F472007

General Info

Members Datasets Scaffolds Average Seq Length
644 223 1288 99

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1009690|JGI24741J21665_10096902
Length 89
Sequence MIAVFQIIQLLLSVVTWIIFNVINTHNDFVRQLLYALSRMTEPMYRPIRRIMPDFGALDFSPLVVLLLIQIVSGIIIPHLEVSLLTAGA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
216 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
219 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 4.04
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1009690 3300001915 Bacteria 1757
2 LJQas_1004057 3300000549 Bacteria 1925
3 JGI24736J21556_1059420 3300001904 Bacteria 591
4 JGI24741J21665_1056114 3300001915 Bacteria 580
5 JGI24740J21852_10043130 3300001979 Bacteria 1347
6 JGI24740J21852_10094440 3300001979 Bacteria 768
7 JGI24739J22299_10008673 3300001989 Bacteria 3792
8 JGI24739J22299_10055781 3300001989 Bacteria 1262
9 JGI24739J22299_10151468 3300001989 Bacteria 686
10 JGI24737J22298_10001243 3300001990 Bacteria 9004
11 JGI24737J22298_10057625 3300001990 Bacteria 1172
12 JGI24743J22301_10059234 3300001991 Bacteria 787
13 JGI24735J21928_10002241 3300002067 Bacteria 6764
14 JGI24735J21928_10047889 3300002067 Bacteria 1238
15 JGI24735J21928_10055269 3300002067 Bacteria 1144
16 JGI24735J21928_10091729 3300002067 Bacteria 871
17 JGI24735J21928_10136456 3300002067 Bacteria 707
18 JGI24735J21928_10210420 3300002067 Bacteria 564
19 JGI24738J21930_10001440 3300002075 Bacteria 6610
20 JGI24738J21930_10015042 3300002075 Bacteria 1651
21 JGI24738J21930_10041125 3300002075 Bacteria 939
22 JGI24744J21845_10007524 3300002077 Bacteria 2250
23 JGI24742J22300_10105622 3300002244 Bacteria 548
24 JGI25157J39369_1013249 3300002741 Bacteria 1040
25 JGI25165J46597_1000040 3300003214 Bacteria 277491
26 Ga0055542_1001654 3300003762 Bacteria 9990
27 Ga0055529_1005922 3300003763 Bacteria 1739
28 Ga0065715_10512583 3300005293 Bacteria 770
29 Ga0070658_10000022 3300005327 Bacteria 186706
30 Ga0070658_10003723 3300005327 Bacteria 12473
31 Ga0070658_10007308 3300005327 Bacteria 8922
32 Ga0070658_10030124 3300005327 Bacteria 4361
33 Ga0070658_10050893 3300005327 Bacteria 3358
34 Ga0070658_10057701 3300005327 Bacteria 3158
35 Ga0070658_10491993 3300005327 Bacteria 1059
36 Ga0070658_11026774 3300005327 Bacteria 717
37 Ga0070676_10188562 3300005328 Bacteria 1345
38 Ga0070683_100157353 3300005329 Bacteria 2155
39 Ga0070683_100775204 3300005329 Bacteria 919
40 Ga0070690_100007013 3300005330 Bacteria 6423
41 Ga0070690_100846865 3300005330 Bacteria 712
42 Ga0070670_100053682 3300005331 Bacteria 3461
43 Ga0070670_100466547 3300005331 Bacteria 1120
44 Ga0070677_10521097 3300005333 Bacteria 647
45 Ga0070666_10004292 3300005335 Bacteria 8676
46 Ga0070666_10043239 3300005335 Bacteria 3016
47 Ga0070680_100000683 3300005336 Bacteria 23493
48 Ga0070680_100005956 3300005336 Bacteria 9250
49 Ga0070680_100111365 3300005336 Bacteria 2279
50 Ga0070682_100022704 3300005337 Bacteria 3719
51 Ga0068868_100128441 3300005338 Bacteria 2072
52 Ga0068868_101970044 3300005338 Bacteria 554
53 Ga0070660_100000212 3300005339 Bacteria 39028
54 Ga0070660_100000751 3300005339 Bacteria 21524
55 Ga0070660_100009089 3300005339 Bacteria 6976
56 Ga0070660_100036201 3300005339 Bacteria 3737
57 Ga0070660_100058544 3300005339 Bacteria 2986
58 Ga0070660_100059159 3300005339 Bacteria 2971
59 Ga0070660_100087592 3300005339 Bacteria 2451
60 Ga0070660_100101033 3300005339 Bacteria 2285
61 Ga0070660_100142921 3300005339 Bacteria 1921
62 Ga0070660_100204728 3300005339 Bacteria 1601
63 Ga0070660_101229501 3300005339 Unclassified 635
64 Ga0070660_101356752 3300005339 Bacteria 604
65 Ga0070689_100191079 3300005340 Bacteria 1667
66 Ga0070687_100449035 3300005343 Bacteria 857
67 Ga0070661_100092611 3300005344 Bacteria 2239
68 Ga0070661_101214502 3300005344 Bacteria 631
69 Ga0070661_101732613 3300005344 Bacteria 530
70 Ga0070692_10018011 3300005345 Bacteria 3388
71 Ga0070692_10405270 3300005345 Bacteria 862
72 Ga0070692_10500975 3300005345 Unclassified 787
73 Ga0070668_100000009 3300005347 Bacteria 136884
74 Ga0070668_101749405 3300005347 Bacteria 571
75 Ga0070675_100014931 3300005354 Bacteria 6133
76 Ga0070675_100635906 3300005354 Bacteria 969
77 Ga0070675_101268679 3300005354 Bacteria 679
78 Ga0070671_100000098 3300005355 Bacteria 55077
79 Ga0070671_100007591 3300005355 Bacteria 8672
80 Ga0070671_100037988 3300005355 Bacteria 3996
81 Ga0070671_100589986 3300005355 Bacteria 960
82 Ga0070674_100014374 3300005356 Bacteria 4922
83 Ga0070674_100058710 3300005356 Bacteria 2675
84 Ga0070673_100003346 3300005364 Bacteria 9964
85 Ga0070673_101104519 3300005364 Bacteria 741
86 Ga0070673_101230150 3300005364 Bacteria 702
87 Ga0070673_101740011 3300005364 Bacteria 590
88 Ga0070688_100394290 3300005365 Bacteria 1023
89 Ga0070659_100075326 3300005366 Bacteria 2690
90 Ga0070659_100212273 3300005366 Bacteria 1595
91 Ga0070659_100234456 3300005366 Bacteria 1517
92 Ga0070659_100371804 3300005366 Bacteria 1203
93 Ga0070659_101308496 3300005366 Bacteria 643
94 Ga0070667_100014991 3300005367 Bacteria 6404
95 Ga0070667_100721756 3300005367 Bacteria 923
96 Ga0070663_100004783 3300005455 Bacteria 7986
97 Ga0070663_100062771 3300005455 Bacteria 2680
98 Ga0070663_100771104 3300005455 Bacteria 823
99 Ga0070663_101245291 3300005455 Bacteria 655
100 Ga0070663_101928583 3300005455 Bacteria 531
101 Ga0070678_100033684 3300005456 Bacteria 3560
102 Ga0070678_100046037 3300005456 Bacteria 3125
103 Ga0070662_100197093 3300005457 Bacteria 1596
104 Ga0070662_101887963 3300005457 Bacteria 516
105 Ga0070681_10224690 3300005458 Bacteria 1792
106 Ga0068867_100002136 3300005459 Bacteria 13892
107 Ga0070679_100211558 3300005530 Bacteria 1903
108 Ga0070679_101060232 3300005530 Bacteria 755
109 Ga0070679_101509512 3300005530 Unclassified 619
110 Ga0070684_100021129 3300005535 Bacteria 5409
111 Ga0068853_100014991 3300005539 Bacteria 6368
112 Ga0068853_100039431 3300005539 Bacteria 4028
113 Ga0068853_100142436 3300005539 Bacteria 2153
114 Ga0068853_100399728 3300005539 Bacteria 1286
115 Ga0068853_101568583 3300005539 Bacteria 638
116 Ga0070672_100011066 3300005543 Bacteria 6281
117 Ga0070672_100086454 3300005543 Bacteria 2521
118 Ga0070672_101943151 3300005543 Bacteria 530
119 Ga0070686_100147263 3300005544 Bacteria 1645
120 Ga0070686_100168303 3300005544 Bacteria 1548
121 Ga0070693_100311889 3300005547 Bacteria 1064
122 Ga0070693_101347580 3300005547 Bacteria 553
123 Ga0070665_100154914 3300005548 Bacteria 2293
124 Ga0070665_100222949 3300005548 Bacteria 1886
125 Ga0070665_100556885 3300005548 Bacteria 1159
126 Ga0068855_100000079 3300005563 Bacteria 117264
127 Ga0068855_100001164 3300005563 Bacteria 32603
128 Ga0068855_100074321 3300005563 Bacteria 3948
129 Ga0068855_100135870 3300005563 Bacteria 2806
130 Ga0068855_100381789 3300005563 Bacteria 1547
131 Ga0068855_101106566 3300005563 Bacteria 828
132 Ga0068857_100043136 3300005577 Bacteria 4001
133 Ga0068857_100058302 3300005577 Bacteria 3428
134 Ga0068854_100003204 3300005578 Bacteria 10212
135 Ga0068854_100107471 3300005578 Bacteria 2100
136 Ga0068854_100875848 3300005578 Bacteria 788
137 Ga0068856_100013426 3300005614 Bacteria 7930
138 Ga0068856_100015289 3300005614 Bacteria 7416
139 Ga0068856_100124219 3300005614 Bacteria 2583
140 Ga0068856_100169948 3300005614 Bacteria 2192
141 Ga0068856_100601597 3300005614 Bacteria 1120
142 Ga0068856_100834864 3300005614 Bacteria 941
143 Ga0068856_101022253 3300005614 Bacteria 845
144 Ga0068856_101803531 3300005614 Unclassified 623
145 Ga0068852_100045398 3300005616 Bacteria 3737
146 Ga0068852_100104429 3300005616 Bacteria 2564
147 Ga0068852_100414295 3300005616 Bacteria 1328
148 Ga0068852_102269602 3300005616 Unclassified 564
149 Ga0068859_100025222 3300005617 Bacteria 5966
150 Ga0068859_100028499 3300005617 Bacteria 5598
151 Ga0068859_100060239 3300005617 Bacteria 3825
152 Ga0068859_100282737 3300005617 Bacteria 1752
153 Ga0068859_101487985 3300005617 Bacteria 747
154 Ga0068864_100091289 3300005618 Bacteria 2686
155 Ga0068866_10009481 3300005718 Bacteria 4134
156 Ga0068851_10013745 3300005834 Bacteria 3832
157 Ga0068851_10076113 3300005834 Bacteria 1745
158 Ga0068851_10170800 3300005834 Bacteria 1200
159 Ga0068851_10270961 3300005834 Bacteria 968
160 Ga0068851_10671319 3300005834 Bacteria 636
161 Ga0068863_100000040 3300005841 Bacteria 158465
162 Ga0068863_100011841 3300005841 Bacteria 8430
163 Ga0068858_100074689 3300005842 Bacteria 3148
164 Ga0068858_100147612 3300005842 Bacteria 2209
165 Ga0068860_100039460 3300005843 Bacteria 4516
166 Ga0068860_100150631 3300005843 Bacteria 2240
167 Ga0068860_100246295 3300005843 Bacteria 1739
168 Ga0068862_100026335 3300005844 Bacteria 4887
169 Ga0068862_101180886 3300005844 Bacteria 763
170 Ga0081539_10023429 3300005985 Bacteria 4046
171 Ga0097621_100001388 3300006237 Bacteria 16665
172 Ga0097621_100013189 3300006237 Bacteria 6149
173 Ga0097621_100955552 3300006237 Bacteria 800
174 Ga0068871_100002654 3300006358 Bacteria 12217
175 Ga0068871_100508967 3300006358 Bacteria 1086
176 Ga0068865_100001550 3300006881 Bacteria 13415
177 Ga0097620_100025222 3300006931 Bacteria 5966
178 Ga0097620_100028499 3300006931 Bacteria 5598
179 Ga0097620_100060239 3300006931 Bacteria 3825
180 Ga0097620_100282735 3300006931 Bacteria 1752
181 Ga0097620_101487880 3300006931 Bacteria 747
182 Ga0105240_10195311 3300009093 Bacteria 2377
183 Ga0105240_10523701 3300009093 Bacteria 1315
184 Ga0105240_11016101 3300009093 Bacteria 886
185 Ga0105240_11479079 3300009093 Bacteria 713
186 Ga0105240_11772168 3300009093 Bacteria 644
187 Ga0105245_10006481 3300009098 Bacteria 10291
188 Ga0105247_11284427 3300009101 Bacteria 587
189 Ga0105243_10008878 3300009148 Bacteria 7692
190 Ga0105243_10556538 3300009148 Bacteria 1097
191 Ga0105241_10407683 3300009174 Bacteria 1194
192 Ga0105241_10411987 3300009174 Bacteria 1188
193 Ga0105241_12656254 3300009174 Bacteria 504
194 Ga0105242_10468643 3300009176 Bacteria 1191
195 Ga0105238_10115889 3300009551 Bacteria 2659
196 Ga0105238_10120121 3300009551 Bacteria 2608
197 Ga0105238_10212626 3300009551 Bacteria 1910
198 Ga0105238_10213649 3300009551 Bacteria 1905
199 Ga0105238_10654371 3300009551 Bacteria 1061
200 Ga0105238_10771949 3300009551 Bacteria 976
201 Ga0105238_11166722 3300009551 Bacteria 794
202 Ga0105238_11322918 3300009551 Bacteria 747
203 Ga0105249_10001735 3300009553 Bacteria 19048
204 Ga0105239_10110863 3300010375 Bacteria 3041
205 Ga0105239_10223798 3300010375 Bacteria 2110
206 Ga0105239_10544033 3300010375 Bacteria 1322
207 Ga0105239_10823445 3300010375 Bacteria 1064
208 Ga0105246_10823511 3300011119 Bacteria 826
209 Ga0105246_11427634 3300011119 Bacteria 647
210 Ga0157373_10039126 3300013100 Bacteria 3396
211 Ga0157373_10089696 3300013100 Bacteria 2165
212 Ga0157373_10185883 3300013100 Bacteria 1464
213 Ga0157373_10317179 3300013100 Bacteria 1108
214 Ga0157371_10000558 3300013102 Bacteria 44161
215 Ga0157371_10038395 3300013102 Bacteria 3426
216 Ga0157371_10073063 3300013102 Bacteria 2429
217 Ga0157371_10466437 3300013102 Bacteria 930
218 Ga0157371_10729058 3300013102 Unclassified 743
219 Ga0157371_11516260 3300013102 Unclassified 523
220 Ga0157370_10000117 3300013104 Bacteria 92168
221 Ga0157370_10097405 3300013104 Bacteria 2759
222 Ga0157370_10148254 3300013104 Bacteria 2184
223 Ga0157370_10152799 3300013104 Bacteria 2148
224 Ga0157370_10834916 3300013104 Bacteria 838
225 Ga0157370_11370216 3300013104 Bacteria 637
226 Ga0157370_11480549 3300013104 Bacteria 610
227 Ga0157369_10007204 3300013105 Bacteria 12816
228 Ga0157369_10014466 3300013105 Bacteria 8907
229 Ga0157369_10042284 3300013105 Bacteria 4972
230 Ga0157369_10224048 3300013105 Bacteria 1967
231 Ga0157369_10666497 3300013105 Bacteria 1072
232 Ga0157369_10945017 3300013105 Bacteria 883
233 Ga0157369_10981418 3300013105 Bacteria 865
234 Ga0157369_11616413 3300013105 Bacteria 659
235 Ga0157374_10062500 3300013296 Bacteria 3490
236 Ga0157374_10332629 3300013296 Bacteria 1507
237 Ga0157374_10365541 3300013296 Bacteria 1435
238 Ga0157374_10694771 3300013296 Bacteria 1030
239 Ga0157374_12771071 3300013296 Unclassified 518
240 Ga0157378_10031009 3300013297 Bacteria 4721
241 Ga0163162_10148849 3300013306 Bacteria 2458
242 Ga0163162_10787967 3300013306 Bacteria 1068
243 Ga0163162_11920567 3300013306 Bacteria 678
244 Ga0157372_10093707 3300013307 Bacteria 3418
245 Ga0157372_10346343 3300013307 Bacteria 1731
246 Ga0157372_10379691 3300013307 Bacteria 1647
247 Ga0157372_10431458 3300013307 Bacteria 1536
248 Ga0157372_11220442 3300013307 Bacteria 869
249 Ga0157372_12103677 3300013307 Bacteria 648
250 Ga0157375_10123420 3300013308 Bacteria 2702
251 Ga0157375_11586263 3300013308 Bacteria 774
252 Ga0157375_11728614 3300013308 Bacteria 741
253 Ga0163163_10227938 3300014325 Bacteria 1912
254 Ga0163163_10956102 3300014325 Bacteria 920
255 Ga0157380_12648270 3300014326 Bacteria 568
256 Ga0157377_10172911 3300014745 Bacteria 1352
257 Ga0157379_10100287 3300014968 Bacteria 2599
258 Ga0157376_10053115 3300014969 Bacteria 3372
259 Ga0157376_12071827 3300014969 Bacteria 607
260 Ga0209026_1003463 3300025250 Bacteria 5157
261 Ga0209148_1000147 3300025254 Bacteria 160231
262 Ga0209148_1002428 3300025254 Bacteria 6428
263 Ga0209233_1000003 3300025261 Bacteria 1607366
264 Ga0209455_1000707 3300025272 Bacteria 19438
265 Ga0209455_1048315 3300025272 Bacteria 609
266 Ga0207697_10063527 3300025315 Bacteria 1539
267 Ga0207697_10111110 3300025315 Bacteria 1173
268 Ga0207697_10406936 3300025315 Bacteria 604
269 Ga0207656_10006606 3300025321 Bacteria 4184
270 Ga0207656_10045322 3300025321 Bacteria 1882
271 Ga0207656_10286700 3300025321 Bacteria 813
272 Ga0207656_10334602 3300025321 Bacteria 754
273 Ga0207642_10215243 3300025899 Bacteria 1070
274 Ga0207688_10094932 3300025901 Bacteria 1716
275 Ga0207688_10388288 3300025901 Bacteria 864
276 Ga0207680_10001410 3300025903 Bacteria 11373
277 Ga0207680_10028087 3300025903 Bacteria 3143
278 Ga0207647_10000389 3300025904 Bacteria 35906
279 Ga0207647_10036599 3300025904 Bacteria 3118
280 Ga0207647_10040305 3300025904 Bacteria 2943
281 Ga0207647_10041178 3300025904 Bacteria 2906
282 Ga0207647_10099232 3300025904 Bacteria 1730
283 Ga0207647_10136122 3300025904 Bacteria 1441
284 Ga0207647_10238899 3300025904 Bacteria 1044
285 Ga0207647_10314069 3300025904 Bacteria 891
286 Ga0207645_11154264 3300025907 Bacteria 521
287 Ga0207705_10000042 3300025909 Bacteria 182120
288 Ga0207705_10000190 3300025909 Bacteria 62546
289 Ga0207705_10000236 3300025909 Bacteria 54788
290 Ga0207705_10025910 3300025909 Bacteria 4185
291 Ga0207705_10031773 3300025909 Bacteria 3770
292 Ga0207705_10051142 3300025909 Bacteria 2974
293 Ga0207705_10066088 3300025909 Bacteria 2615
294 Ga0207705_10099013 3300025909 Bacteria 2143
295 Ga0207705_10778554 3300025909 Bacteria 743
296 Ga0207705_11085188 3300025909 Bacteria 617
297 Ga0207654_10129120 3300025911 Bacteria 1597
298 Ga0207654_10400388 3300025911 Bacteria 954
299 Ga0207707_10085195 3300025912 Bacteria 2761
300 Ga0207695_10430693 3300025913 Bacteria 1203
301 Ga0207695_10442927 3300025913 Bacteria 1182
302 Ga0207695_10465647 3300025913 Bacteria 1147
303 Ga0207695_10789810 3300025913 Bacteria 829
304 Ga0207660_10000438 3300025917 Bacteria 27496
305 Ga0207660_10000522 3300025917 Bacteria 25663
306 Ga0207660_10102050 3300025917 Bacteria 2144
307 Ga0207660_10752164 3300025917 Unclassified 795
308 Ga0207662_10432312 3300025918 Bacteria 897
309 Ga0207657_10000407 3300025919 Bacteria 45521
310 Ga0207657_10000837 3300025919 Bacteria 32516
311 Ga0207657_10000900 3300025919 Bacteria 31430
312 Ga0207657_10002570 3300025919 Bacteria 19633
313 Ga0207657_10018127 3300025919 Bacteria 6735
314 Ga0207657_10020043 3300025919 Bacteria 6334
315 Ga0207657_10039196 3300025919 Bacteria 4212
316 Ga0207657_10083525 3300025919 Bacteria 2679
317 Ga0207657_10097055 3300025919 Bacteria 2451
318 Ga0207657_10223823 3300025919 Bacteria 1506
319 Ga0207657_10233197 3300025919 Bacteria 1471
320 Ga0207657_10282996 3300025919 Bacteria 1316
321 Ga0207657_11338154 3300025919 Bacteria 540
322 Ga0207649_10083466 3300025920 Bacteria 2074
323 Ga0207649_10258583 3300025920 Bacteria 1257
324 Ga0207649_10450870 3300025920 Bacteria 971
325 Ga0207649_11589476 3300025920 Bacteria 517
326 Ga0207652_10220558 3300025921 Bacteria 1709
327 Ga0207694_10154179 3300025924 Bacteria 1852
328 Ga0207694_10188064 3300025924 Bacteria 1677
329 Ga0207694_10653280 3300025924 Bacteria 886
330 Ga0207650_10056039 3300025925 Bacteria 2928
331 Ga0207650_10297939 3300025925 Bacteria 1316
332 Ga0207659_10011390 3300025926 Bacteria 5616
333 Ga0207659_11303820 3300025926 Bacteria 623
334 Ga0207687_10077386 3300025927 Bacteria 2392
335 Ga0207664_10765907 3300025929 Bacteria 868
336 Ga0207644_10000035 3300025931 Bacteria 131979
337 Ga0207644_10000243 3300025931 Bacteria 37412
338 Ga0207644_10031405 3300025931 Bacteria 3700
339 Ga0207644_10083461 3300025931 Bacteria 2366
340 Ga0207644_11605169 3300025931 Bacteria 545
341 Ga0207690_10017235 3300025932 Bacteria 4407
342 Ga0207690_10026346 3300025932 Bacteria 3660
343 Ga0207690_10076381 3300025932 Bacteria 2326
344 Ga0207690_10079099 3300025932 Bacteria 2290
345 Ga0207690_10187820 3300025932 Bacteria 1561
346 Ga0207690_10432011 3300025932 Bacteria 1055
347 Ga0207690_10890155 3300025932 Bacteria 738
348 Ga0207690_10937505 3300025932 Bacteria 719
349 Ga0207690_10970573 3300025932 Bacteria 706
350 Ga0207690_11056963 3300025932 Bacteria 676
351 Ga0207706_10020396 3300025933 Bacteria 5959
352 Ga0207706_10059624 3300025933 Bacteria 3360
353 Ga0207706_10646928 3300025933 Bacteria 906
354 Ga0207706_11186055 3300025933 Bacteria 635
355 Ga0207706_11736789 3300025933 Bacteria 501
356 Ga0207686_10261038 3300025934 Bacteria 1270
357 Ga0207709_10247551 3300025935 Bacteria 1300
358 Ga0207709_10700947 3300025935 Bacteria 810
359 Ga0207670_10152951 3300025936 Bacteria 1714
360 Ga0207670_11257025 3300025936 Bacteria 627
361 Ga0207669_10003142 3300025937 Bacteria 7123
362 Ga0207669_10038189 3300025937 Bacteria 2762
363 Ga0207704_10087688 3300025938 Bacteria 2033
364 Ga0207691_10023185 3300025940 Bacteria 5845
365 Ga0207691_10130402 3300025940 Bacteria 2221
366 Ga0207691_11340474 3300025940 Bacteria 590
367 Ga0207711_10083245 3300025941 Bacteria 2798
368 Ga0207679_10380275 3300025945 Bacteria 1238
369 Ga0207679_11275308 3300025945 Bacteria 674
370 Ga0207667_10000017 3300025949 Bacteria 390654
371 Ga0207667_10001479 3300025949 Bacteria 29480
372 Ga0207667_10017260 3300025949 Bacteria 8130
373 Ga0207667_10059444 3300025949 Bacteria 4003
374 Ga0207667_10825763 3300025949 Bacteria 922
375 Ga0207667_11330699 3300025949 Unclassified 694
376 Ga0207651_10000201 3300025960 Bacteria 26086
377 Ga0207651_11164489 3300025960 Bacteria 692
378 Ga0207712_10533105 3300025961 Bacteria 1008
379 Ga0207668_10000147 3300025972 Bacteria 48279
380 Ga0207640_10000695 3300025981 Bacteria 19606
381 Ga0207640_10043181 3300025981 Bacteria 2880
382 Ga0207640_10071428 3300025981 Bacteria 2338
383 Ga0207658_10038221 3300025986 Bacteria 3455
384 Ga0207658_10494441 3300025986 Bacteria 1089
385 Ga0207658_11166533 3300025986 Bacteria 704
386 Ga0207677_10000529 3300026023 Bacteria 24143
387 Ga0207677_11712686 3300026023 Bacteria 583
388 Ga0207703_10010627 3300026035 Bacteria 7191
389 Ga0207703_12397499 3300026035 Bacteria 503
390 Ga0207639_10004222 3300026041 Bacteria 9682
391 Ga0207639_10084827 3300026041 Bacteria 2517
392 Ga0207639_10108095 3300026041 Bacteria 2261
393 Ga0207639_10393508 3300026041 Bacteria 1247
394 Ga0207639_11200294 3300026041 Bacteria 712
395 Ga0207639_12005662 3300026041 Bacteria 540
396 Ga0207678_10031342 3300026067 Bacteria 4638
397 Ga0207678_10033366 3300026067 Bacteria 4485
398 Ga0207678_10130693 3300026067 Bacteria 2142
399 Ga0207678_10684054 3300026067 Bacteria 902
400 Ga0207702_10029627 3300026078 Bacteria 4556
401 Ga0207702_10039551 3300026078 Bacteria 3952
402 Ga0207702_10047060 3300026078 Bacteria 3633
403 Ga0207702_10129064 3300026078 Bacteria 2273
404 Ga0207702_11983711 3300026078 Bacteria 573
405 Ga0207641_10000039 3300026088 Bacteria 199453
406 Ga0207641_10006115 3300026088 Bacteria 10188
407 Ga0207648_10002999 3300026089 Bacteria 17838
408 Ga0207676_10012915 3300026095 Bacteria 5998
409 Ga0207676_12503279 3300026095 Bacteria 513
410 Ga0207674_10002528 3300026116 Bacteria 23055
411 Ga0207674_10006868 3300026116 Bacteria 13343
412 Ga0207675_101624108 3300026118 Bacteria 667
413 Ga0207683_10005838 3300026121 Bacteria 10554
414 Ga0207683_10015611 3300026121 Bacteria 6464
415 Ga0207683_11276747 3300026121 Bacteria 680
416 Ga0207698_10013037 3300026142 Bacteria 5469
417 Ga0207698_10037299 3300026142 Bacteria 3578
418 Ga0207698_11258509 3300026142 Bacteria 754
419 Ga0207698_11534602 3300026142 Bacteria 681
420 Ga0207698_11881960 3300026142 Unclassified 613
421 Ga0207698_12398835 3300026142 Unclassified 539
422 Ga0268266_10050799 3300028379 Bacteria 3558
423 Ga0268266_10114108 3300028379 Bacteria 2397
424 Ga0268266_10372165 3300028379 Bacteria 1346
425 Ga0268265_11575593 3300028380 Unclassified 661
426 Ga0268264_10019471 3300028381 Bacteria 5545
427 Ga0268264_10037320 3300028381 Bacteria 4006
428 Ga0268264_10611282 3300028381 Bacteria 1075
429 Ga0307408_100040343 3300031548 Bacteria 3305
430 Ga0307408_100047429 3300031548 Bacteria 3077
431 Ga0307408_100397364 3300031548 Bacteria 1183
432 Ga0307408_100461846 3300031548 Bacteria 1103
433 Ga0307408_101484831 3300031548 Bacteria 640
434 Ga0307405_10100468 3300031731 Bacteria 1939
435 Ga0307405_10139409 3300031731 Bacteria 1688
436 Ga0307405_10309673 3300031731 Bacteria 1201
437 Ga0307405_10385830 3300031731 Bacteria 1092
438 Ga0307405_10396931 3300031731 Bacteria 1078
439 Ga0307405_10821181 3300031731 Bacteria 780
440 Ga0307405_11208982 3300031731 Bacteria 654
441 Ga0307405_11380424 3300031731 Bacteria 615
442 Ga0307405_11394649 3300031731 Bacteria 612
443 Ga0307413_10048332 3300031824 Bacteria 2542
444 Ga0307413_10135903 3300031824 Bacteria 1690
445 Ga0307413_10141851 3300031824 Bacteria 1661
446 Ga0307413_10287008 3300031824 Bacteria 1241
447 Ga0307413_10545541 3300031824 Bacteria 939
448 Ga0307413_10982486 3300031824 Bacteria 722
449 Ga0307413_11874966 3300031824 Bacteria 538
450 Ga0307410_10093803 3300031852 Bacteria 2136
451 Ga0307410_10098476 3300031852 Bacteria 2091
452 Ga0307410_10161486 3300031852 Bacteria 1679
453 Ga0307410_10177137 3300031852 Bacteria 1611
454 Ga0307410_10190679 3300031852 Bacteria 1558
455 Ga0307410_10197305 3300031852 Bacteria 1534
456 Ga0307410_10396561 3300031852 Bacteria 1114
457 Ga0307410_11539038 3300031852 Bacteria 586
458 Ga0307406_10043181 3300031901 Bacteria 2818
459 Ga0307406_10045476 3300031901 Bacteria 2756
460 Ga0307406_10130569 3300031901 Bacteria 1763
461 Ga0307406_10233323 3300031901 Bacteria 1375
462 Ga0307406_10334114 3300031901 Bacteria 1177
463 Ga0307406_10388564 3300031901 Bacteria 1102
464 Ga0307406_10804482 3300031901 Bacteria 793
465 Ga0307407_10028847 3300031903 Bacteria 2972
466 Ga0307407_10056215 3300031903 Bacteria 2277
467 Ga0307407_10409771 3300031903 Bacteria 974
468 Ga0307407_10685584 3300031903 Bacteria 770
469 Ga0307412_10063834 3300031911 Bacteria 2486
470 Ga0307412_10340962 3300031911 Bacteria 1199
471 Ga0307412_10388726 3300031911 Bacteria 1132
472 Ga0307412_10454055 3300031911 Bacteria 1056
473 Ga0307412_11499563 3300031911 Bacteria 613
474 Ga0307412_11567756 3300031911 Bacteria 600
475 Ga0307412_11833187 3300031911 Bacteria 558
476 Ga0307409_100047977 3300031995 Bacteria 3246
477 Ga0307409_100151387 3300031995 Bacteria 2014
478 Ga0307409_100323434 3300031995 Bacteria 1444
479 Ga0307409_100428078 3300031995 Bacteria 1271
480 Ga0307409_100863326 3300031995 Bacteria 916
481 Ga0307409_101478518 3300031995 Bacteria 706
482 Ga0307416_100147272 3300032002 Bacteria 2152
483 Ga0307416_100320559 3300032002 Bacteria 1551
484 Ga0307416_100470966 3300032002 Bacteria 1314
485 Ga0307416_100521463 3300032002 Bacteria 1256
486 Ga0307416_101291646 3300032002 Bacteria 836
487 Ga0307416_102075588 3300032002 Bacteria 670
488 Ga0307416_102630846 3300032002 Bacteria 600
489 Ga0307414_10024487 3300032004 Bacteria 3850
490 Ga0307414_10313180 3300032004 Bacteria 1333
491 Ga0307414_10704404 3300032004 Bacteria 914
492 Ga0307414_10747555 3300032004 Bacteria 888
493 Ga0307414_11103828 3300032004 Bacteria 732
494 Ga0307411_10029635 3300032005 Bacteria 3345
495 Ga0307411_10127685 3300032005 Bacteria 1852
496 Ga0307411_10282885 3300032005 Bacteria 1321
497 Ga0307411_10309089 3300032005 Bacteria 1271
498 Ga0307411_10318070 3300032005 Bacteria 1255
499 Ga0307411_10374777 3300032005 Bacteria 1168
500 Ga0307411_10515049 3300032005 Bacteria 1014
501 Ga0307411_10532184 3300032005 Bacteria 999
502 Ga0307415_100034992 3300032126 Bacteria 3276
503 Ga0307415_100094767 3300032126 Bacteria 2171
504 Ga0307415_100153146 3300032126 Bacteria 1777
505 Ga0307415_100242574 3300032126 Bacteria 1458
506 Ga0307415_100444212 3300032126 Bacteria 1119
507 Ga0307415_101351882 3300032126 Bacteria 676
508 Ga0373941_0242527 3300035115 Unclassified 701
509 Ga0373960_0132326 3300035121 Bacteria 838
510 Ga0373962_0166696 3300035242 Bacteria 729
511 Ga0373931_0007668 3300035691 Bacteria 5092
512 Ga0395899_0000737 3300037312 Bacteria 32666
513 Ga0395899_0006708 3300037312 Bacteria 8921
514 Ga0395899_0090094 3300037312 Bacteria 2224
515 Ga0395899_0117922 3300037312 Bacteria 1903
516 Ga0395899_0302023 3300037312 Bacteria 1083
517 Ga0395899_0324456 3300037312 Bacteria 1036
518 Ga0395900_0000364 3300037418 Bacteria 65068
519 Ga0395900_0103263 3300037418 Bacteria 2928
520 Ga0395900_0116787 3300037418 Bacteria 2738
521 Ga0395900_0222354 3300037418 Bacteria 1902
522 Ga0395900_0237224 3300037418 Bacteria 1831
523 Ga0395900_0312391 3300037418 Bacteria 1554
524 Ga0395900_0337512 3300037418 Bacteria 1483
525 Ga0395900_0424485 3300037418 Bacteria 1290
526 Ga0395900_0604202 3300037418 Bacteria 1037
527 Ga0395900_1542533 3300037418 Unclassified 576
528 Ga0395898_0019963 3300037466 Bacteria 6814
529 Ga0395898_0037743 3300037466 Bacteria 4790
530 Ga0395898_0054496 3300037466 Bacteria 3902
531 Ga0395898_0152477 3300037466 Bacteria 2211
532 Ga0395898_0437046 3300037466 Bacteria 1247
533 Ga0395898_0479076 3300037466 Bacteria 1184
534 Ga0395905_0004090 3300037471 Bacteria 15281
535 Ga0395905_0069318 3300037471 Bacteria 3303
536 Ga0395905_0085211 3300037471 Bacteria 2961
537 Ga0395905_0105843 3300037471 Bacteria 2641
538 Ga0395905_0191865 3300037471 Bacteria 1916
539 Ga0395905_0266828 3300037471 Bacteria 1597
540 Ga0395905_0465051 3300037471 Bacteria 1163
541 Ga0395905_0528357 3300037471 Bacteria 1080
542 Ga0395905_0705636 3300037471 Bacteria 911
543 Ga0395901_0000209 3300038443 Bacteria 73635
544 Ga0395901_0041174 3300038443 Bacteria 4786
545 Ga0395901_0061759 3300038443 Bacteria 3899
546 Ga0395901_0183756 3300038443 Bacteria 2193
547 Ga0395901_0194923 3300038443 Bacteria 2124
548 Ga0395901_0202798 3300038443 Bacteria 2079
549 Ga0395901_0292981 3300038443 Bacteria 1688
550 Ga0395901_0789351 3300038443 Bacteria 939
551 Ga0395901_0812363 3300038443 Unclassified 923
552 Ga0451853_1622396 3300041512 Bacteria 877
553 Ga0451853_2233164 3300041512 Bacteria 795
554 Ga0439445_0056267 3300042004 Bacteria 1069
555 Ga0439448_0000627 3300042005 Bacteria 8335
556 Ga0439455_0006710 3300042012 Bacteria 2402
557 Ga0439455_0019716 3300042012 Bacteria 1592
558 Ga0450923_039052 3300042125 Bacteria 992
559 Ga0439458_0000006 3300042157 Bacteria 32402
560 Ga0439458_0013505 3300042157 Bacteria 1837
561 Ga0466969_0068840 3300044656 Bacteria 1705
562 Ga0466966_0029842 3300044684 Bacteria 3545
563 Ga0466966_0282546 3300044684 Bacteria 998
564 Ga0466961_0003923 3300044693 Bacteria 9306
565 Ga0466961_0398464 3300044693 Bacteria 835
566 Ga0466961_0648078 3300044693 Bacteria 634
567 Ga0466963_0015928 3300044694 Bacteria 4667
568 Ga0466963_0029255 3300044694 Bacteria 3544
569 Ga0466963_0155247 3300044694 Bacteria 1591
570 Ga0466963_0284246 3300044694 Bacteria 1163
571 Ga0466963_0323865 3300044694 Bacteria 1085
572 Ga0466971_0019587 3300044719 Bacteria 3006
573 Ga0466971_0081863 3300044719 Bacteria 1473
574 Ga0466968_0407919 3300044735 Bacteria 667
575 Ga0466968_0577836 3300044735 Bacteria 566
576 Ga0466970_0312759 3300044765 Bacteria 887
577 Ga0466957_0083970 3300044842 Bacteria 1987
578 Ga0466957_0298965 3300044842 Bacteria 1081
579 Ga0466957_1324379 3300044842 Bacteria 523
580 Ga0466959_0102969 3300045049 Bacteria 2043
581 Ga0466959_0164656 3300045049 Bacteria 1557
582 Ga0466959_0811545 3300045049 Bacteria 625
583 Ga0466958_0021712 3300045836 Bacteria 3754
584 Ga0466958_0522665 3300045836 Bacteria 770
585 Ga0466958_1018360 3300045836 Unclassified 540
586 Ga0466967_0063010 3300045976 Bacteria 3293
587 Ga0466967_0147134 3300045976 Bacteria 2198
588 Ga0466967_0284433 3300045976 Bacteria 1587
589 Ga0466967_0331006 3300045976 Bacteria 1471
590 Ga0466967_0453447 3300045976 Bacteria 1254
591 Ga0466967_1040800 3300045976 Bacteria 815
592 Ga0466967_1139225 3300045976 Bacteria 777
593 Ga0466967_1319082 3300045976 Bacteria 719
594 Ga0495606_0230352 3300046507 Bacteria 1039
595 Ga0495620_0061502 3300046515 Bacteria 1562
596 Ga0495620_0159926 3300046515 Bacteria 875
597 Ga0495642_0049369 3300046528 Bacteria 1728
598 Ga0495625_0162784 3300046660 Bacteria 1493
599 Ga0495669_0009712 3300046684 Bacteria 4060
600 Ga0495669_0409371 3300046684 Bacteria 657
601 Ga0496100_0001319 3300048903 Bacteria 12124
602 Ga0496100_0018297 3300048903 Bacteria 4154
603 Ga0496100_1080378 3300048903 Bacteria 632
604 Ga0496101_0000256 3300048904 Bacteria 37912
605 Ga0496102_0006759 3300048905 Bacteria 9793
606 Ga0496102_0468227 3300048905 Bacteria 1181
607 Ga0496103_0113653 3300048906 Bacteria 1721
608 Ga0496104_0022966 3300048907 Bacteria 5733
609 Ga0496104_1449284 3300048907 Bacteria 590
610 Ga0496105_0038015 3300048908 Bacteria 3965
611 Ga0496106_0011259 3300048909 Bacteria 6620
612 Ga0496107_0000623 3300048910 Bacteria 19871
613 Ga0496107_0836365 3300048910 Bacteria 673
614 Ga0496108_0000673 3300048911 Bacteria 26408
615 Ga0496109_1015345 3300048912 Bacteria 767
616 Ga0496111_0000247 3300048914 Bacteria 25998
617 Ga0496111_0597522 3300048914 Bacteria 808
618 Ga0496112_0000369 3300048915 Bacteria 29388
619 Ga0496112_0061660 3300048915 Bacteria 3698
620 Ga0496112_0795083 3300048915 Bacteria 871
621 Ga0496113_0000242 3300048916 Bacteria 25756
622 Ga0496113_1025725 3300048916 Bacteria 649
623 Ga0496114_0358866 3300048917 Bacteria 1289
624 Ga0496114_0525480 3300048917 Bacteria 1046
625 Ga0496115_0002137 3300048918 Bacteria 14132
626 Ga0496115_0903018 3300048918 Bacteria 681
627 Ga0496126_0093822 3300048929 Bacteria 2635
628 Ga0501034_1418953 3300049571 Bacteria 569
629 Ga0501036_0209588 3300049572 Bacteria 1638
630 Ga0501038_0226703 3300049574 Bacteria 1489
631 Ga0501046_0350006 3300049580 Bacteria 1073
632 Ga0501235_161766 3300049669 Bacteria 586
633 Ga0501248_039577 3300049678 Bacteria 572
634 Ga0501253_028165 3300049683 Bacteria 1050
635 Ga0501261_132299 3300049690 Unclassified 504
636 Ga0501268_009695 3300049765 Bacteria 1484
637 Ga0501268_104240 3300049765 Bacteria 611
638 Ga0501268_125088 3300049765 Bacteria 573
639 Ga0501204_051317 3300049850 Bacteria 633
640 Ga0500577_0013766 3300053142 Bacteria 2481
641 Ga0466962_0021183 3300061719 Bacteria 3122
642 Ga0466962_0219004 3300061719 Bacteria 932
643 Ga0530510_0760299 3300061734 Bacteria 739
644 2896431682 2896429255 Bacteria 2557483
645 JGI24741J21665_1009690
646 LJQas_1004057
647 JGI24736J21556_1059420
648 JGI24741J21665_1056114
649 JGI24740J21852_10043130
650 JGI24740J21852_10094440
651 JGI24739J22299_10008673
652 JGI24739J22299_10055781
653 JGI24739J22299_10151468
654 JGI24737J22298_10001243
655 JGI24737J22298_10057625
656 JGI24743J22301_10059234
657 JGI24735J21928_10002241
658 JGI24735J21928_10047889
659 JGI24735J21928_10055269
660 JGI24735J21928_10091729
661 JGI24735J21928_10136456
662 JGI24735J21928_10210420
663 JGI24738J21930_10001440
664 JGI24738J21930_10015042
665 JGI24738J21930_10041125
666 JGI24744J21845_10007524
667 JGI24742J22300_10105622
668 JGI25157J39369_1013249
669 JGI25165J46597_1000040
670 Ga0055542_1001654
671 Ga0055529_1005922
672 Ga0065715_10512583
673 Ga0070658_10000022
674 Ga0070658_10003723
675 Ga0070658_10007308
676 Ga0070658_10030124
677 Ga0070658_10050893
678 Ga0070658_10057701
679 Ga0070658_10491993
680 Ga0070658_11026774
681 Ga0070676_10188562
682 Ga0070683_100157353
683 Ga0070683_100775204
684 Ga0070690_100007013
685 Ga0070690_100846865
686 Ga0070670_100053682
687 Ga0070670_100466547
688 Ga0070677_10521097
689 Ga0070666_10004292
690 Ga0070666_10043239
691 Ga0070680_100000683
692 Ga0070680_100005956
693 Ga0070680_100111365
694 Ga0070682_100022704
695 Ga0068868_100128441
696 Ga0068868_101970044
697 Ga0070660_100000212
698 Ga0070660_100000751
699 Ga0070660_100009089
700 Ga0070660_100036201
701 Ga0070660_100058544
702 Ga0070660_100059159
703 Ga0070660_100087592
704 Ga0070660_100101033
705 Ga0070660_100142921
706 Ga0070660_100204728
707 Ga0070660_101229501
708 Ga0070660_101356752
709 Ga0070689_100191079
710 Ga0070687_100449035
711 Ga0070661_100092611
712 Ga0070661_101214502
713 Ga0070661_101732613
714 Ga0070692_10018011
715 Ga0070692_10405270
716 Ga0070692_10500975
717 Ga0070668_100000009
718 Ga0070668_101749405
719 Ga0070675_100014931
720 Ga0070675_100635906
721 Ga0070675_101268679
722 Ga0070671_100000098
723 Ga0070671_100007591
724 Ga0070671_100037988
725 Ga0070671_100589986
726 Ga0070674_100014374
727 Ga0070674_100058710
728 Ga0070673_100003346
729 Ga0070673_101104519
730 Ga0070673_101230150
731 Ga0070673_101740011
732 Ga0070688_100394290
733 Ga0070659_100075326
734 Ga0070659_100212273
735 Ga0070659_100234456
736 Ga0070659_100371804
737 Ga0070659_101308496
738 Ga0070667_100014991
739 Ga0070667_100721756
740 Ga0070663_100004783
741 Ga0070663_100062771
742 Ga0070663_100771104
743 Ga0070663_101245291
744 Ga0070663_101928583
745 Ga0070678_100033684
746 Ga0070678_100046037
747 Ga0070662_100197093
748 Ga0070662_101887963
749 Ga0070681_10224690
750 Ga0068867_100002136
751 Ga0070679_100211558
752 Ga0070679_101060232
753 Ga0070679_101509512
754 Ga0070684_100021129
755 Ga0068853_100014991
756 Ga0068853_100039431
757 Ga0068853_100142436
758 Ga0068853_100399728
759 Ga0068853_101568583
760 Ga0070672_100011066
761 Ga0070672_100086454
762 Ga0070672_101943151
763 Ga0070686_100147263
764 Ga0070686_100168303
765 Ga0070693_100311889
766 Ga0070693_101347580
767 Ga0070665_100154914
768 Ga0070665_100222949
769 Ga0070665_100556885
770 Ga0068855_100000079
771 Ga0068855_100001164
772 Ga0068855_100074321
773 Ga0068855_100135870
774 Ga0068855_100381789
775 Ga0068855_101106566
776 Ga0068857_100043136
777 Ga0068857_100058302
778 Ga0068854_100003204
779 Ga0068854_100107471
780 Ga0068854_100875848
781 Ga0068856_100013426
782 Ga0068856_100015289
783 Ga0068856_100124219
784 Ga0068856_100169948
785 Ga0068856_100601597
786 Ga0068856_100834864
787 Ga0068856_101022253
788 Ga0068856_101803531
789 Ga0068852_100045398
790 Ga0068852_100104429
791 Ga0068852_100414295
792 Ga0068852_102269602
793 Ga0068859_100025222
794 Ga0068859_100028499
795 Ga0068859_100060239
796 Ga0068859_100282737
797 Ga0068859_101487985
798 Ga0068864_100091289
799 Ga0068866_10009481
800 Ga0068851_10013745
801 Ga0068851_10076113
802 Ga0068851_10170800
803 Ga0068851_10270961
804 Ga0068851_10671319
805 Ga0068863_100000040
806 Ga0068863_100011841
807 Ga0068858_100074689
808 Ga0068858_100147612
809 Ga0068860_100039460
810 Ga0068860_100150631
811 Ga0068860_100246295
812 Ga0068862_100026335
813 Ga0068862_101180886
814 Ga0081539_10023429
815 Ga0097621_100001388
816 Ga0097621_100013189
817 Ga0097621_100955552
818 Ga0068871_100002654
819 Ga0068871_100508967
820 Ga0068865_100001550
821 Ga0097620_100025222
822 Ga0097620_100028499
823 Ga0097620_100060239
824 Ga0097620_100282735
825 Ga0097620_101487880
826 Ga0105240_10195311
827 Ga0105240_10523701
828 Ga0105240_11016101
829 Ga0105240_11479079
830 Ga0105240_11772168
831 Ga0105245_10006481
832 Ga0105247_11284427
833 Ga0105243_10008878
834 Ga0105243_10556538
835 Ga0105241_10407683
836 Ga0105241_10411987
837 Ga0105241_12656254
838 Ga0105242_10468643
839 Ga0105238_10115889
840 Ga0105238_10120121
841 Ga0105238_10212626
842 Ga0105238_10213649
843 Ga0105238_10654371
844 Ga0105238_10771949
845 Ga0105238_11166722
846 Ga0105238_11322918
847 Ga0105249_10001735
848 Ga0105239_10110863
849 Ga0105239_10223798
850 Ga0105239_10544033
851 Ga0105239_10823445
852 Ga0105246_10823511
853 Ga0105246_11427634
854 Ga0157373_10039126
855 Ga0157373_10089696
856 Ga0157373_10185883
857 Ga0157373_10317179
858 Ga0157371_10000558
859 Ga0157371_10038395
860 Ga0157371_10073063
861 Ga0157371_10466437
862 Ga0157371_10729058
863 Ga0157371_11516260
864 Ga0157370_10000117
865 Ga0157370_10097405
866 Ga0157370_10148254
867 Ga0157370_10152799
868 Ga0157370_10834916
869 Ga0157370_11370216
870 Ga0157370_11480549
871 Ga0157369_10007204
872 Ga0157369_10014466
873 Ga0157369_10042284
874 Ga0157369_10224048
875 Ga0157369_10666497
876 Ga0157369_10945017
877 Ga0157369_10981418
878 Ga0157369_11616413
879 Ga0157374_10062500
880 Ga0157374_10332629
881 Ga0157374_10365541
882 Ga0157374_10694771
883 Ga0157374_12771071
884 Ga0157378_10031009
885 Ga0163162_10148849
886 Ga0163162_10787967
887 Ga0163162_11920567
888 Ga0157372_10093707
889 Ga0157372_10346343
890 Ga0157372_10379691
891 Ga0157372_10431458
892 Ga0157372_11220442
893 Ga0157372_12103677
894 Ga0157375_10123420
895 Ga0157375_11586263
896 Ga0157375_11728614
897 Ga0163163_10227938
898 Ga0163163_10956102
899 Ga0157380_12648270
900 Ga0157377_10172911
901 Ga0157379_10100287
902 Ga0157376_10053115
903 Ga0157376_12071827
904 Ga0209026_1003463
905 Ga0209148_1000147
906 Ga0209148_1002428
907 Ga0209233_1000003
908 Ga0209455_1000707
909 Ga0209455_1048315
910 Ga0207697_10063527
911 Ga0207697_10111110
912 Ga0207697_10406936
913 Ga0207656_10006606
914 Ga0207656_10045322
915 Ga0207656_10286700
916 Ga0207656_10334602
917 Ga0207642_10215243
918 Ga0207688_10094932
919 Ga0207688_10388288
920 Ga0207680_10001410
921 Ga0207680_10028087
922 Ga0207647_10000389
923 Ga0207647_10036599
924 Ga0207647_10040305
925 Ga0207647_10041178
926 Ga0207647_10099232
927 Ga0207647_10136122
928 Ga0207647_10238899
929 Ga0207647_10314069
930 Ga0207645_11154264
931 Ga0207705_10000042
932 Ga0207705_10000190
933 Ga0207705_10000236
934 Ga0207705_10025910
935 Ga0207705_10031773
936 Ga0207705_10051142
937 Ga0207705_10066088
938 Ga0207705_10099013
939 Ga0207705_10778554
940 Ga0207705_11085188
941 Ga0207654_10129120
942 Ga0207654_10400388
943 Ga0207707_10085195
944 Ga0207695_10430693
945 Ga0207695_10442927
946 Ga0207695_10465647
947 Ga0207695_10789810
948 Ga0207660_10000438
949 Ga0207660_10000522
950 Ga0207660_10102050
951 Ga0207660_10752164
952 Ga0207662_10432312
953 Ga0207657_10000407
954 Ga0207657_10000837
955 Ga0207657_10000900
956 Ga0207657_10002570
957 Ga0207657_10018127
958 Ga0207657_10020043
959 Ga0207657_10039196
960 Ga0207657_10083525
961 Ga0207657_10097055
962 Ga0207657_10223823
963 Ga0207657_10233197
964 Ga0207657_10282996
965 Ga0207657_11338154
966 Ga0207649_10083466
967 Ga0207649_10258583
968 Ga0207649_10450870
969 Ga0207649_11589476
970 Ga0207652_10220558
971 Ga0207694_10154179
972 Ga0207694_10188064
973 Ga0207694_10653280
974 Ga0207650_10056039
975 Ga0207650_10297939
976 Ga0207659_10011390
977 Ga0207659_11303820
978 Ga0207687_10077386
979 Ga0207664_10765907
980 Ga0207644_10000035
981 Ga0207644_10000243
982 Ga0207644_10031405
983 Ga0207644_10083461
984 Ga0207644_11605169
985 Ga0207690_10017235
986 Ga0207690_10026346
987 Ga0207690_10076381
988 Ga0207690_10079099
989 Ga0207690_10187820
990 Ga0207690_10432011
991 Ga0207690_10890155
992 Ga0207690_10937505
993 Ga0207690_10970573
994 Ga0207690_11056963
995 Ga0207706_10020396
996 Ga0207706_10059624
997 Ga0207706_10646928
998 Ga0207706_11186055
999 Ga0207706_11736789
1000 Ga0207686_10261038
1001 Ga0207709_10247551
1002 Ga0207709_10700947
1003 Ga0207670_10152951
1004 Ga0207670_11257025
1005 Ga0207669_10003142
1006 Ga0207669_10038189
1007 Ga0207704_10087688
1008 Ga0207691_10023185
1009 Ga0207691_10130402
1010 Ga0207691_11340474
1011 Ga0207711_10083245
1012 Ga0207679_10380275
1013 Ga0207679_11275308
1014 Ga0207667_10000017
1015 Ga0207667_10001479
1016 Ga0207667_10017260
1017 Ga0207667_10059444
1018 Ga0207667_10825763
1019 Ga0207667_11330699
1020 Ga0207651_10000201
1021 Ga0207651_11164489
1022 Ga0207712_10533105
1023 Ga0207668_10000147
1024 Ga0207640_10000695
1025 Ga0207640_10043181
1026 Ga0207640_10071428
1027 Ga0207658_10038221
1028 Ga0207658_10494441
1029 Ga0207658_11166533
1030 Ga0207677_10000529
1031 Ga0207677_11712686
1032 Ga0207703_10010627
1033 Ga0207703_12397499
1034 Ga0207639_10004222
1035 Ga0207639_10084827
1036 Ga0207639_10108095
1037 Ga0207639_10393508
1038 Ga0207639_11200294
1039 Ga0207639_12005662
1040 Ga0207678_10031342
1041 Ga0207678_10033366
1042 Ga0207678_10130693
1043 Ga0207678_10684054
1044 Ga0207702_10029627
1045 Ga0207702_10039551
1046 Ga0207702_10047060
1047 Ga0207702_10129064
1048 Ga0207702_11983711
1049 Ga0207641_10000039
1050 Ga0207641_10006115
1051 Ga0207648_10002999
1052 Ga0207676_10012915
1053 Ga0207676_12503279
1054 Ga0207674_10002528
1055 Ga0207674_10006868
1056 Ga0207675_101624108
1057 Ga0207683_10005838
1058 Ga0207683_10015611
1059 Ga0207683_11276747
1060 Ga0207698_10013037
1061 Ga0207698_10037299
1062 Ga0207698_11258509
1063 Ga0207698_11534602
1064 Ga0207698_11881960
1065 Ga0207698_12398835
1066 Ga0268266_10050799
1067 Ga0268266_10114108
1068 Ga0268266_10372165
1069 Ga0268265_11575593
1070 Ga0268264_10019471
1071 Ga0268264_10037320
1072 Ga0268264_10611282
1073 Ga0307408_100040343
1074 Ga0307408_100047429
1075 Ga0307408_100397364
1076 Ga0307408_100461846
1077 Ga0307408_101484831
1078 Ga0307405_10100468
1079 Ga0307405_10139409
1080 Ga0307405_10309673
1081 Ga0307405_10385830
1082 Ga0307405_10396931
1083 Ga0307405_10821181
1084 Ga0307405_11208982
1085 Ga0307405_11380424
1086 Ga0307405_11394649
1087 Ga0307413_10048332
1088 Ga0307413_10135903
1089 Ga0307413_10141851
1090 Ga0307413_10287008
1091 Ga0307413_10545541
1092 Ga0307413_10982486
1093 Ga0307413_11874966
1094 Ga0307410_10093803
1095 Ga0307410_10098476
1096 Ga0307410_10161486
1097 Ga0307410_10177137
1098 Ga0307410_10190679
1099 Ga0307410_10197305
1100 Ga0307410_10396561
1101 Ga0307410_11539038
1102 Ga0307406_10043181
1103 Ga0307406_10045476
1104 Ga0307406_10130569
1105 Ga0307406_10233323
1106 Ga0307406_10334114
1107 Ga0307406_10388564
1108 Ga0307406_10804482
1109 Ga0307407_10028847
1110 Ga0307407_10056215
1111 Ga0307407_10409771
1112 Ga0307407_10685584
1113 Ga0307412_10063834
1114 Ga0307412_10340962
1115 Ga0307412_10388726
1116 Ga0307412_10454055
1117 Ga0307412_11499563
1118 Ga0307412_11567756
1119 Ga0307412_11833187
1120 Ga0307409_100047977
1121 Ga0307409_100151387
1122 Ga0307409_100323434
1123 Ga0307409_100428078
1124 Ga0307409_100863326
1125 Ga0307409_101478518
1126 Ga0307416_100147272
1127 Ga0307416_100320559
1128 Ga0307416_100470966
1129 Ga0307416_100521463
1130 Ga0307416_101291646
1131 Ga0307416_102075588
1132 Ga0307416_102630846
1133 Ga0307414_10024487
1134 Ga0307414_10313180
1135 Ga0307414_10704404
1136 Ga0307414_10747555
1137 Ga0307414_11103828
1138 Ga0307411_10029635
1139 Ga0307411_10127685
1140 Ga0307411_10282885
1141 Ga0307411_10309089
1142 Ga0307411_10318070
1143 Ga0307411_10374777
1144 Ga0307411_10515049
1145 Ga0307411_10532184
1146 Ga0307415_100034992
1147 Ga0307415_100094767
1148 Ga0307415_100153146
1149 Ga0307415_100242574
1150 Ga0307415_100444212
1151 Ga0307415_101351882
1152 Ga0373941_0242527
1153 Ga0373960_0132326
1154 Ga0373962_0166696
1155 Ga0373931_0007668
1156 Ga0395899_0000737
1157 Ga0395899_0006708
1158 Ga0395899_0090094
1159 Ga0395899_0117922
1160 Ga0395899_0302023
1161 Ga0395899_0324456
1162 Ga0395900_0000364
1163 Ga0395900_0103263
1164 Ga0395900_0116787
1165 Ga0395900_0222354
1166 Ga0395900_0237224
1167 Ga0395900_0312391
1168 Ga0395900_0337512
1169 Ga0395900_0424485
1170 Ga0395900_0604202
1171 Ga0395900_1542533
1172 Ga0395898_0019963
1173 Ga0395898_0037743
1174 Ga0395898_0054496
1175 Ga0395898_0152477
1176 Ga0395898_0437046
1177 Ga0395898_0479076
1178 Ga0395905_0004090
1179 Ga0395905_0069318
1180 Ga0395905_0085211
1181 Ga0395905_0105843
1182 Ga0395905_0191865
1183 Ga0395905_0266828
1184 Ga0395905_0465051
1185 Ga0395905_0528357
1186 Ga0395905_0705636
1187 Ga0395901_0000209
1188 Ga0395901_0041174
1189 Ga0395901_0061759
1190 Ga0395901_0183756
1191 Ga0395901_0194923
1192 Ga0395901_0202798
1193 Ga0395901_0292981
1194 Ga0395901_0789351
1195 Ga0395901_0812363
1196 Ga0451853_1622396
1197 Ga0451853_2233164
1198 Ga0439445_0056267
1199 Ga0439448_0000627
1200 Ga0439455_0006710
1201 Ga0439455_0019716
1202 Ga0450923_039052
1203 Ga0439458_0000006
1204 Ga0439458_0013505
1205 Ga0466969_0068840
1206 Ga0466966_0029842
1207 Ga0466966_0282546
1208 Ga0466961_0003923
1209 Ga0466961_0398464
1210 Ga0466961_0648078
1211 Ga0466963_0015928
1212 Ga0466963_0029255
1213 Ga0466963_0155247
1214 Ga0466963_0284246
1215 Ga0466963_0323865
1216 Ga0466971_0019587
1217 Ga0466971_0081863
1218 Ga0466968_0407919
1219 Ga0466968_0577836
1220 Ga0466970_0312759
1221 Ga0466957_0083970
1222 Ga0466957_0298965
1223 Ga0466957_1324379
1224 Ga0466959_0102969
1225 Ga0466959_0164656
1226 Ga0466959_0811545
1227 Ga0466958_0021712
1228 Ga0466958_0522665
1229 Ga0466958_1018360
1230 Ga0466967_0063010
1231 Ga0466967_0147134
1232 Ga0466967_0284433
1233 Ga0466967_0331006
1234 Ga0466967_0453447
1235 Ga0466967_1040800
1236 Ga0466967_1139225
1237 Ga0466967_1319082
1238 Ga0495606_0230352
1239 Ga0495620_0061502
1240 Ga0495620_0159926
1241 Ga0495642_0049369
1242 Ga0495625_0162784
1243 Ga0495669_0009712
1244 Ga0495669_0409371
1245 Ga0496100_0001319
1246 Ga0496100_0018297
1247 Ga0496100_1080378
1248 Ga0496101_0000256
1249 Ga0496102_0006759
1250 Ga0496102_0468227
1251 Ga0496103_0113653
1252 Ga0496104_0022966
1253 Ga0496104_1449284
1254 Ga0496105_0038015
1255 Ga0496106_0011259
1256 Ga0496107_0000623
1257 Ga0496107_0836365
1258 Ga0496108_0000673
1259 Ga0496109_1015345
1260 Ga0496111_0000247
1261 Ga0496111_0597522
1262 Ga0496112_0000369
1263 Ga0496112_0061660
1264 Ga0496112_0795083
1265 Ga0496113_0000242
1266 Ga0496113_1025725
1267 Ga0496114_0358866
1268 Ga0496114_0525480
1269 Ga0496115_0002137
1270 Ga0496115_0903018
1271 Ga0496126_0093822
1272 Ga0501034_1418953
1273 Ga0501036_0209588
1274 Ga0501038_0226703
1275 Ga0501046_0350006
1276 Ga0501235_161766
1277 Ga0501248_039577
1278 Ga0501253_028165
1279 Ga0501261_132299
1280 Ga0501268_009695
1281 Ga0501268_104240
1282 Ga0501268_125088
1283 Ga0501204_051317
1284 Ga0500577_0013766
1285 Ga0466962_0021183
1286 Ga0466962_0219004
1287 Ga0530510_0760299
1288 2896431682

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

1

77

0.8

Map