10080359 3300026088 Bacteria 2828
223 Ga0207698_10011041 3300026142 Bacteria 5839
224 Ga0207698_10025825 3300026142 Bacteria 4145
225 Ga0207698_10121837 3300026142 Bacteria 2209
226 Ga0209281_1000132 3300027111 Bacteria 188464
227 Ga0209281_1000330 3300027111 Bacteria 82146
228 Ga0209371_1001602 3300027312 Bacteria 14718
229 Ga0209282_1000018 3300027666 Bacteria 188472
230 Ga0268266_10000118 3300028379 Bacteria 163466
231 Ga0268266_10001257 3300028379 Bacteria 30973
232 Ga0268266_10012602 3300028379 Bacteria 7305
233 Ga0268265_10002034 3300028380 Bacteria 15864
234 Ga0268265_10008567 3300028380 Bacteria 6914
235 Ga0268265_10041658 3300028380 Bacteria 3401
236 Ga0268264_10019402 3300028381 Bacteria 5556
237 Ga0268264_10278778 3300028381 Bacteria 1565
238 Ga0268256_1001086 3300030500 Bacteria 17888
239 Ga0307513_10126056 3300031456 Bacteria 2516
240 Ga0265314_10012997 3300031711 Bacteria 6759
241 Ga0307405_10017380 3300031731 Bacteria 3945
242 Ga0307405_10157754 3300031731 Bacteria 1603
243 Ga0307413_10038369 3300031824 Bacteria 2776
244 Ga0307413_10040926 3300031824 Bacteria 2709
245 Ga0307410_10001826 3300031852 Bacteria 9892
246 Ga0307410_10017272 3300031852 Bacteria 4328
247 Ga0307406_10017840 3300031901 Bacteria 4139
248 Ga0315914_1004045 3300031967 Bacteria 22019
249 Ga0307409_100183859 3300031995 Bacteria 1853
250 Ga0307416_100151308 3300032002 Bacteria 2128
251 Ga0307414_10034270 3300032004 Bacteria 3364
252 Ga0307414_10046824 3300032004 Bacteria 2972
253 Ga0307414_10049109 3300032004 Bacteria 2915
254 Ga0307414_10316523 3300032004 Bacteria 1326
255 Ga0307411_10041163 3300032005 Bacteria 2937
256 Ga0307411_10087535 3300032005 Bacteria 2163
257 Ga0315913_1002336 3300033430 Bacteria 22163
258 Ga0315915_1000006 3300033464 Bacteria 330709
259 Ga0373935_0167194 3300035692 Bacteria 1502
260 Ga0373947_0122000 3300035725 Bacteria 1656
261 Ga0373925_0015079 3300037068 Bacteria 5585
262 Ga0395899_0000004 3300037312 Bacteria 874267
263 Ga0395899_0000258 3300037312 Bacteria 69644
264 Ga0395899_0000756 3300037312 Bacteria 32002
265 Ga0395899_0088385 3300037312 Bacteria 2248
266 Ga0395899_0118361 3300037312 Bacteria 1899
267 Ga0395899_0220709 3300037312 Bacteria 1313
268 Ga0395900_0000254 3300037418 Bacteria 83296
269 Ga0395900_0050033 3300037418 Bacteria 4305
270 Ga0395900_0077101 3300037418 Bacteria 3424
271 Ga0395900_0078585 3300037418 Bacteria 3390
272 Ga0395900_0084080 3300037418 Bacteria 3269
273 Ga0395900_0408505 3300037418 Bacteria 1320
274 Ga0395898_0001500 3300037466 Bacteria 32350
275 Ga0395898_0019847 3300037466 Bacteria 6836
276 Ga0395898_0271759 3300037466 Bacteria 1616
277 Ga0395898_0365240 3300037466 Bacteria 1376
278 Ga0395905_0000092 3300037471 Bacteria 149300
279 Ga0395905_0001268 3300037471 Bacteria 31200
280 Ga0395905_0034799 3300037471 Bacteria 4730
281 Ga0395905_0135777 3300037471 Bacteria 2314
282 Ga0395905_0249630 3300037471 Bacteria 1657
283 Ga0395901_0000030 3300038443 Bacteria 241916
284 Ga0395901_0059836 3300038443 Bacteria 3963
285 Ga0436365_0225864 3300039437 Bacteria 4367
286 Ga0436365_1414469 3300039437 Bacteria 13821
287 Ga0436361_0579226 3300039447 Bacteria 15069
288 Ga0436361_0650369 3300039447 Bacteria 5166
289 Ga0436361_0884472 3300039447 Bacteria 1660
290 Ga0439462_0018367 3300042015 Bacteria 1816
291 Ga0466969_0009620 3300044656 Bacteria 5123
292 Ga0466966_0000040 3300044684 Bacteria 97159
293 Ga0466963_0001063 3300044694 Bacteria 14300
294 Ga0466963_0039216 3300044694 Bacteria 3101
295 Ga0466970_0000013 3300044765 Bacteria 83194
296 Ga0466957_0002063 3300044842 Bacteria 10743
297 Ga0466957_0035118 3300044842 Bacteria 3008
298 Ga0466957_0050135 3300044842 Bacteria 2540
299 Ga0466959_0015238 3300045049 Bacteria 5598
300 Ga0466958_0003594 3300045836 Bacteria 8077
301 Ga0466967_0183494 3300045976 Bacteria 1975
302 Ga0495627_000064 3300046453 Bacteria 132648
303 Ga0495638_0000271 3300046460 Bacteria 69977
304 Ga0495583_0043213 3300046506 Bacteria 2099
305 Ga0495642_0000077 3300046528 Bacteria 57843
306 Ga0495654_0011793 3300046530 Bacteria 4718
307 Ga0495668_0010095 3300046616 Bacteria 5745
308 Ga0495658_0001680 3300046683 Bacteria 11515
309 Ga0495669_0031567 3300046684 Bacteria 2326
310 Ga0495671_0003564 3300046692 Bacteria 9502
311 Ga0495672_0001456 3300047320 Bacteria 23217
312 Ga0495673_0000350 3300047469 Bacteria 57843
313 Ga0495681_0000876 3300047470 Bacteria 23218
314 Ga0495686_0000260 3300047472 Bacteria 94551
315 Ga0496104_0008143 3300048907 Bacteria 9302
316 Ga0496105_0036105 3300048908 Bacteria 4070
317 Ga0496116_0025300 3300048919 Bacteria 4366
318 Ga0496117_0134261 3300048920 Bacteria 1494
319 Ga0496118_0086478 3300048921 Bacteria 2178
320 Ga0496119_0012032 3300048922 Bacteria 7078
321 Ga0496119_0073807 3300048922 Bacteria 1988
322 Ga0496122_0084643 3300048925 Bacteria 2192
323 Ga0496123_0018934 3300048926 Bacteria 5447
324 Ga0496124_0027225 3300048927 Bacteria 5137
325 Ga0496125_0029974 3300048928 Bacteria 4876
326 Ga0496125_0038285 3300048928 Bacteria 4154
327 Ga0501031_0018775 3300049568 Bacteria 4502
328 Ga0501032_0008644 3300049569 Bacteria 7422
329 Ga0501033_0107322 3300049570 Bacteria 2034
330 Ga0501038_0021682 3300049574 Bacteria 5763
331 Ga0501039_0033762 3300049575 Bacteria 3947
332 Ga0501039_0045899 3300049575 Bacteria 3376
333 Ga0501040_0032549 3300049576 Bacteria 3528
334 Ga0501043_0017544 3300049579 Bacteria 5612
335 Ga0501043_0122813 3300049579 Bacteria 2037
336 Ga0501047_0000070 3300049581 Bacteria 127146
337 Ga0501047_0021206 3300049581 Bacteria 6240
338 Ga0501048_0085365 3300049582 Bacteria 2226
339 Ga0501068_0035931 3300049584 Bacteria 2960
340 Ga0501068_0056684 3300049584 Bacteria 2375
341 Ga0501070_0000020 3300049586 Bacteria 169025
342 Ga0501071_0014607 3300049587 Bacteria 5373
343 Ga0501071_0042035 3300049587 Bacteria 3273
344 Ga0501072_0045747 3300049588 Bacteria 3442
345 Ga0501072_0057633 3300049588 Bacteria 3061
346 Ga0501072_0088535 3300049588 Bacteria 2456
347 Ga0501073_0010417 3300049589 Bacteria 6818
348 Ga0501074_0084923 3300049590 Bacteria 2269
349 Ga0501074_0092271 3300049590 Bacteria 2169
350 Ga0501075_0000489 3300049591 Bacteria 23691
351 Ga0501076_0074909 3300049592 Bacteria 2712
352 Ga0501076_0095251 3300049592 Bacteria 2397
353 Ga0501077_0099469 3300049593 Bacteria 1843
354 Ga0501079_0010578 3300049741 Bacteria 7019
355 Ga0501079_0152883 3300049741 Bacteria 1799
356 Ga0501080_0001196 3300049742 Bacteria 21518
357 Ga0501080_0020528 3300049742 Bacteria 6117
358 Ga0501080_0024995 3300049742 Bacteria 5541
359 Ga0501080_0121938 3300049742 Bacteria 2415
360 Ga0501081_0197992 3300049743 Bacteria 1456
361 Ga0501083_0001136 3300049744 Bacteria 17863
362 Ga0501035_0000349 3300049822 Bacteria 53020
363 Ga0501035_0042177 3300049822 Bacteria 4117
364 Ga0501044_0008968 3300049823 Bacteria 10936
365 Ga0501044_0017133 3300049823 Bacteria 7776
366 Ga0501045_0078570 3300049824 Bacteria 2432
367 nmdc:mga06z11_8558_c1 3300050494 Bacteria 4277
368 nmdc:mga06r32_7180_c1 3300050510 Bacteria 9642
369 Ga0500643_000386 3300053087 Bacteria 34137
370 Ga0500643_002276 3300053087 Bacteria 10073
371 Ga0500643_007177 3300053087 Bacteria 4551
372 Ga0500643_015919 3300053087 Bacteria 2565
373 Ga0500556_0001231 3300053104 Bacteria 11899
374 Ga0500592_000010 3300053116 Bacteria 76714
375 Ga0500618_001503 3300053125 Bacteria 10266
376 Ga0500658_0000041 3300053134 Bacteria 77435
377 Ga0500559_0032177 3300053136 Bacteria 2253
378 Ga0500568_0007029 3300053139 Bacteria 5567
379 Ga0500616_0000087 3300053153 Bacteria 192225
380 Ga0500627_0000036 3300053158 Bacteria 79400
381 Ga0500596_000669 3300053735 Bacteria 6639
382 Ga0501084_0015084 3300054114 Bacteria 6408
383 Ga0501084_0052768 3300054114 Bacteria 3401
384 Ga0501082_0002930 3300060353 Bacteria 14892
385 Ga0501082_0005325 3300060353 Bacteria 11184
386 Ga0501082_0103514 3300060353 Bacteria 2462
387 Ga0530510_0003021 3300061734 Bacteria 11553
388 2821451009 2821443989 Bacteria 7658172
389 2509110350 2508501122 Bacteria 6292184
390 2509377306 2509276019 Bacteria 6802256
391 2510303981 2510065057 Bacteria 6649661
392 2511184899 2510917028 Bacteria 6185411
393 2511497349 2511231052 Bacteria 6974333
394 2512529784 2512047086 Bacteria 6850303
395 2512969972 2512875026 Bacteria 6861065
396 2513582045 2513237086 Bacteria 7265287
397 2513595863 2513237088 Bacteria 6927906
398 2513602576 2513237089 Bacteria 6553624
399 2513615146 2513237091 Bacteria 6900273
400 2513869141 2513237138 Bacteria 7368160
401 2513881543 2513237140 Bacteria 7076289
402 2513901234 2513237143 Bacteria 6664116
403 2513984693 2513237156 Bacteria 6402557
404 2514005667 2513237160 Bacteria 6650282
405 2515609633 2515154107 Bacteria 6795637
406 2516207733 2516143018 Bacteria 6951533
407 2516895419 2516653046 Bacteria 6989037
408 2517565152 2517487022 Bacteria 7227575
409 2524463227 2524023209 Bacteria 6679728
410 2535519683 2534681796 Bacteria 7146037
411 2551682404 2551306084 Bacteria 8942552
412 2551688597 2551306085 Bacteria 7347181
413 2551690319 2551306086 Bacteria 6843938
414 2551700326 2551306087 Bacteria 7351905
415 2551711060 2551306089 Bacteria 7162724
416 2551720506 2551306090 Bacteria 7953713
417 2551730778 2551306091 Bacteria 7086830
418 2551744942 2551306093 Bacteria 7064773
419 2558862169 2558860100 Bacteria 8458965
420 2585200741 2582581294 Bacteria 6626667
421 2585334895 2582581316 Bacteria 7774528
422 2585401754 2582581867 Bacteria 7184437
423 2585820145 2585427590 Bacteria 6824633
424 2616552754 2615840698 Bacteria 7319877
425 2617380939 2617270742 Bacteria 6808054
426 2643727265 2643221541 Bacteria 5498788
427 2644040598 2643221605 Bacteria 4772303
428 2644041574 2643221606 Bacteria 5588032
429 2644395114 2643221671 Bacteria 5496681
430 2657684394 2657244999 Bacteria 5946535
431 2671114294 2667528174 Bacteria 6435400
432 2692318394 2690316117 Bacteria 6800650
433 2753462733 2751185821 Bacteria 6189929
434 2778174720 2775507266 Bacteria 7392367
435 2792583546 2791355082 Bacteria 5973319
436 2792619456 2791355091 Bacteria 6135441
437 2792627228 2791355092 Bacteria 6248105
438 2792639876 2791355094 Bacteria 7011481
439 2802716397 2802428858 Bacteria 6636079
440 2802722565 2802428859 Bacteria 6667919
441 2802729293 2802428860 Bacteria 6525526
442 2802735685 2802428861 Bacteria 6534206
443 2802741740 2802428862 Bacteria 6633353
444 2802748192 2802428863 Bacteria 6410669
445 2804754799 2802429268 Bacteria 6094027
446 2819608079 2818991448 Bacteria 6772224
447 2838030600 2838029111 Bacteria 6603031
448 2841863035 2841859092 Bacteria 5436171
449 2842303937 2842298080 Bacteria 6123127
450 2842477119 2842475841 Bacteria 6603183
451 2842485970 2842482326 Bacteria 7212537
452 2842503916 2842502639 Bacteria 6604161
453 2842519448 2842515876 Bacteria 5436280
454 2842777487 2842775625 Bacteria 5587290
455 2844535864 2844533157 Bacteria 7517899
456 2847423104 2847417321 Bacteria 6913799
457 2848997504 2848992105 Bacteria 6810864
458 2850085444 2850079185 Bacteria 6848280
459 2855828182 2855825444 Bacteria 6785811
460 2855843289 2855839649 Bacteria 7135830
461 2855874089 2855872281 Bacteria 6964271
462 2858805685 2858800743 Bacteria 6603254
463 2913295994 2913295892 Bacteria 6333755
464 2915984655 2915980308 Bacteria 6624279
465 2915987535 2915986958 Bacteria 6739310
466 2915995671 2915993759 Bacteria 7016183
467 2916012020 2916007675 Bacteria 6898660
468 2916017028 2916014648 Bacteria 6946486
469 2916025350 2916021584 Bacteria 6854472
470 2916029560 2916028427 Bacteria 6748433
471 2916039969 2916035215 Bacteria 6755766
472 2916047209 2916041962 Bacteria 6820487
473 2916051438 2916048683 Bacteria 6543552
474 2916059257 2916055098 Bacteria 6758838
475 2916061870 2916061851 Bacteria 6737736
476 2916083232 2916076590 Bacteria 6596108
477 2919412379 2919408235 Bacteria 6149349
478 2921208238 2921201388 Bacteria 6926299
479 2921211363 2921208531 Bacteria 6745326
480 2921241369 2921237296 Bacteria 6876710
481 2921246988 2921244191 Bacteria 6568419
482 2921255777 2921250672 Bacteria 6677771
483 2921257808 2921257292 Bacteria 6808382
484 2921267276 2921263974 Bacteria 6864552
485 2921287584 2921282425 Bacteria 6826397
486 2921293144 2921289301 Bacteria 7316391
487 2921296813 2921296804 Bacteria 7176999
488 2923560915 2923556063 Bacteria 6793593
489 2924144161 2924144063 Bacteria 6883928
490 2924151089 2924150972 Bacteria 7169444
491 2924158420 2924158325 Bacteria 7188855
492 2924166257 2924165586 Bacteria 7260590
493 2924173004 2924172951 Bacteria 6749356
494 2924179866 2924179722 Bacteria 6843264
495 2924187040 2924186466 Bacteria 6876637
496 2924197679 2924193448 Bacteria 6955718
497 2924202314 2924200457 Bacteria 6757188
498 2924210444 2924207177 Bacteria 6917007
499 2924214199 2924214083 Bacteria 7080103
500 2924228055 2924221636 Bacteria 7113495
501 2924229955 2924228884 Bacteria 6633132
502 2933016653 2933011516 Bacteria 5439334
503 2936996896 2936996657 Bacteria 6298727
504 2937004917 2937002841 Bacteria 6934057
505 2937013653 2937009748 Bacteria 6746052
506 2937016578 2937016420 Bacteria 6782579
507 2937026435 2937023124 Bacteria 6815156
508 2937032200 2937029754 Bacteria 6424026
509 2937041785 2937036028 Bacteria 6846469
510 2937044791 2937042894 Bacteria 6741576
511 2937055022 2937049772 Bacteria 6757901
512 2937059720 2937056579 Bacteria 7107896
513 2937066882 2937063883 Bacteria 7199456
514 2937073601 2937071275 Bacteria 6984483
515 2937080941 2937078374 Bacteria 6610289
516 2937094793 2937091812 Bacteria 6979387
517 2937100751 2937098957 Bacteria 7249374
518 2937108101 2937106411 Bacteria 6947143
519 2937119109 2937113482 Bacteria 6505872
520 2937121574 2937119839 Bacteria 6597547
521 2937127152 2937126314 Bacteria 6771275
522 2957377625 2957375807 Bacteria 6425588
523 2957387985 2957382221 Bacteria 6737050
524 2957392364 2957388812 Bacteria 6778072
525 2957395662 2957395598 Bacteria 6822399
526 2957402453 2957402308 Bacteria 6741770
527 2957413979 2957408893 Bacteria 6558585
528 2957418514 2957415311 Bacteria 6991633
529 2957433300 2957430029 Bacteria 7022557
530 2957438318 2957437181 Bacteria 6568994
531 2957444298 2957443900 Bacteria 6869977
532 2957455562 2957450854 Bacteria 6765715
533 2957460615 2957457609 Bacteria 6967680
534 2957466704 2957464669 Bacteria 6568877
535 2957471180 2957471148 Bacteria 6797643
536 2957482629 2957478035 Bacteria 6756658
537 2957490674 2957484790 Bacteria 6703082
538 2957497045 2957491536 Bacteria 6695180
539 2957503915 2957498199 Bacteria 7126688
540 2957512662 2957505466 Bacteria 7253085
541 2960586292 2960584000 Bacteria 6864594
542 2960592393 2960591022 Bacteria 6622873
543 2960599445 2960597568 Bacteria 6550735
544 2960607272 2960603979 Bacteria 6898737
545 2960611217 2960610863 Bacteria 6691244
546 2960619463 2960617483 Bacteria 6727748
547 2960627890 2960624210 Bacteria 6875384
548 2960631320 2960631154 Bacteria 6732508
549 2960641642 2960637947 Bacteria 7296468
550 2960647152 2960645483 Bacteria 7211087
551 2960653995 2960652885 Bacteria 7083688
552 2960662381 2960660292 Bacteria 7041660
553 2960669109 2960667422 Bacteria 6763020
554 2960674122 2960674078 Bacteria 6609048
555 2960682859 2960680706 Bacteria 6624464
556 2960689445 2960687367 Bacteria 6535474
557 2960696074 2960693952 Bacteria 6749742
558 2964608375 2964607997 Bacteria 7101408
559 2964617432 2964615318 Bacteria 6809089
560 2964623135 2964621998 Bacteria 6834995
561 2964630088 2964628898 Bacteria 7083044
562 2964638802 2964636051 Bacteria 7091832
563 2964645114 2964643177 Bacteria 6820887
564 2964651856 2964649959 Bacteria 6675118
565 2964660901 2964656573 Bacteria 7100150
566 2964667175 2964663802 Bacteria 7019362
567 2964672861 2964670856 Bacteria 6851364
568 2964682040 2964678106 Bacteria 6792020
569 2964688716 2964685014 Bacteria 6839111
570 2964697011 2964691889 Bacteria 6802758
571 2964701201 2964698721 Bacteria 6765331
572 2964705725 2964705432 Bacteria 7114648
573 2964715040 2964712639 Bacteria 6695970
574 2964724144 2964719344 Bacteria 7286602
575 2967669166 2967664464 Bacteria 6948836
576 2967675834 2967671571 Bacteria 7021409
577 2967683079 2967678726 Bacteria 7264382
578 2967686831 2967686174 Bacteria 6678622
579 2967697155 2967693043 Bacteria 6804451
580 2967705109 2967699805 Bacteria 6854538
581 2967707014 2967706974 Bacteria 7186053
582 2967717754 2967714385 Bacteria 7000047
583 2967727192 2967721400 Bacteria 7073753
584 2967731565 2967728569 Bacteria 6641507
585 2967740476 2967735183 Bacteria 6827012
586 2967742061 2967742019 Bacteria 6794534
587 2967752952 2967748971 Bacteria 6733771
588 2967758369 2967755722 Bacteria 6814706
589 2967768356 2967762386 Bacteria 6923502
590 2967771115 2967769361 Bacteria 6587838
591 2967776079 2967775926 Bacteria 6738189
592 2970021417 2970019648 Bacteria 7072033
593 2970026937 2970026789 Bacteria 6785236
594 2970036472 2970033650 Bacteria 7118744
595 2970045658 2970040964 Bacteria 6731123
596 2970051220 2970047711 Bacteria 7088379
597 2970055039 2970054988 Bacteria 6611507
598 2970066893 2970061556 Bacteria 7099761
599 2970071973 2970068827 Bacteria 7123112
600 2970076276 2970076120 Bacteria 6697332
601 2970082879 2970082768 Bacteria 6183754
602 2970090850 2970088815 Bacteria 6933825
603 2970096030 2970095765 Bacteria 6936963
604 2970104787 2970102677 Bacteria 6812532
605 2970109422 2970109326 Bacteria 6863976
606 2970116360 2970116247 Bacteria 6501857
607 2970128893 2970122695 Bacteria 6625855
608 2970132744 2970129317 Bacteria 6806560
609 2970142192 2970136068 Bacteria 7207982
610 2970148224 2970143518 Bacteria 6446480
611 2970150189 2970149975 Bacteria 6779706
612 2970159720 2970156795 Bacteria 7168044
613 2970166042 2970164137 Bacteria 6861252
614 2970175117 2970170962 Bacteria 6876229
615 2970177960 2970177841 Bacteria 6768001
616 2970188362 2970184632 Bacteria 7054431
617 2970195319 2970191845 Bacteria 7032787
618 2977516974 2977516862 Bacteria 6940108
619 2977526208 2977523885 Bacteria 6960446
620 2977533478 2977530762 Bacteria 6951399
621 2977544232 2977537788 Bacteria 6929320
622 2977548412 2977544691 Bacteria 6875412
623 2977553907 2977551784 Bacteria 7125765
624 2977561038 2977558990 Bacteria 6863948
625 2977568160 2977565890 Bacteria 6901543
626 2977577229 2977572785 Bacteria 6763888
627 2977582777 2977579622 Bacteria 6772100
628 2989353711 2989349275 Bacteria 6349068
629 2995393694 2995392953 Bacteria 4539380
630 2996887881 2996887358 Bacteria 5795980
631 3003935782 3003930520 Bacteria 5667563
632 3005420585 3005416602 Bacteria 7064308
633 643823002 643692032 Bacteria 6891900
634 648736886 648276728 Bacteria 6968865
635 8003995873 8003992118 Bacteria 7266902
636 8004003626 8003999396 Bacteria 7063185
637 8005259250 8005258706 Bacteria 6184835
638 8005318006 8005314921 Bacteria 7072929
639 8005322408 8005321885 Bacteria 5795980
640 8005487709 8005484373 Bacteria 6297373
641 8005547395 8005542996 Bacteria 7077758
642 8005650344 8005645114 Bacteria 6950293
643 8005683805 8005682033 Bacteria 6726518
644 8049297926 8049293176 Bacteria 6128433
645 JGI24736J21556_1002088
646 JGI24740J21852_10002065
647 JGI24740J21852_10007846
648 JGI24739J22299_10003494
649 JGI24739J22299_10033070
650 JGI25155J39150_1000043
651 JGI25156J39149_1000056
652 JGI25162J39368_1000074
653 JGI25162J39368_1001761
654 JGI25154J39366_1000086
655 JGI25157J39369_1000086
656 JGI25152J39213_1000745
657 JGI25152J39213_1004117
658 JGI25151J46595_10000400
659 JGI25165J46597_1000068
660 JGI25165J46597_1000537
661 JGI25153J46596_10027636
662 rootH1_10018885
663 rootH2_10003835
664 rootH2_10009015
665 rootL2_10012115
666 rootH1_10051830
667 rootH1_10070810
668 Ga0055524_1008339
669 Ga0055524_1010091
670 Ga0055528_1010360
671 Ga0070658_10000001
672 Ga0070658_10005984
673 Ga0070683_100039287
674 Ga0070670_100230551
675 Ga0068869_100020468
676 Ga0068868_100000001
677 Ga0070660_100000184
678 Ga0070660_100003723
679 Ga0070660_100006698
680 Ga0070661_100105148
681 Ga0070661_100153643
682 Ga0070692_10001068
683 Ga0070668_100131775
684 Ga0070669_100092494
685 Ga0070669_100136434
686 Ga0070671_100005893
687 Ga0070659_100000001
688 Ga0070659_100000984
689 Ga0070659_100001698
690 Ga0070659_100031264
691 Ga0070659_100060824
692 Ga0070667_100067074
693 Ga0070713_100016505
694 Ga0070663_100001497
695 Ga0070663_100031593
696 Ga0070663_100033565
697 Ga0070679_100207692
698 Ga0070684_100223228
699 Ga0068853_100067304
700 Ga0070686_100000194
701 Ga0070665_100006904
702 Ga0070665_100035910
703 Ga0068855_100341883
704 Ga0070664_100113106
705 Ga0068857_100065010
706 Ga0068854_100004180
707 Ga0068854_100109622
708 Ga0068854_100125592
709 Ga0068854_100211119
710 Ga0068856_100006069
711 Ga0068856_100011043
712 Ga0068856_100016897
713 Ga0068856_100024005
714 Ga0068856_100074238
715 Ga0068856_100125148
716 Ga0068852_100013467
717 Ga0068852_100068726
718 Ga0068852_100099006
719 Ga0068852_100109434
720 Ga0068864_100004726
721 Ga0068870_10083478
722 Ga0068863_100117729
723 Ga0068860_100040634
724 Ga0068860_100153007
725 Ga0068862_100009863
726 Ga0068862_100011017
727 Ga0068862_100073554
728 Ga0075367_10001856
729 Ga0075366_10020462
730 Ga0068871_100048960
731 Ga0075434_100061314
732 Ga0079104_1009785
733 Ga0105250_10083308
734 Ga0105240_10016809
735 Ga0105240_10052334
736 Ga0105240_10062030
737 Ga0105240_10120824
738 Ga0105245_10364339
739 Ga0105243_10000150
740 Ga0105241_10009912
741 Ga0105241_10030600
742 Ga0105248_10000005
743 Ga0105248_10001965
744 Ga0105248_10108184
745 Ga0105237_10019521
746 Ga0105237_10110555
747 Ga0105238_10046084
748 Ga0105238_10048684
749 Ga0123342_1004588
750 Ga0105239_10000300
751 Ga0105239_10024092
752 Ga0157373_10215976
753 Ga0157371_10000705
754 Ga0157371_10165399
755 Ga0157370_10044437
756 Ga0157370_10084977
757 Ga0157370_10116180
758 Ga0157370_10346663
759 Ga0157369_10000553
760 Ga0157369_10002565
761 Ga0157369_10009186
762 Ga0157369_10013284
763 Ga0157369_10107491
764 Ga0157369_10146826
765 Ga0171462_1018
766 Ga0157372_10157774
767 Ga0157372_10522377
768 Ga0163161_10004269
769 Ga0214544_1000130
770 Ga0214542_1000014
771 Ga0214542_1015520
772 Ga0214543_1000005
773 Ga0214543_1000146
774 Ga0213872_10018761
775 Ga0213876_10003603
776 Ga0213876_10024251
777 Ga0228711_1000009
778 Ga0228710_1000011
779 Ga0209435_100039
780 Ga0209437_100023
781 Ga0209437_100067
782 Ga0209646_1000137
783 Ga0209026_1000135
784 Ga0209759_1000154
785 Ga0209129_1001217
786 Ga0209233_1000088
787 Ga0209233_1000219
788 Ga0209673_1010743
789 Ga0209673_1013794
790 Ga0209025_1000486
791 Ga0209025_1029263
792 Ga0209564_1007884
793 Ga0209564_1015410
794 Ga0209758_1005395
795 Ga0209256_1004539
796 Ga0209256_1006393
797 Ga0207426_1000092
798 Ga0207426_1000730
799 Ga0209051_1000801
800 Ga0207647_10007269
801 Ga0207645_10067906
802 Ga0207705_10000002
803 Ga0207705_10000050
804 Ga0207705_10000060
805 Ga0207705_10000274
806 Ga0207705_10006806
807 Ga0207705_10008785
808 Ga0207705_10089423
809 Ga0207654_10000442
810 Ga0207654_10004226
811 Ga0207707_10031948
812 Ga0207695_10003088
813 Ga0207695_10003338
814 Ga0207695_10042758
815 Ga0207695_10124933
816 Ga0207695_10153554
817 Ga0207671_10012484
818 Ga0207660_10003617
819 Ga0207657_10000210
820 Ga0207657_10000301
821 Ga0207657_10002610
822 Ga0207657_10009499
823 Ga0207649_10000826
824 Ga0207649_10042880
825 Ga0207649_10080598
826 Ga0207681_10026824
827 Ga0207694_10000230
828 Ga0207694_10010416
829 Ga0207694_10023287
830 Ga0207690_10000018
831 Ga0207690_10000052
832 Ga0207690_10006516
833 Ga0207690_10010071
834 Ga0207690_10033889
835 Ga0207706_10018713
836 Ga0207709_10000005
837 Ga0207689_10017877
838 Ga0207661_10134254
839 Ga0207667_10000327
840 Ga0207667_10004913
841 Ga0207667_10059054
842 Ga0207667_10080132
843 Ga0207640_10000668
844 Ga0207640_10001866
845 Ga0207640_10002879
846 Ga0207640_10031181
847 Ga0207640_10037021
848 Ga0207640_10102970
849 Ga0207658_10019218
850 Ga0207677_10000024
851 Ga0207639_10023974
852 Ga0207639_10027413
853 Ga0207639_10065772
854 Ga0207639_10084789
855 Ga0207678_10001868
856 Ga0207678_10017893
857 Ga0207678_10026057
858 Ga0207678_10191483
859 Ga0207702_10002001
860 Ga0207702_10002550
861 Ga0207702_10005497
862 Ga0207702_10054396
863 Ga0207702_10078685
864 Ga0207702_10098504
865 Ga0207641_10080359
866 Ga0207698_10011041
867 Ga0207698_10025825
868 Ga0207698_10121837
869 Ga0209281_1000132
870 Ga0209281_1000330
871 Ga0209371_1001602
872 Ga0209282_1000018
873 Ga0268266_10000118
874 Ga0268266_10001257
875 Ga0268266_10012602
876 Ga0268265_10002034
877 Ga0268265_10008567
878 Ga0268265_10041658
879 Ga0268264_10019402
880 Ga0268264_10278778
881 Ga0268256_1001086
882 Ga0307513_10126056
883 Ga0265314_10012997
884 Ga0307405_10017380
885 Ga0307405_10157754
886 Ga0307413_10038369
887 Ga0307413_10040926
888 Ga0307410_10001826
889 Ga0307410_10017272
890 Ga0307406_10017840
891 Ga0315914_1004045
892 Ga0307409_100183859
893 Ga0307416_100151308
894 Ga0307414_10034270
895 Ga0307414_10046824
896 Ga0307414_10049109
897 Ga0307414_10316523
898 Ga0307411_10041163
899 Ga0307411_10087535
900 Ga0315913_1002336
901 Ga0315915_1000006
902 Ga0373935_0167194
903 Ga0373947_0122000
904 Ga0373925_0015079
905 Ga0395899_0000004
906 Ga0395899_0000258
907 Ga0395899_0000756
908 Ga0395899_0088385
909 Ga0395899_0118361
910 Ga0395899_0220709
911 Ga0395900_0000254
912 Ga0395900_0050033
913 Ga0395900_0077101
914 Ga0395900_0078585
915 Ga0395900_0084080
916 Ga0395900_0408505
917 Ga0395898_0001500
918 Ga0395898_0019847
919 Ga0395898_0271759
920 Ga0395898_0365240
921 Ga0395905_0000092
922 Ga0395905_0001268
923 Ga0395905_0034799
924 Ga0395905_0135777
925 Ga0395905_0249630
926 Ga0395901_0000030
927 Ga0395901_0059836
928 Ga0436365_0225864
929 Ga0436365_1414469
930 Ga0436361_0579226
931 Ga0436361_0650369
932 Ga0436361_0884472
933 Ga0439462_0018367
934 Ga0466969_0009620
935 Ga0466966_0000040
936 Ga0466963_0001063
937 Ga0466963_0039216
938 Ga0466970_0000013
939 Ga0466957_0002063
940 Ga0466957_0035118
941 Ga0466957_0050135
942 Ga0466959_0015238
943 Ga0466958_0003594
944 Ga0466967_0183494
945 Ga0495627_000064
946 Ga0495638_0000271
947 Ga0495583_0043213
948 Ga0495642_0000077
949 Ga0495654_0011793
950 Ga0495668_0010095
951 Ga0495658_0001680
952 Ga0495669_0031567
953 Ga0495671_0003564
954 Ga0495672_0001456
955 Ga0495673_0000350
956 Ga0495681_0000876
957 Ga0495686_0000260
958 Ga0496104_0008143
959 Ga0496105_0036105
960 Ga0496116_0025300
961 Ga0496117_0134261
962 Ga0496118_0086478
963 Ga0496119_0012032
964 Ga0496119_0073807
965 Ga0496122_0084643
966 Ga0496123_0018934
967 Ga0496124_0027225
968 Ga0496125_0029974
969 Ga0496125_0038285
970 Ga0501031_0018775
971 Ga0501032_0008644
972 Ga0501033_0107322
973 Ga0501038_0021682
974 Ga0501039_0033762
975 Ga0501039_0045899
976 Ga0501040_0032549
977 Ga0501043_0017544
978 Ga0501043_0122813
979 Ga0501047_0000070
980 Ga0501047_0021206
981 Ga0501048_0085365
982 Ga0501068_0035931
983 Ga0501068_0056684
984 Ga0501070_0000020
985 Ga0501071_0014607
986 Ga0501071_0042035
987 Ga0501072_0045747
988 Ga0501072_0057633
989 Ga0501072_0088535
990 Ga0501073_0010417
991 Ga0501074_0084923
992 Ga0501074_0092271
993 Ga0501075_0000489
994 Ga0501076_0074909
995 Ga0501076_0095251
996 Ga0501077_0099469
997 Ga0501079_0010578
998 Ga0501079_0152883
999 Ga0501080_0001196
1000 Ga0501080_0020528
1001 Ga0501080_0024995
1002 Ga0501080_0121938
1003 Ga0501081_0197992
1004 Ga0501083_0001136
1005 Ga0501035_0000349
1006 Ga0501035_0042177
1007 Ga0501044_0008968
1008 Ga0501044_0017133
1009 Ga0501045_0078570
1010 nmdc:mga06z11_8558_c1
1011 nmdc:mga06r32_7180_c1
1012 Ga0500643_000386
1013 Ga0500643_002276
1014 Ga0500643_007177
1015 Ga0500643_015919
1016 Ga0500556_0001231
1017 Ga0500592_000010
1018 Ga0500618_001503
1019 Ga0500658_0000041
1020 Ga0500559_0032177
1021 Ga0500568_0007029
1022 Ga0500616_0000087
1023 Ga0500627_0000036
1024 Ga0500596_000669
1025 Ga0501084_0015084
1026 Ga0501084_0052768
1027 Ga0501082_0002930
1028 Ga0501082_0005325
1029 Ga0501082_0103514
1030 Ga0530510_0003021
1031 2821451009
1032 2509110350
1033 2509377306
1034 2510303981
1035 2511184899
1036 2511497349
1037 2512529784
1038 2512969972
1039 2513582045
1040 2513595863
1041 2513602576
1042 2513615146
1043 2513869141
1044 2513881543
1045 2513901234
1046 2513984693
1047 2514005667
1048 2515609633
1049 2516207733
1050 2516895419
1051 2517565152
1052 2524463227
1053 2535519683
1054 2551682404
1055 2551688597
1056 2551690319
1057 2551700326
1058 2551711060
1059 2551720506
1060 2551730778
1061 2551744942
1062 2558862169
1063 2585200741
1064 2585334895
1065 2585401754
1066 2585820145
1067 2616552754
1068 2617380939
1069 2643727265
1070 2644040598
1071 2644041574
1072 2644395114
1073 2657684394
1074 2671114294
1075 2692318394
1076 2753462733
1077 2778174720
1078 2792583546
1079 2792619456
1080 2792627228
1081 2792639876
1082 2802716397
1083 2802722565
1084 2802729293
1085 2802735685
1086 2802741740
1087 2802748192
1088 2804754799
1089 2819608079
1090 2838030600
1091 2841863035
1092 2842303937
1093 2842477119
1094 2842485970
1095 2842503916
1096 2842519448
1097 2842777487
1098 2844535864
1099 2847423104
1100 2848997504
1101 2850085444
1102 2855828182
1103 2855843289
1104 2855874089
1105 2858805685
1106 2913295994
1107 2915984655
1108 2915987535
1109 2915995671
1110 2916012020
1111 2916017028
1112 2916025350
1113 2916029560
1114 2916039969
1115 2916047209
1116 2916051438
1117 2916059257
1118 2916061870
1119 2916083232
1120 2919412379
1121 2921208238
1122 2921211363
1123 2921241369
1124 2921246988
1125 2921255777
1126 2921257808
1127 2921267276
1128 2921287584
1129 2921293144
1130 2921296813
1131 2923560915
1132 2924144161
1133 2924151089
1134 2924158420
1135 2924166257
1136 2924173004
1137 2924179866
1138 2924187040
1139 2924197679
1140 2924202314
1141 2924210444
1142 2924214199
1143 2924228055
1144 2924229955
1145 2933016653
1146 2936996896
1147 2937004917
1148 2937013653
1149 2937016578
1150 2937026435
1151 2937032200
1152 2937041785
1153 2937044791
1154 2937055022
1155 2937059720
1156 2937066882
1157 2937073601
1158 2937080941
1159 2937094793
1160 2937100751
1161 2937108101
1162 2937119109
1163 2937121574
1164 2937127152
1165 2957377625
1166 2957387985
1167 2957392364
1168 2957395662
1169 2957402453
1170 2957413979
1171 2957418514
1172 2957433300
1173 2957438318
1174 2957444298
1175 2957455562
1176 2957460615
1177 2957466704
1178 2957471180
1179 2957482629
1180 2957490674
1181 2957497045
1182 2957503915
1183 2957512662
1184 2960586292
1185 2960592393
1186 2960599445
1187 2960607272
1188 2960611217
1189 2960619463
1190 2960627890
1191 2960631320
1192 2960641642
1193 2960647152
1194 2960653995
1195 2960662381
1196 2960669109
1197 2960674122
1198 2960682859
1199 2960689445
1200 2960696074
1201 2964608375
1202 2964617432
1203 2964623135
1204 2964630088
1205 2964638802
1206 2964645114
1207 2964651856
1208 2964660901
1209 2964667175
1210 2964672861
1211 2964682040
1212 2964688716
1213 2964697011
1214 2964701201
1215 2964705725
1216 2964715040
1217 2964724144
1218 2967669166
1219 2967675834
1220 2967683079
1221 2967686831
1222 2967697155
1223 2967705109
1224 2967707014
1225 2967717754
1226 2967727192
1227 2967731565
1228 2967740476
1229 2967742061
1230 2967752952
1231 2967758369
1232 2967768356
1233 2967771115
1234 2967776079
1235 2970021417
1236 2970026937
1237 2970036472
1238 2970045658
1239 2970051220
1240 2970055039
1241 2970066893
1242 2970071973
1243 2970076276
1244 2970082879
1245 2970090850
1246 2970096030
1247 2970104787
1248 2970109422
1249 2970116360
1250 2970128893
1251 2970132744
1252 2970142192
1253 2970148224
1254 2970150189
1255 2970159720
1256 2970166042
1257 2970175117
1258 2970177960
1259 2970188362
1260 2970195319
1261 2977516974
1262 2977526208
1263 2977533478
1264 2977544232
1265 2977548412
1266 2977553907
1267 2977561038
1268 2977568160
1269 2977577229
1270 2977582777
1271 2989353711
1272 2995393694
1273 2996887881
1274 3003935782
1275 3005420585
1276 643823002
1277 648736886
1278 8003995873
1279 8004003626
1280 8005259250
1281 8005318006
1282 8005322408
1283 8005487709
1284 8005547395
1285 8005650344
1286 8005683805
1287 8049297926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02817

E3_binding

e3 binding domain

157

192

0.97

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

221

454

0.95

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

6

78

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9453 3 75
1w4h-assembly1.cif.gz_A peripheral-subunit from mesophilic, thermophilic and hyperthermophilic bacteria fold by ultrafast, apparently two-state transitions 0.9436 128 167
1w88-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9426 129 164
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9411 1 75
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.9354 3 75
ID Description Score Start End Superfamily
3rnmF00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.9617 129 169 4.10.320.10
af_Q9FLQ4_93_170_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9585 1 75 2.40.50.100
af_Q8H107_76_169_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9579 2 74 2.40.50.100
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9528 4 75 2.40.50.100
af_P0AFG6_2_81_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9491 2 78 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A0F2QVG6-F1-model_v4 Glutaconyl-CoA decarboxylase subunit gamma 0.96 3 75
AF-A0A6G6X4P7-F1-model_v4 2-oxoglutarate dehydrogenase E1 component (Alpha-ketoglutarate dehydrogenase) 0.9589 3 74 GO:0016624
AF-A0A7C2YCB7-F1-model_v4 Biotin attachment protein 0.9572 2 74 GO:0005737
GO:0016407
GO:0031405
AF-A0A6N2EAQ1-F1-model_v4 Lipoyl-binding domain-containing protein 0.956 2 75 GO:0005737
GO:0016407
GO:0031405
AF-A0A2V8L4T0-F1-model_v4 Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 0.9543 3 75

Map