F472011

General Info

Members Datasets Scaffolds Average Seq Length
644 261 1288 206

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10002959|Ga0065707_100029591
Length 247
Sequence VSRSEPSCAKPRRSSSRIEKRQDRSEHPDEHALRSLGAPVTSKQHFSMLRSYTAADALTIGNAACGTIAVFLCLDYLATGSRRFLWTAFLLLPLALVCDVLDGYVARLDRKRQSRLGADLDSLADVISFGVAPAVLGFTLGLRGGWDMAILTYFVVCGVSRLARFNVTADALADPATGKVKYFEGTPIPTSIVIVAALGVAMLLGRIDDRLWFGAYQLGPALLHPLSLVYAASGSAMISATLRVPKP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
186 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
191 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
192 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
193 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
194 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 1.24
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10002959 3300005295 Bacteria 6480
2 MRS1b_contig_1082550 2162886011 Bacteria 2113
3 JGI25406J46586_10006663 3300003203 Bacteria 5306
4 JGI25406J46586_10009168 3300003203 Bacteria 4439
5 Ga0065704_10013963 3300005289 Bacteria 2558
6 Ga0065712_10011601 3300005290 Unclassified 2527
7 Ga0065712_10072603 3300005290 Bacteria 4686
8 Ga0065712_10098004 3300005290 Bacteria 2133
9 Ga0065712_10129627 3300005290 Bacteria 1565
10 Ga0065712_10167785 3300005290 Unclassified 1262
11 Ga0065712_10211082 3300005290 Bacteria 1072
12 Ga0065715_10094650 3300005293 Bacteria 4278
13 Ga0065715_10157372 3300005293 Bacteria 1658
14 Ga0065715_10278343 3300005293 Bacteria 1093
15 Ga0065715_10384768 3300005293 Bacteria 902
16 Ga0065707_10010638 3300005295 Bacteria 2456
17 Ga0065707_10022567 3300005295 Bacteria 1595
18 Ga0065707_10090337 3300005295 Bacteria 4159
19 Ga0065707_10112983 3300005295 Bacteria 2343
20 Ga0070676_10010187 3300005328 Bacteria 5097
21 Ga0070676_10196857 3300005328 Bacteria 1319
22 Ga0070676_10374003 3300005328 Bacteria 985
23 Ga0070683_100008426 3300005329 Bacteria 8756
24 Ga0070683_100752633 3300005329 Unclassified 934
25 Ga0070690_100015247 3300005330 Bacteria 4581
26 Ga0070690_100124653 3300005330 Bacteria 1733
27 Ga0070690_100167112 3300005330 Bacteria 1511
28 Ga0070670_100007792 3300005331 Bacteria 9112
29 Ga0070670_100011618 3300005331 Bacteria 7528
30 Ga0070670_100014469 3300005331 Bacteria 6774
31 Ga0070670_100114245 3300005331 Bacteria 2328
32 Ga0070670_100168735 3300005331 Bacteria 1898
33 Ga0070670_100683449 3300005331 Bacteria 922
34 Ga0070677_10094972 3300005333 Bacteria 1304
35 Ga0068869_100066008 3300005334 Bacteria 2665
36 Ga0068869_100163607 3300005334 Bacteria 1734
37 Ga0068869_100205185 3300005334 Bacteria 1556
38 Ga0070666_10271447 3300005335 Bacteria 1204
39 Ga0070666_10405450 3300005335 Bacteria 980
40 Ga0070680_100252204 3300005336 Bacteria 1492
41 Ga0070680_100488465 3300005336 Bacteria 1053
42 Ga0070682_100316806 3300005337 Bacteria 1150
43 Ga0070660_100577813 3300005339 Bacteria 939
44 Ga0070689_100025976 3300005340 Bacteria 4404
45 Ga0070689_100045909 3300005340 Bacteria 3365
46 Ga0070691_10004504 3300005341 Bacteria 6323
47 Ga0070687_100018723 3300005343 Bacteria 3209
48 Ga0070687_100020701 3300005343 Bacteria 3080
49 Ga0070687_100149046 3300005343 Bacteria 1371
50 Ga0070661_100195781 3300005344 Bacteria 1543
51 Ga0070692_10076796 3300005345 Bacteria 1791
52 Ga0070668_100041938 3300005347 Bacteria 3506
53 Ga0070668_100393258 3300005347 Bacteria 1182
54 Ga0070668_100807798 3300005347 Bacteria 834
55 Ga0070669_100001684 3300005353 Bacteria 16006
56 Ga0070669_100004688 3300005353 Bacteria 9869
57 Ga0070669_100055858 3300005353 Bacteria 2893
58 Ga0070669_100535961 3300005353 Bacteria 975
59 Ga0070675_100001521 3300005354 Bacteria 17146
60 Ga0070675_100017211 3300005354 Bacteria 5743
61 Ga0070675_100030192 3300005354 Bacteria 4374
62 Ga0070675_100038908 3300005354 Bacteria 3879
63 Ga0070675_100161007 3300005354 Bacteria 1930
64 Ga0070675_100247845 3300005354 Bacteria 1558
65 Ga0070675_100291328 3300005354 Bacteria 1437
66 Ga0070675_100364243 3300005354 Bacteria 1284
67 Ga0070675_100374218 3300005354 Bacteria 1267
68 Ga0070675_100414848 3300005354 Bacteria 1203
69 Ga0070675_100916158 3300005354 Bacteria 804
70 Ga0070671_100233951 3300005355 Unclassified 1559
71 Ga0070671_100332324 3300005355 Bacteria 1295
72 Ga0070674_100021317 3300005356 Bacteria 4156
73 Ga0070674_100095959 3300005356 Bacteria 2150
74 Ga0070674_100149489 3300005356 Bacteria 1761
75 Ga0070674_100187485 3300005356 Unclassified 1589
76 Ga0070674_100234853 3300005356 Bacteria 1433
77 Ga0070674_100793876 3300005356 Bacteria 817
78 Ga0070673_100004481 3300005364 Bacteria 8835
79 Ga0070673_100047448 3300005364 Bacteria 3342
80 Ga0070673_100268614 3300005364 Bacteria 1492
81 Ga0070673_100756503 3300005364 Bacteria 895
82 Ga0070659_100140395 3300005366 Bacteria 1967
83 Ga0070659_100256565 3300005366 Bacteria 1450
84 Ga0070667_100070871 3300005367 Bacteria 2968
85 Ga0070667_100915371 3300005367 Bacteria 817
86 Ga0070713_100091861 3300005436 Bacteria 2612
87 Ga0070710_10487285 3300005437 Bacteria 842
88 Ga0070701_10032914 3300005438 Bacteria 2586
89 Ga0070701_10094080 3300005438 Bacteria 1648
90 Ga0070701_10381991 3300005438 Bacteria 888
91 Ga0070711_100549899 3300005439 Unclassified 958
92 Ga0070711_100650179 3300005439 Unclassified 884
93 Ga0070705_100103130 3300005440 Bacteria 1806
94 Ga0070705_100219161 3300005440 Bacteria 1316
95 Ga0070705_100590452 3300005440 Bacteria 858
96 Ga0070700_100030326 3300005441 Bacteria 3231
97 Ga0070700_100347448 3300005441 Bacteria 1098
98 Ga0070700_100386198 3300005441 Bacteria 1049
99 Ga0070700_100702734 3300005441 Bacteria 804
100 Ga0070694_100007036 3300005444 Bacteria 6844
101 Ga0070694_100027920 3300005444 Bacteria 3668
102 Ga0070694_100178926 3300005444 Bacteria 1567
103 Ga0070694_100286097 3300005444 Bacteria 1258
104 Ga0070694_100765169 3300005444 Bacteria 789
105 Ga0070663_100394579 3300005455 Bacteria 1130
106 Ga0070678_100041802 3300005456 Bacteria 3253
107 Ga0070678_100282697 3300005456 Bacteria 1404
108 Ga0070678_100373335 3300005456 Bacteria 1232
109 Ga0070678_100384030 3300005456 Bacteria 1216
110 Ga0070662_100265515 3300005457 Bacteria 1384
111 Ga0070662_100698230 3300005457 Bacteria 858
112 Ga0070662_100976286 3300005457 Bacteria 725
113 Ga0070681_10025231 3300005458 Bacteria 5979
114 Ga0068867_100002212 3300005459 Bacteria 13648
115 Ga0068867_100074809 3300005459 Bacteria 2540
116 Ga0068867_100249217 3300005459 Bacteria 1443
117 Ga0070685_10149291 3300005466 Bacteria 1480
118 Ga0070706_100511375 3300005467 Bacteria 1117
119 Ga0070707_100053548 3300005468 Bacteria 3869
120 Ga0070707_100386113 3300005468 Bacteria 1360
121 Ga0070698_100132299 3300005471 Bacteria 2449
122 Ga0070698_100578936 3300005471 Bacteria 1062
123 Ga0070699_100012501 3300005518 Bacteria 7325
124 Ga0070699_100024762 3300005518 Bacteria 5174
125 Ga0070699_100037300 3300005518 Bacteria 4205
126 Ga0070684_100062834 3300005535 Bacteria 3254
127 Ga0070684_100472547 3300005535 Bacteria 1160
128 Ga0070697_100485964 3300005536 Bacteria 1079
129 Ga0070672_100066178 3300005543 Bacteria 2861
130 Ga0070672_100139364 3300005543 Bacteria 1999
131 Ga0070672_100233394 3300005543 Bacteria 1546
132 Ga0070672_100734760 3300005543 Bacteria 866
133 Ga0070686_100104329 3300005544 Bacteria 1920
134 Ga0070686_100170851 3300005544 Bacteria 1537
135 Ga0070686_100225360 3300005544 Bacteria 1357
136 Ga0070686_100288195 3300005544 Bacteria 1213
137 Ga0070695_100000063 3300005545 Bacteria 42774
138 Ga0070695_100004510 3300005545 Bacteria 8176
139 Ga0070695_100038416 3300005545 Bacteria 3021
140 Ga0070695_100105210 3300005545 Bacteria 1907
141 Ga0070695_100361033 3300005545 Bacteria 1091
142 Ga0070696_100000064 3300005546 Bacteria 50839
143 Ga0070696_100019223 3300005546 Bacteria 4625
144 Ga0070696_100026215 3300005546 Bacteria 3965
145 Ga0070696_100323738 3300005546 Bacteria 1187
146 Ga0070696_100364635 3300005546 Bacteria 1122
147 Ga0070693_100088516 3300005547 Bacteria 1862
148 Ga0070665_100141240 3300005548 Bacteria 2411
149 Ga0070665_100418538 3300005548 Bacteria 1348
150 Ga0070704_100000747 3300005549 Bacteria 15973
151 Ga0070704_100010507 3300005549 Bacteria 5635
152 Ga0070704_100059473 3300005549 Bacteria 2727
153 Ga0070704_100472465 3300005549 Bacteria 1084
154 Ga0070704_100540929 3300005549 Bacteria 1016
155 Ga0070664_100223412 3300005564 Bacteria 1686
156 Ga0068857_100014576 3300005577 Bacteria 6858
157 Ga0068854_100019496 3300005578 Bacteria 4573
158 Ga0068854_100029707 3300005578 Bacteria 3786
159 Ga0070702_100000648 3300005615 Bacteria 12936
160 Ga0070702_100021569 3300005615 Bacteria 3391
161 Ga0070702_100080649 3300005615 Bacteria 1948
162 Ga0070702_100133193 3300005615 Bacteria 1573
163 Ga0068859_100025918 3300005617 Bacteria 5882
164 Ga0068859_100041167 3300005617 Bacteria 4641
165 Ga0068859_100233353 3300005617 Bacteria 1928
166 Ga0068859_100492675 3300005617 Bacteria 1321
167 Ga0068859_101177016 3300005617 Bacteria 844
168 Ga0068864_100112811 3300005618 Bacteria 2423
169 Ga0068864_100193413 3300005618 Bacteria 1866
170 Ga0068864_100212592 3300005618 Bacteria 1782
171 Ga0068864_100332765 3300005618 Bacteria 1429
172 Ga0068864_100440384 3300005618 Bacteria 1245
173 Ga0068861_100004217 3300005719 Bacteria 9643
174 Ga0068861_100008586 3300005719 Bacteria 7028
175 Ga0068861_100873788 3300005719 Bacteria 849
176 Ga0068870_10038486 3300005840 Bacteria 2470
177 Ga0068863_100071065 3300005841 Bacteria 3293
178 Ga0068863_100131793 3300005841 Bacteria 2387
179 Ga0068858_100293726 3300005842 Bacteria 1549
180 Ga0068858_100316526 3300005842 Bacteria 1491
181 Ga0068860_100080076 3300005843 Bacteria 3106
182 Ga0068860_100742825 3300005843 Bacteria 992
183 Ga0068862_100012093 3300005844 Bacteria 7133
184 Ga0068862_100039605 3300005844 Bacteria 4003
185 Ga0068862_100115810 3300005844 Bacteria 2357
186 Ga0068862_100353584 3300005844 Bacteria 1364
187 Ga0068862_100354085 3300005844 Bacteria 1363
188 Ga0081455_10140432 3300005937 Bacteria 1877
189 Ga0081539_10000291 3300005985 Bacteria 113769
190 Ga0081539_10000295 3300005985 Bacteria 112740
191 Ga0081539_10009784 3300005985 Bacteria 7930
192 Ga0075365_10010220 3300006038 Bacteria 5453
193 Ga0075365_10158774 3300006038 Bacteria 1575
194 Ga0075432_10077729 3300006058 Bacteria 1200
195 Ga0075367_10054163 3300006178 Bacteria 2378
196 Ga0075366_10048258 3300006195 Bacteria 2524
197 Ga0075366_10053711 3300006195 Bacteria 2394
198 Ga0075366_10467549 3300006195 Bacteria 779
199 Ga0097621_100135130 3300006237 Bacteria 2103
200 Ga0097621_100334117 3300006237 Bacteria 1345
201 Ga0097621_100687250 3300006237 Bacteria 941
202 Ga0068871_100134981 3300006358 Bacteria 2095
203 Ga0068871_100461760 3300006358 Unclassified 1140
204 Ga0068871_101071246 3300006358 Bacteria 753
205 Ga0075428_100000019 3300006844 Bacteria 137803
206 Ga0075428_100248310 3300006844 Bacteria 1918
207 Ga0075428_100277775 3300006844 Bacteria 1802
208 Ga0075428_100469751 3300006844 Unclassified 1347
209 Ga0075428_100935109 3300006844 Bacteria 919
210 Ga0075430_100006421 3300006846 Bacteria 9915
211 Ga0075431_100077725 3300006847 Bacteria 3425
212 Ga0075431_100250825 3300006847 Bacteria 1798
213 Ga0075431_100405131 3300006847 Bacteria 1365
214 Ga0075431_100414846 3300006847 Unclassified 1346
215 Ga0075433_10028455 3300006852 Bacteria 4751
216 Ga0075433_10053378 3300006852 Bacteria 3524
217 Ga0075433_10069078 3300006852 Bacteria 3102
218 Ga0075433_10492004 3300006852 Bacteria 1080
219 Ga0075433_10592506 3300006852 Bacteria 973
220 Ga0075434_100003106 3300006871 Bacteria 14792
221 Ga0075434_100005957 3300006871 Bacteria 11157
222 Ga0075434_100038006 3300006871 Bacteria 4768
223 Ga0075434_100040876 3300006871 Bacteria 4592
224 Ga0075434_100050303 3300006871 Bacteria 4139
225 Ga0075434_100238872 3300006871 Bacteria 1837
226 Ga0075434_100362571 3300006871 Unclassified 1470
227 Ga0075434_100728653 3300006871 Bacteria 1009
228 Ga0075434_100981434 3300006871 Bacteria 859
229 Ga0075429_100038132 3300006880 Bacteria 4183
230 Ga0075429_100066844 3300006880 Bacteria 3129
231 Ga0075429_100072232 3300006880 Bacteria 3005
232 Ga0075429_100100637 3300006880 Bacteria 2523
233 Ga0068865_100167776 3300006881 Bacteria 1680
234 Ga0068865_100237003 3300006881 Bacteria 1434
235 Ga0068865_100585045 3300006881 Bacteria 941
236 Ga0075436_100000626 3300006914 Bacteria 23230
237 Ga0097620_100025919 3300006931 Bacteria 5882
238 Ga0097620_100041166 3300006931 Bacteria 4641
239 Ga0097620_100233357 3300006931 Bacteria 1928
240 Ga0097620_100492695 3300006931 Bacteria 1321
241 Ga0097620_101177211 3300006931 Bacteria 844
242 Ga0075435_100000054 3300007076 Bacteria 58537
243 Ga0075435_100001354 3300007076 Bacteria 15787
244 Ga0075435_100004693 3300007076 Bacteria 9423
245 Ga0075435_100007192 3300007076 Bacteria 7916
246 Ga0075435_100015036 3300007076 Bacteria 5808
247 Ga0075435_100172013 3300007076 Bacteria 1828
248 Ga0075435_100331863 3300007076 Bacteria 1303
249 Ga0111539_10000002 3300009094 Bacteria 983359
250 Ga0111539_10000510 3300009094 Bacteria 49338
251 Ga0111539_10003612 3300009094 Bacteria 20380
252 Ga0111539_10009314 3300009094 Bacteria 12401
253 Ga0111539_10027205 3300009094 Bacteria 6985
254 Ga0111539_10152624 3300009094 Bacteria 2703
255 Ga0111539_10197751 3300009094 Bacteria 2345
256 Ga0111539_10225578 3300009094 Bacteria 2182
257 Ga0111539_10314928 3300009094 Bacteria 1821
258 Ga0111539_10699754 3300009094 Bacteria 1180
259 Ga0111539_10972584 3300009094 Bacteria 987
260 Ga0111539_11336515 3300009094 Bacteria 832
261 Ga0111539_11820964 3300009094 Unclassified 706
262 Ga0105245_10074914 3300009098 Bacteria 3080
263 Ga0105245_10121209 3300009098 Unclassified 2444
264 Ga0105245_10210341 3300009098 Bacteria 1872
265 Ga0114129_10006505 3300009147 Bacteria 16577
266 Ga0114129_10037040 3300009147 Bacteria 6887
267 Ga0114129_10051884 3300009147 Bacteria 5757
268 Ga0114129_10112947 3300009147 Bacteria 3746
269 Ga0114129_10340832 3300009147 Bacteria 1988
270 Ga0114129_10690083 3300009147 Bacteria 1313
271 Ga0114129_10769114 3300009147 Unclassified 1231
272 Ga0114129_10803845 3300009147 Bacteria 1199
273 Ga0105243_10010407 3300009148 Bacteria 7063
274 Ga0105243_10012662 3300009148 Bacteria 6372
275 Ga0105243_10013743 3300009148 Bacteria 6125
276 Ga0105243_10085235 3300009148 Bacteria 2589
277 Ga0105243_10433213 3300009148 Bacteria 1229
278 Ga0105243_10592939 3300009148 Bacteria 1066
279 Ga0105241_10179597 3300009174 Bacteria 1755
280 Ga0105241_10255017 3300009174 Bacteria 1489
281 Ga0105242_10054946 3300009176 Bacteria 3257
282 Ga0105242_10172769 3300009176 Bacteria 1900
283 Ga0105242_10307773 3300009176 Bacteria 1449
284 Ga0105242_10384617 3300009176 Bacteria 1305
285 Ga0105242_10963151 3300009176 Bacteria 858
286 Ga0105248_10055014 3300009177 Bacteria 4463
287 Ga0105248_10186942 3300009177 Bacteria 2334
288 Ga0105248_10320860 3300009177 Bacteria 1745
289 Ga0105248_10637178 3300009177 Bacteria 1203
290 Ga0105248_11081841 3300009177 Bacteria 906
291 Ga0105238_10410436 3300009551 Bacteria 1348
292 Ga0105249_10002200 3300009553 Bacteria 16899
293 Ga0105249_10037925 3300009553 Bacteria 4374
294 Ga0105249_10079759 3300009553 Bacteria 3039
295 Ga0105249_10828229 3300009553 Bacteria 990
296 Ga0105249_11115113 3300009553 Bacteria 859
297 Ga0105246_10398953 3300011119 Bacteria 1142
298 Ga0157374_10111305 3300013296 Bacteria 2634
299 Ga0157374_10205609 3300013296 Unclassified 1929
300 Ga0157374_11179178 3300013296 Bacteria 787
301 Ga0157378_10020220 3300013297 Bacteria 5856
302 Ga0163162_11196273 3300013306 Bacteria 862
303 Ga0157375_10093987 3300013308 Bacteria 3066
304 Ga0157375_10370924 3300013308 Bacteria 1597
305 Ga0157375_10466568 3300013308 Bacteria 1428
306 Ga0163163_10189414 3300014325 Bacteria 2106
307 Ga0163163_10310447 3300014325 Bacteria 1630
308 Ga0163163_10505359 3300014325 Bacteria 1271
309 Ga0163163_10828463 3300014325 Unclassified 989
310 Ga0157380_10016152 3300014326 Bacteria 5500
311 Ga0157380_10056992 3300014326 Bacteria 3110
312 Ga0157380_10069775 3300014326 Bacteria 2837
313 Ga0157380_10074966 3300014326 Bacteria 2749
314 Ga0157380_10104274 3300014326 Bacteria 2368
315 Ga0157380_10232659 3300014326 Bacteria 1656
316 Ga0157380_10392562 3300014326 Eukaryota 1313
317 Ga0157380_10494484 3300014326 Bacteria 1186
318 Ga0157380_11297712 3300014326 Bacteria 775
319 Ga0157377_10281711 3300014745 Bacteria 1090
320 Ga0157377_10383480 3300014745 Bacteria 952
321 Ga0157379_10137032 3300014968 Bacteria 2205
322 Ga0157376_10049712 3300014969 Unclassified 3474
323 Ga0163161_10857540 3300017792 Archaea 767
324 Ga0207697_10002359 3300025315 Bacteria 9836
325 Ga0207697_10186397 3300025315 Bacteria 910
326 Ga0207653_10005427 3300025885 Bacteria 3988
327 Ga0207688_10013727 3300025901 Bacteria 4403
328 Ga0207688_10293055 3300025901 Unclassified 994
329 Ga0207647_10142021 3300025904 Bacteria 1407
330 Ga0207647_10416292 3300025904 Bacteria 756
331 Ga0207645_10001981 3300025907 Bacteria 16452
332 Ga0207645_10027628 3300025907 Bacteria 3662
333 Ga0207645_10032484 3300025907 Bacteria 3354
334 Ga0207643_10013931 3300025908 Bacteria 4363
335 Ga0207705_10202639 3300025909 Bacteria 1504
336 Ga0207705_10266508 3300025909 Bacteria 1309
337 Ga0207684_10640336 3300025910 Bacteria 906
338 Ga0207663_10570266 3300025916 Unclassified 887
339 Ga0207662_10025684 3300025918 Bacteria 3393
340 Ga0207662_10275256 3300025918 Bacteria 1112
341 Ga0207649_10754368 3300025920 Bacteria 757
342 Ga0207652_10905075 3300025921 Bacteria 779
343 Ga0207646_10038770 3300025922 Bacteria 4289
344 Ga0207646_10434485 3300025922 Bacteria 1185
345 Ga0207681_10001889 3300025923 Bacteria 13405
346 Ga0207681_10022029 3300025923 Bacteria 4059
347 Ga0207681_10608355 3300025923 Bacteria 903
348 Ga0207650_10004335 3300025925 Bacteria 9692
349 Ga0207650_10029479 3300025925 Bacteria 3945
350 Ga0207650_10303008 3300025925 Bacteria 1305
351 Ga0207659_10000726 3300025926 Bacteria 19497
352 Ga0207659_10047613 3300025926 Bacteria 3033
353 Ga0207659_10264484 3300025926 Bacteria 1401
354 Ga0207659_10296250 3300025926 Unclassified 1327
355 Ga0207659_10359502 3300025926 Bacteria 1210
356 Ga0207659_10504574 3300025926 Unclassified 1024
357 Ga0207687_10023825 3300025927 Bacteria 4083
358 Ga0207687_10218755 3300025927 Unclassified 1498
359 Ga0207687_10238178 3300025927 Bacteria 1441
360 Ga0207700_10082073 3300025928 Unclassified 2520
361 Ga0207644_10067522 3300025931 Bacteria 2606
362 Ga0207644_10087099 3300025931 Bacteria 2320
363 Ga0207644_10148944 3300025931 Bacteria 1809
364 Ga0207644_10185545 3300025931 Bacteria 1633
365 Ga0207644_10466800 3300025931 Bacteria 1038
366 Ga0207706_10293539 3300025933 Bacteria 1417
367 Ga0207706_10314046 3300025933 Bacteria 1364
368 Ga0207706_10615625 3300025933 Bacteria 932
369 Ga0207706_10850496 3300025933 Bacteria 773
370 Ga0207686_10132065 3300025934 Bacteria 1714
371 Ga0207709_10009055 3300025935 Bacteria 5489
372 Ga0207709_10015915 3300025935 Bacteria 4175
373 Ga0207709_10030716 3300025935 Bacteria 3128
374 Ga0207709_10038260 3300025935 Bacteria 2855
375 Ga0207709_10045348 3300025935 Bacteria 2662
376 Ga0207709_10152479 3300025935 Bacteria 1602
377 Ga0207709_10389518 3300025935 Bacteria 1062
378 Ga0207670_10033385 3300025936 Bacteria 3316
379 Ga0207670_10049437 3300025936 Bacteria 2813
380 Ga0207669_10094418 3300025937 Bacteria 1957
381 Ga0207704_10030521 3300025938 Bacteria 3022
382 Ga0207704_10131528 3300025938 Bacteria 1734
383 Ga0207691_10009469 3300025940 Bacteria 9354
384 Ga0207691_10041053 3300025940 Bacteria 4274
385 Ga0207691_10153939 3300025940 Bacteria 2020
386 Ga0207691_10586848 3300025940 Bacteria 944
387 Ga0207711_10010245 3300025941 Bacteria 7783
388 Ga0207711_10013662 3300025941 Bacteria 6742
389 Ga0207711_10428958 3300025941 Bacteria 1230
390 Ga0207689_10061221 3300025942 Bacteria 3095
391 Ga0207689_10089237 3300025942 Bacteria 2532
392 Ga0207689_10147907 3300025942 Bacteria 1935
393 Ga0207689_10184870 3300025942 Bacteria 1719
394 Ga0207689_10223865 3300025942 Bacteria 1555
395 Ga0207661_10018738 3300025944 Bacteria 5148
396 Ga0207679_10100184 3300025945 Bacteria 2264
397 Ga0207679_10179272 3300025945 Bacteria 1751
398 Ga0207679_10935839 3300025945 Bacteria 793
399 Ga0207651_10094131 3300025960 Bacteria 2202
400 Ga0207651_10268267 3300025960 Unclassified 1405
401 Ga0207712_10173614 3300025961 Bacteria 1687
402 Ga0207712_10396654 3300025961 Bacteria 1159
403 Ga0207668_10040916 3300025972 Bacteria 3130
404 Ga0207640_10023131 3300025981 Bacteria 3731
405 Ga0207677_10242741 3300026023 Bacteria 1458
406 Ga0207703_10045779 3300026035 Bacteria 3520
407 Ga0207703_10255294 3300026035 Bacteria 1582
408 Ga0207703_10780690 3300026035 Bacteria 911
409 Ga0207639_10218253 3300026041 Bacteria 1645
410 Ga0207639_10753180 3300026041 Bacteria 906
411 Ga0207678_10295817 3300026067 Bacteria 1391
412 Ga0207708_10001924 3300026075 Bacteria 15347
413 Ga0207708_10015556 3300026075 Bacteria 5706
414 Ga0207708_10155381 3300026075 Bacteria 1804
415 Ga0207708_10281199 3300026075 Bacteria 1348
416 Ga0207641_10162699 3300026088 Bacteria 2030
417 Ga0207648_10000815 3300026089 Bacteria 35275
418 Ga0207648_10003630 3300026089 Bacteria 16136
419 Ga0207648_10009192 3300026089 Bacteria 9493
420 Ga0207648_10056781 3300026089 Bacteria 3416
421 Ga0207676_10125355 3300026095 Bacteria 2174
422 Ga0207676_10131837 3300026095 Bacteria 2126
423 Ga0207676_10220949 3300026095 Bacteria 1687
424 Ga0207676_10657526 3300026095 Bacteria 1012
425 Ga0207674_10016945 3300026116 Bacteria 7957
426 Ga0207674_10020897 3300026116 Bacteria 7064
427 Ga0207674_10026616 3300026116 Bacteria 6136
428 Ga0207675_100000622 3300026118 Bacteria 34726
429 Ga0207675_100006105 3300026118 Bacteria 11461
430 Ga0207675_100006298 3300026118 Bacteria 11262
431 Ga0207675_100049476 3300026118 Bacteria 3923
432 Ga0207675_100243439 3300026118 Bacteria 1738
433 Ga0207675_100647154 3300026118 Bacteria 1063
434 Ga0207675_100774421 3300026118 Bacteria 972
435 Ga0207683_10201880 3300026121 Bacteria 1808
436 Ga0207683_10310991 3300026121 Bacteria 1442
437 Ga0207683_10363984 3300026121 Bacteria 1328
438 Ga0207683_10869604 3300026121 Bacteria 837
439 Ga0207698_10760714 3300026142 Bacteria 968
440 Ga0209974_10063817 3300027876 Bacteria 1249
441 Ga0207428_10000004 3300027907 Bacteria 727800
442 Ga0207428_10000654 3300027907 Bacteria 40562
443 Ga0207428_10000986 3300027907 Bacteria 31515
444 Ga0207428_10014458 3300027907 Bacteria 6857
445 Ga0207428_10030395 3300027907 Bacteria 4465
446 Ga0207428_10659047 3300027907 Bacteria 751
447 Ga0268266_10454416 3300028379 Bacteria 1218
448 Ga0268265_10001186 3300028380 Bacteria 22751
449 Ga0268265_10206242 3300028380 Bacteria 1709
450 Ga0268265_10271937 3300028380 Eukaryota 1512
451 Ga0268265_10754989 3300028380 Bacteria 944
452 Ga0268265_10774741 3300028380 Bacteria 933
453 Ga0268264_10002343 3300028381 Bacteria 16749
454 Ga0307408_100200398 3300031548 Unclassified 1615
455 Ga0307408_100253811 3300031548 Bacteria 1452
456 Ga0307410_10462510 3300031852 Bacteria 1037
457 Ga0307410_10712566 3300031852 Bacteria 847
458 Ga0307407_10318166 3300031903 Bacteria 1091
459 Ga0307412_10516651 3300031911 Bacteria 997
460 Ga0307409_100141686 3300031995 Bacteria 2073
461 Ga0307409_100278237 3300031995 Bacteria 1545
462 Ga0307409_100295053 3300031995 Bacteria 1505
463 Ga0307409_101316265 3300031995 Bacteria 748
464 Ga0307416_100107229 3300032002 Bacteria 2451
465 Ga0307416_100201662 3300032002 Bacteria 1888
466 Ga0307416_100252069 3300032002 Bacteria 1719
467 Ga0307411_10023224 3300032005 Bacteria 3669
468 Ga0307411_10749047 3300032005 Bacteria 856
469 Ga0307415_100287114 3300032126 Unclassified 1356
470 Ga0373930_0006611 3300034816 Bacteria 1968
471 Ga0373930_0041955 3300034816 Bacteria 978
472 Ga0373950_0001596 3300034818 Bacteria 2984
473 Ga0373958_0011630 3300034819 Bacteria 1491
474 Ga0373959_0006524 3300034820 Bacteria 1939
475 Ga0373938_0006063 3300034957 Bacteria 2075
476 Ga0373928_0002037 3300035084 Bacteria 3936
477 Ga0373929_0001073 3300035085 Bacteria 5311
478 Ga0373940_0000879 3300035088 Bacteria 5055
479 Ga0373949_0013822 3300035090 Bacteria 1793
480 Ga0373951_0039010 3300035091 Bacteria 1140
481 Ga0373952_0046363 3300035092 Bacteria 1021
482 Ga0373932_0013910 3300035112 Bacteria 2012
483 Ga0373939_0007543 3300035114 Bacteria 2643
484 Ga0373939_0027951 3300035114 Bacteria 1602
485 Ga0373941_0019317 3300035115 Bacteria 1895
486 Ga0373960_0000194 3300035121 Bacteria 11017
487 Ga0373942_0000063 3300035207 Bacteria 22409
488 Ga0373961_0004973 3300035241 Bacteria 3194
489 Ga0373961_0012394 3300035241 Bacteria 2134
490 Ga0373961_0031244 3300035241 Bacteria 1486
491 Ga0373962_0002153 3300035242 Bacteria 4699
492 Ga0373931_0054031 3300035691 Bacteria 2145
493 Ga0439439_0074950 3300041406 Bacteria 909
494 Ga0439447_073973 3300041407 Bacteria 790
495 Ga0451793_1554342 3300041452 Bacteria 1527
496 Ga0451802_0704419 3300041460 Bacteria 866
497 Ga0439431_0028125 3300041997 Bacteria 1384
498 Ga0439445_0026891 3300042004 Bacteria 1475
499 Ga0439457_034467 3300042014 Bacteria 1125
500 Ga0450920_065162 3300042122 Bacteria 738
501 Ga0450923_112800 3300042125 Bacteria 636
502 Ga0450894_001487 3300042131 Bacteria 3348
503 Ga0450896_006486 3300042133 Bacteria 1606
504 Ga0450896_009992 3300042133 Bacteria 1328
505 Ga0450896_021476 3300042133 Bacteria 949
506 Ga0450898_022601 3300042134 Bacteria 1114
507 Ga0439446_0055921 3300042156 Bacteria 1185
508 Ga0439435_0069589 3300042436 Bacteria 1040
509 Ga0439435_0130873 3300042436 Unclassified 793
510 Ga0439460_0107546 3300042461 Bacteria 902
511 Ga0450918_021623 3300042531 Bacteria 1124
512 Ga0451577_0045883 3300042876 Bacteria 3911
513 Ga0451577_0882272 3300042876 Unclassified 806
514 Ga0466960_0155346 3300044901 Bacteria 1225
515 Ga0451576_0107333 3300045051 Bacteria 2905
516 Ga0451576_0531714 3300045051 Bacteria 1235
517 Ga0451576_1040784 3300045051 Bacteria 858
518 Ga0495663_0119766 3300046525 Bacteria 880
519 Ga0495642_0011217 3300046528 Bacteria 3437
520 Ga0495598_0060996 3300046537 Bacteria 1163
521 Ga0495598_0145458 3300046537 Bacteria 823
522 Ga0495621_0012414 3300046539 Bacteria 2657
523 Ga0495621_0280370 3300046539 Bacteria 686
524 Ga0495659_0028020 3300046664 Bacteria 1947
525 Ga0495659_0040832 3300046664 Bacteria 1655
526 Ga0495669_0262054 3300046684 Bacteria 830
527 Ga0495589_0033711 3300046794 Unclassified 2571
528 Ga0495636_0016970 3300047318 Bacteria 2911
529 Ga0495636_0031167 3300047318 Bacteria 2184
530 Ga0495636_0166819 3300047318 Bacteria 994
531 Ga0495636_0275395 3300047318 Bacteria 783
532 Ga0495677_0057570 3300047445 Bacteria 1437
533 Ga0495677_0077191 3300047445 Bacteria 1246
534 Ga0495615_0043751 3300048090 Bacteria 1128
535 Ga0495615_0076381 3300048090 Bacteria 912
536 Ga0496102_0830596 3300048905 Bacteria 846
537 Ga0496104_0478986 3300048907 Bacteria 1156
538 Ga0496106_0334728 3300048909 Bacteria 1215
539 Ga0496109_0161444 3300048912 Bacteria 2100
540 Ga0496112_0170998 3300048915 Bacteria 2138
541 Ga0496114_0438443 3300048917 Unclassified 1157
542 Ga0496124_0008980 3300048927 Bacteria 10344
543 Ga0501032_0195968 3300049569 Bacteria 1319
544 Ga0501036_0206375 3300049572 Bacteria 1652
545 Ga0501036_0243137 3300049572 Bacteria 1509
546 Ga0501036_0395328 3300049572 Bacteria 1153
547 Ga0501039_0111834 3300049575 Bacteria 2135
548 Ga0501039_0115518 3300049575 Bacteria 2101
549 Ga0501040_0114312 3300049576 Bacteria 1889
550 Ga0501040_0209406 3300049576 Bacteria 1386
551 Ga0501040_0327000 3300049576 Bacteria 1097
552 Ga0501041_0025612 3300049577 Bacteria 3545
553 Ga0501041_0280874 3300049577 Bacteria 1048
554 Ga0501042_0016151 3300049578 Bacteria 5121
555 Ga0501042_0612968 3300049578 Bacteria 791
556 Ga0501046_0051651 3300049580 Bacteria 3243
557 Ga0501048_0046835 3300049582 Bacteria 3087
558 Ga0501048_0082871 3300049582 Bacteria 2262
559 Ga0501067_0049240 3300049583 Bacteria 2335
560 Ga0501070_0495269 3300049586 Bacteria 982
561 Ga0501071_0136845 3300049587 Bacteria 1823
562 Ga0501071_0175777 3300049587 Bacteria 1604
563 Ga0501071_0406928 3300049587 Bacteria 1039
564 Ga0501072_0026436 3300049588 Bacteria 4525
565 Ga0501074_0023969 3300049590 Bacteria 4435
566 Ga0501074_0179014 3300049590 Bacteria 1513
567 Ga0501075_0094277 3300049591 Bacteria 2272
568 Ga0501075_0198300 3300049591 Bacteria 1531
569 Ga0501075_0318894 3300049591 Bacteria 1184
570 Ga0501076_0252883 3300049592 Bacteria 1442
571 Ga0501077_0286270 3300049593 Bacteria 1049
572 Ga0501257_062409 3300049686 Bacteria 943
573 Ga0501079_0031424 3300049741 Bacteria 4081
574 Ga0501080_0025432 3300049742 Bacteria 5495
575 Ga0501080_0158170 3300049742 Bacteria 2093
576 Ga0501081_0236731 3300049743 Bacteria 1331
577 Ga0501081_0736740 3300049743 Bacteria 740
578 Ga0501035_0153413 3300049822 Bacteria 1998
579 Ga0501045_0047831 3300049824 Bacteria 3116
580 nmdc:mga0yw44_70386_c1 3300050492 Bacteria 2169
581 nmdc:mga0k408_43785_c1 3300050493 Bacteria 2581
582 nmdc:mga06z11_192614_c1 3300050494 Bacteria 1181
583 nmdc:mga06z11_333829_c1 3300050494 Bacteria 906
584 nmdc:mga05p37_10105_c1 3300050507 Bacteria 11201
585 nmdc:mga05p37_234264_c1 3300050507 Bacteria 2211
586 nmdc:mga05p37_312496_c1 3300050507 Bacteria 1862
587 nmdc:mga05p37_36551_c1 3300050507 Bacteria 6025
588 nmdc:mga05p37_3678_c1 3300050507 Bacteria 17931
589 nmdc:mga05p37_50594_c1 3300050507 Bacteria 5110
590 nmdc:mga09592_179604_c1 3300050508 Bacteria 1831
591 nmdc:mga09592_220803_c1 3300050508 Bacteria 1642
592 nmdc:mga09592_587495_c1 3300050508 Bacteria 955
593 nmdc:mga09592_68663_c1 3300050508 Bacteria 3006
594 nmdc:mga09592_703265_c1 3300050508 Bacteria 860
595 nmdc:mga0qj67_13422_c1 3300050509 Bacteria 6180
596 nmdc:mga0qj67_136996_c1 3300050509 Bacteria 1983
597 nmdc:mga0qj67_14287_c1 3300050509 Bacteria 6000
598 nmdc:mga0qj67_219016_c1 3300050509 Bacteria 1545
599 nmdc:mga06r32_113555_c1 3300050510 Bacteria 2667
600 nmdc:mga06r32_633771_c1 3300050510 Bacteria 1038
601 nmdc:mga06r32_63433_c1 3300050510 Bacteria 3561
602 nmdc:mga06r32_679646_c1 3300050510 Bacteria 996
603 nmdc:mga06r32_87795_c1 3300050510 Bacteria 3035
604 nmdc:mga08y16_101552_c1 3300050511 Unclassified 2994
605 nmdc:mga08y16_120298_c1 3300050511 Bacteria 2733
606 nmdc:mga08y16_131002_c1 3300050511 Bacteria 2608
607 nmdc:mga08y16_133185_c1 3300050511 Bacteria 2584
608 nmdc:mga08y16_133677_c1 3300050511 Bacteria 2578
609 nmdc:mga08y16_25398_c1 3300050511 Bacteria 6247
610 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
611 nmdc:mga08y16_396356_c1 3300050511 Bacteria 1413
612 nmdc:mga08y16_565_c1 3300050511 Bacteria 34380
613 nmdc:mga08y16_82768_c1 3300050511 Bacteria 3345
614 nmdc:mga0n895_168916_c1 3300050512 Unclassified 2219
615 nmdc:mga0n895_28752_c1 3300050512 Bacteria 5292
616 nmdc:mga0n895_298580_c1 3300050512 Bacteria 1633
617 nmdc:mga0n895_392377_c1 3300050512 Unclassified 1404
618 nmdc:mga0n895_461_c1 3300050512 Bacteria 27200
619 nmdc:mga0n895_5087_c1 3300050512 Bacteria 10921
620 nmdc:mga0n895_5526_c1 3300050512 Bacteria 10582
621 nmdc:mga0n895_61191_c1 3300050512 Bacteria 3716
622 nmdc:mga0rr50_1623_c1 3300050513 Bacteria 12368
623 nmdc:mga0rr50_181714_c1 3300050513 Bacteria 1720
624 nmdc:mga0rr50_23550_c1 3300050513 Bacteria 4248
625 nmdc:mga0rr50_44423_c1 3300050513 Bacteria 3259
626 nmdc:mga0rr50_581428_c1 3300050513 Bacteria 954
627 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
628 nmdc:mga08x19_356_c1 3300050514 Bacteria 32856
629 nmdc:mga0a205_12501_c1 3300050515 Bacteria 7856
630 nmdc:mga0a205_237327_c2 3300050515 Bacteria 862
631 nmdc:mga0a205_263225_c1 3300050515 Bacteria 1602
632 nmdc:mga0a205_6854_c1 3300050515 Bacteria 10306
633 nmdc:mga0a205_92068_c1 3300050515 Bacteria 2930
634 Ga0500568_0028487 3300053139 Bacteria 2328
635 Ga0500588_0003173 3300053146 Bacteria 3440
636 Ga0500622_0016481 3300053156 Bacteria 3948
637 Ga0501084_0059569 3300054114 Bacteria 3196
638 Ga0501084_0823212 3300054114 Bacteria 782
639 Ga0501084_0931791 3300054114 Bacteria 730
640 Ga0590071_020559 3300059421 Bacteria 1554
641 Ga0590075_027432 3300059424 Bacteria 1436
642 Ga0590075_060950 3300059424 Bacteria 972
643 Ga0501082_0124708 3300060353 Bacteria 2234
644 Ga0530510_0047394 3300061734 Bacteria 3105
645 Ga0065707_10002959
646 MRS1b_contig_1082550
647 JGI25406J46586_10006663
648 JGI25406J46586_10009168
649 Ga0065704_10013963
650 Ga0065712_10011601
651 Ga0065712_10072603
652 Ga0065712_10098004
653 Ga0065712_10129627
654 Ga0065712_10167785
655 Ga0065712_10211082
656 Ga0065715_10094650
657 Ga0065715_10157372
658 Ga0065715_10278343
659 Ga0065715_10384768
660 Ga0065707_10010638
661 Ga0065707_10022567
662 Ga0065707_10090337
663 Ga0065707_10112983
664 Ga0070676_10010187
665 Ga0070676_10196857
666 Ga0070676_10374003
667 Ga0070683_100008426
668 Ga0070683_100752633
669 Ga0070690_100015247
670 Ga0070690_100124653
671 Ga0070690_100167112
672 Ga0070670_100007792
673 Ga0070670_100011618
674 Ga0070670_100014469
675 Ga0070670_100114245
676 Ga0070670_100168735
677 Ga0070670_100683449
678 Ga0070677_10094972
679 Ga0068869_100066008
680 Ga0068869_100163607
681 Ga0068869_100205185
682 Ga0070666_10271447
683 Ga0070666_10405450
684 Ga0070680_100252204
685 Ga0070680_100488465
686 Ga0070682_100316806
687 Ga0070660_100577813
688 Ga0070689_100025976
689 Ga0070689_100045909
690 Ga0070691_10004504
691 Ga0070687_100018723
692 Ga0070687_100020701
693 Ga0070687_100149046
694 Ga0070661_100195781
695 Ga0070692_10076796
696 Ga0070668_100041938
697 Ga0070668_100393258
698 Ga0070668_100807798
699 Ga0070669_100001684
700 Ga0070669_100004688
701 Ga0070669_100055858
702 Ga0070669_100535961
703 Ga0070675_100001521
704 Ga0070675_100017211
705 Ga0070675_100030192
706 Ga0070675_100038908
707 Ga0070675_100161007
708 Ga0070675_100247845
709 Ga0070675_100291328
710 Ga0070675_100364243
711 Ga0070675_100374218
712 Ga0070675_100414848
713 Ga0070675_100916158
714 Ga0070671_100233951
715 Ga0070671_100332324
716 Ga0070674_100021317
717 Ga0070674_100095959
718 Ga0070674_100149489
719 Ga0070674_100187485
720 Ga0070674_100234853
721 Ga0070674_100793876
722 Ga0070673_100004481
723 Ga0070673_100047448
724 Ga0070673_100268614
725 Ga0070673_100756503
726 Ga0070659_100140395
727 Ga0070659_100256565
728 Ga0070667_100070871
729 Ga0070667_100915371
730 Ga0070713_100091861
731 Ga0070710_10487285
732 Ga0070701_10032914
733 Ga0070701_10094080
734 Ga0070701_10381991
735 Ga0070711_100549899
736 Ga0070711_100650179
737 Ga0070705_100103130
738 Ga0070705_100219161
739 Ga0070705_100590452
740 Ga0070700_100030326
741 Ga0070700_100347448
742 Ga0070700_100386198
743 Ga0070700_100702734
744 Ga0070694_100007036
745 Ga0070694_100027920
746 Ga0070694_100178926
747 Ga0070694_100286097
748 Ga0070694_100765169
749 Ga0070663_100394579
750 Ga0070678_100041802
751 Ga0070678_100282697
752 Ga0070678_100373335
753 Ga0070678_100384030
754 Ga0070662_100265515
755 Ga0070662_100698230
756 Ga0070662_100976286
757 Ga0070681_10025231
758 Ga0068867_100002212
759 Ga0068867_100074809
760 Ga0068867_100249217
761 Ga0070685_10149291
762 Ga0070706_100511375
763 Ga0070707_100053548
764 Ga0070707_100386113
765 Ga0070698_100132299
766 Ga0070698_100578936
767 Ga0070699_100012501
768 Ga0070699_100024762
769 Ga0070699_100037300
770 Ga0070684_100062834
771 Ga0070684_100472547
772 Ga0070697_100485964
773 Ga0070672_100066178
774 Ga0070672_100139364
775 Ga0070672_100233394
776 Ga0070672_100734760
777 Ga0070686_100104329
778 Ga0070686_100170851
779 Ga0070686_100225360
780 Ga0070686_100288195
781 Ga0070695_100000063
782 Ga0070695_100004510
783 Ga0070695_100038416
784 Ga0070695_100105210
785 Ga0070695_100361033
786 Ga0070696_100000064
787 Ga0070696_100019223
788 Ga0070696_100026215
789 Ga0070696_100323738
790 Ga0070696_100364635
791 Ga0070693_100088516
792 Ga0070665_100141240
793 Ga0070665_100418538
794 Ga0070704_100000747
795 Ga0070704_100010507
796 Ga0070704_100059473
797 Ga0070704_100472465
798 Ga0070704_100540929
799 Ga0070664_100223412
800 Ga0068857_100014576
801 Ga0068854_100019496
802 Ga0068854_100029707
803 Ga0070702_100000648
804 Ga0070702_100021569
805 Ga0070702_100080649
806 Ga0070702_100133193
807 Ga0068859_100025918
808 Ga0068859_100041167
809 Ga0068859_100233353
810 Ga0068859_100492675
811 Ga0068859_101177016
812 Ga0068864_100112811
813 Ga0068864_100193413
814 Ga0068864_100212592
815 Ga0068864_100332765
816 Ga0068864_100440384
817 Ga0068861_100004217
818 Ga0068861_100008586
819 Ga0068861_100873788
820 Ga0068870_10038486
821 Ga0068863_100071065
822 Ga0068863_100131793
823 Ga0068858_100293726
824 Ga0068858_100316526
825 Ga0068860_100080076
826 Ga0068860_100742825
827 Ga0068862_100012093
828 Ga0068862_100039605
829 Ga0068862_100115810
830 Ga0068862_100353584
831 Ga0068862_100354085
832 Ga0081455_10140432
833 Ga0081539_10000291
834 Ga0081539_10000295
835 Ga0081539_10009784
836 Ga0075365_10010220
837 Ga0075365_10158774
838 Ga0075432_10077729
839 Ga0075367_10054163
840 Ga0075366_10048258
841 Ga0075366_10053711
842 Ga0075366_10467549
843 Ga0097621_100135130
844 Ga0097621_100334117
845 Ga0097621_100687250
846 Ga0068871_100134981
847 Ga0068871_100461760
848 Ga0068871_101071246
849 Ga0075428_100000019
850 Ga0075428_100248310
851 Ga0075428_100277775
852 Ga0075428_100469751
853 Ga0075428_100935109
854 Ga0075430_100006421
855 Ga0075431_100077725
856 Ga0075431_100250825
857 Ga0075431_100405131
858 Ga0075431_100414846
859 Ga0075433_10028455
860 Ga0075433_10053378
861 Ga0075433_10069078
862 Ga0075433_10492004
863 Ga0075433_10592506
864 Ga0075434_100003106
865 Ga0075434_100005957
866 Ga0075434_100038006
867 Ga0075434_100040876
868 Ga0075434_100050303
869 Ga0075434_100238872
870 Ga0075434_100362571
871 Ga0075434_100728653
872 Ga0075434_100981434
873 Ga0075429_100038132
874 Ga0075429_100066844
875 Ga0075429_100072232
876 Ga0075429_100100637
877 Ga0068865_100167776
878 Ga0068865_100237003
879 Ga0068865_100585045
880 Ga0075436_100000626
881 Ga0097620_100025919
882 Ga0097620_100041166
883 Ga0097620_100233357
884 Ga0097620_100492695
885 Ga0097620_101177211
886 Ga0075435_100000054
887 Ga0075435_100001354
888 Ga0075435_100004693
889 Ga0075435_100007192
890 Ga0075435_100015036
891 Ga0075435_100172013
892 Ga0075435_100331863
893 Ga0111539_10000002
894 Ga0111539_10000510
895 Ga0111539_10003612
896 Ga0111539_10009314
897 Ga0111539_10027205
898 Ga0111539_10152624
899 Ga0111539_10197751
900 Ga0111539_10225578
901 Ga0111539_10314928
902 Ga0111539_10699754
903 Ga0111539_10972584
904 Ga0111539_11336515
905 Ga0111539_11820964
906 Ga0105245_10074914
907 Ga0105245_10121209
908 Ga0105245_10210341
909 Ga0114129_10006505
910 Ga0114129_10037040
911 Ga0114129_10051884
912 Ga0114129_10112947
913 Ga0114129_10340832
914 Ga0114129_10690083
915 Ga0114129_10769114
916 Ga0114129_10803845
917 Ga0105243_10010407
918 Ga0105243_10012662
919 Ga0105243_10013743
920 Ga0105243_10085235
921 Ga0105243_10433213
922 Ga0105243_10592939
923 Ga0105241_10179597
924 Ga0105241_10255017
925 Ga0105242_10054946
926 Ga0105242_10172769
927 Ga0105242_10307773
928 Ga0105242_10384617
929 Ga0105242_10963151
930 Ga0105248_10055014
931 Ga0105248_10186942
932 Ga0105248_10320860
933 Ga0105248_10637178
934 Ga0105248_11081841
935 Ga0105238_10410436
936 Ga0105249_10002200
937 Ga0105249_10037925
938 Ga0105249_10079759
939 Ga0105249_10828229
940 Ga0105249_11115113
941 Ga0105246_10398953
942 Ga0157374_10111305
943 Ga0157374_10205609
944 Ga0157374_11179178
945 Ga0157378_10020220
946 Ga0163162_11196273
947 Ga0157375_10093987
948 Ga0157375_10370924
949 Ga0157375_10466568
950 Ga0163163_10189414
951 Ga0163163_10310447
952 Ga0163163_10505359
953 Ga0163163_10828463
954 Ga0157380_10016152
955 Ga0157380_10056992
956 Ga0157380_10069775
957 Ga0157380_10074966
958 Ga0157380_10104274
959 Ga0157380_10232659
960 Ga0157380_10392562
961 Ga0157380_10494484
962 Ga0157380_11297712
963 Ga0157377_10281711
964 Ga0157377_10383480
965 Ga0157379_10137032
966 Ga0157376_10049712
967 Ga0163161_10857540
968 Ga0207697_10002359
969 Ga0207697_10186397
970 Ga0207653_10005427
971 Ga0207688_10013727
972 Ga0207688_10293055
973 Ga0207647_10142021
974 Ga0207647_10416292
975 Ga0207645_10001981
976 Ga0207645_10027628
977 Ga0207645_10032484
978 Ga0207643_10013931
979 Ga0207705_10202639
980 Ga0207705_10266508
981 Ga0207684_10640336
982 Ga0207663_10570266
983 Ga0207662_10025684
984 Ga0207662_10275256
985 Ga0207649_10754368
986 Ga0207652_10905075
987 Ga0207646_10038770
988 Ga0207646_10434485
989 Ga0207681_10001889
990 Ga0207681_10022029
991 Ga0207681_10608355
992 Ga0207650_10004335
993 Ga0207650_10029479
994 Ga0207650_10303008
995 Ga0207659_10000726
996 Ga0207659_10047613
997 Ga0207659_10264484
998 Ga0207659_10296250
999 Ga0207659_10359502
1000 Ga0207659_10504574
1001 Ga0207687_10023825
1002 Ga0207687_10218755
1003 Ga0207687_10238178
1004 Ga0207700_10082073
1005 Ga0207644_10067522
1006 Ga0207644_10087099
1007 Ga0207644_10148944
1008 Ga0207644_10185545
1009 Ga0207644_10466800
1010 Ga0207706_10293539
1011 Ga0207706_10314046
1012 Ga0207706_10615625
1013 Ga0207706_10850496
1014 Ga0207686_10132065
1015 Ga0207709_10009055
1016 Ga0207709_10015915
1017 Ga0207709_10030716
1018 Ga0207709_10038260
1019 Ga0207709_10045348
1020 Ga0207709_10152479
1021 Ga0207709_10389518
1022 Ga0207670_10033385
1023 Ga0207670_10049437
1024 Ga0207669_10094418
1025 Ga0207704_10030521
1026 Ga0207704_10131528
1027 Ga0207691_10009469
1028 Ga0207691_10041053
1029 Ga0207691_10153939
1030 Ga0207691_10586848
1031 Ga0207711_10010245
1032 Ga0207711_10013662
1033 Ga0207711_10428958
1034 Ga0207689_10061221
1035 Ga0207689_10089237
1036 Ga0207689_10147907
1037 Ga0207689_10184870
1038 Ga0207689_10223865
1039 Ga0207661_10018738
1040 Ga0207679_10100184
1041 Ga0207679_10179272
1042 Ga0207679_10935839
1043 Ga0207651_10094131
1044 Ga0207651_10268267
1045 Ga0207712_10173614
1046 Ga0207712_10396654
1047 Ga0207668_10040916
1048 Ga0207640_10023131
1049 Ga0207677_10242741
1050 Ga0207703_10045779
1051 Ga0207703_10255294
1052 Ga0207703_10780690
1053 Ga0207639_10218253
1054 Ga0207639_10753180
1055 Ga0207678_10295817
1056 Ga0207708_10001924
1057 Ga0207708_10015556
1058 Ga0207708_10155381
1059 Ga0207708_10281199
1060 Ga0207641_10162699
1061 Ga0207648_10000815
1062 Ga0207648_10003630
1063 Ga0207648_10009192
1064 Ga0207648_10056781
1065 Ga0207676_10125355
1066 Ga0207676_10131837
1067 Ga0207676_10220949
1068 Ga0207676_10657526
1069 Ga0207674_10016945
1070 Ga0207674_10020897
1071 Ga0207674_10026616
1072 Ga0207675_100000622
1073 Ga0207675_100006105
1074 Ga0207675_100006298
1075 Ga0207675_100049476
1076 Ga0207675_100243439
1077 Ga0207675_100647154
1078 Ga0207675_100774421
1079 Ga0207683_10201880
1080 Ga0207683_10310991
1081 Ga0207683_10363984
1082 Ga0207683_10869604
1083 Ga0207698_10760714
1084 Ga0209974_10063817
1085 Ga0207428_10000004
1086 Ga0207428_10000654
1087 Ga0207428_10000986
1088 Ga0207428_10014458
1089 Ga0207428_10030395
1090 Ga0207428_10659047
1091 Ga0268266_10454416
1092 Ga0268265_10001186
1093 Ga0268265_10206242
1094 Ga0268265_10271937
1095 Ga0268265_10754989
1096 Ga0268265_10774741
1097 Ga0268264_10002343
1098 Ga0307408_100200398
1099 Ga0307408_100253811
1100 Ga0307410_10462510
1101 Ga0307410_10712566
1102 Ga0307407_10318166
1103 Ga0307412_10516651
1104 Ga0307409_100141686
1105 Ga0307409_100278237
1106 Ga0307409_100295053
1107 Ga0307409_101316265
1108 Ga0307416_100107229
1109 Ga0307416_100201662
1110 Ga0307416_100252069
1111 Ga0307411_10023224
1112 Ga0307411_10749047
1113 Ga0307415_100287114
1114 Ga0373930_0006611
1115 Ga0373930_0041955
1116 Ga0373950_0001596
1117 Ga0373958_0011630
1118 Ga0373959_0006524
1119 Ga0373938_0006063
1120 Ga0373928_0002037
1121 Ga0373929_0001073
1122 Ga0373940_0000879
1123 Ga0373949_0013822
1124 Ga0373951_0039010
1125 Ga0373952_0046363
1126 Ga0373932_0013910
1127 Ga0373939_0007543
1128 Ga0373939_0027951
1129 Ga0373941_0019317
1130 Ga0373960_0000194
1131 Ga0373942_0000063
1132 Ga0373961_0004973
1133 Ga0373961_0012394
1134 Ga0373961_0031244
1135 Ga0373962_0002153
1136 Ga0373931_0054031
1137 Ga0439439_0074950
1138 Ga0439447_073973
1139 Ga0451793_1554342
1140 Ga0451802_0704419
1141 Ga0439431_0028125
1142 Ga0439445_0026891
1143 Ga0439457_034467
1144 Ga0450920_065162
1145 Ga0450923_112800
1146 Ga0450894_001487
1147 Ga0450896_006486
1148 Ga0450896_009992
1149 Ga0450896_021476
1150 Ga0450898_022601
1151 Ga0439446_0055921
1152 Ga0439435_0069589
1153 Ga0439435_0130873
1154 Ga0439460_0107546
1155 Ga0450918_021623
1156 Ga0451577_0045883
1157 Ga0451577_0882272
1158 Ga0466960_0155346
1159 Ga0451576_0107333
1160 Ga0451576_0531714
1161 Ga0451576_1040784
1162 Ga0495663_0119766
1163 Ga0495642_0011217
1164 Ga0495598_0060996
1165 Ga0495598_0145458
1166 Ga0495621_0012414
1167 Ga0495621_0280370
1168 Ga0495659_0028020
1169 Ga0495659_0040832
1170 Ga0495669_0262054
1171 Ga0495589_0033711
1172 Ga0495636_0016970
1173 Ga0495636_0031167
1174 Ga0495636_0166819
1175 Ga0495636_0275395
1176 Ga0495677_0057570
1177 Ga0495677_0077191
1178 Ga0495615_0043751
1179 Ga0495615_0076381
1180 Ga0496102_0830596
1181 Ga0496104_0478986
1182 Ga0496106_0334728
1183 Ga0496109_0161444
1184 Ga0496112_0170998
1185 Ga0496114_0438443
1186 Ga0496124_0008980
1187 Ga0501032_0195968
1188 Ga0501036_0206375
1189 Ga0501036_0243137
1190 Ga0501036_0395328
1191 Ga0501039_0111834
1192 Ga0501039_0115518
1193 Ga0501040_0114312
1194 Ga0501040_0209406
1195 Ga0501040_0327000
1196 Ga0501041_0025612
1197 Ga0501041_0280874
1198 Ga0501042_0016151
1199 Ga0501042_0612968
1200 Ga0501046_0051651
1201 Ga0501048_0046835
1202 Ga0501048_0082871
1203 Ga0501067_0049240
1204 Ga0501070_0495269
1205 Ga0501071_0136845
1206 Ga0501071_0175777
1207 Ga0501071_0406928
1208 Ga0501072_0026436
1209 Ga0501074_0023969
1210 Ga0501074_0179014
1211 Ga0501075_0094277
1212 Ga0501075_0198300
1213 Ga0501075_0318894
1214 Ga0501076_0252883
1215 Ga0501077_0286270
1216 Ga0501257_062409
1217 Ga0501079_0031424
1218 Ga0501080_0025432
1219 Ga0501080_0158170
1220 Ga0501081_0236731
1221 Ga0501081_0736740
1222 Ga0501035_0153413
1223 Ga0501045_0047831
1224 nmdc:mga0yw44_70386_c1
1225 nmdc:mga0k408_43785_c1
1226 nmdc:mga06z11_192614_c1
1227 nmdc:mga06z11_333829_c1
1228 nmdc:mga05p37_10105_c1
1229 nmdc:mga05p37_234264_c1
1230 nmdc:mga05p37_312496_c1
1231 nmdc:mga05p37_36551_c1
1232 nmdc:mga05p37_3678_c1
1233 nmdc:mga05p37_50594_c1
1234 nmdc:mga09592_179604_c1
1235 nmdc:mga09592_220803_c1
1236 nmdc:mga09592_587495_c1
1237 nmdc:mga09592_68663_c1
1238 nmdc:mga09592_703265_c1
1239 nmdc:mga0qj67_13422_c1
1240 nmdc:mga0qj67_136996_c1
1241 nmdc:mga0qj67_14287_c1
1242 nmdc:mga0qj67_219016_c1
1243 nmdc:mga06r32_113555_c1
1244 nmdc:mga06r32_633771_c1
1245 nmdc:mga06r32_63433_c1
1246 nmdc:mga06r32_679646_c1
1247 nmdc:mga06r32_87795_c1
1248 nmdc:mga08y16_101552_c1
1249 nmdc:mga08y16_120298_c1
1250 nmdc:mga08y16_131002_c1
1251 nmdc:mga08y16_133185_c1
1252 nmdc:mga08y16_133677_c1
1253 nmdc:mga08y16_25398_c1
1254 nmdc:mga08y16_2_c1
1255 nmdc:mga08y16_396356_c1
1256 nmdc:mga08y16_565_c1
1257 nmdc:mga08y16_82768_c1
1258 nmdc:mga0n895_168916_c1
1259 nmdc:mga0n895_28752_c1
1260 nmdc:mga0n895_298580_c1
1261 nmdc:mga0n895_392377_c1
1262 nmdc:mga0n895_461_c1
1263 nmdc:mga0n895_5087_c1
1264 nmdc:mga0n895_5526_c1
1265 nmdc:mga0n895_61191_c1
1266 nmdc:mga0rr50_1623_c1
1267 nmdc:mga0rr50_181714_c1
1268 nmdc:mga0rr50_23550_c1
1269 nmdc:mga0rr50_44423_c1
1270 nmdc:mga0rr50_581428_c1
1271 nmdc:mga0rr50_5_c1
1272 nmdc:mga08x19_356_c1
1273 nmdc:mga0a205_12501_c1
1274 nmdc:mga0a205_237327_c2
1275 nmdc:mga0a205_263225_c1
1276 nmdc:mga0a205_6854_c1
1277 nmdc:mga0a205_92068_c1
1278 Ga0500568_0028487
1279 Ga0500588_0003173
1280 Ga0500622_0016481
1281 Ga0501084_0059569
1282 Ga0501084_0823212
1283 Ga0501084_0931791
1284 Ga0590071_020559
1285 Ga0590075_027432
1286 Ga0590075_060950
1287 Ga0501082_0124708
1288 Ga0530510_0047394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

52

230

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.8795 3 198
5d92-assembly2.cif.gz_C structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7021 6 189
4mnd-assembly1.cif.gz_A-2 crystal structure of archaeoglobus fulgidus ipct-dipps bifunctional membrane protein 0.6929 6 189
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.6877 3 198
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.6856 6 189
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9449 2 195 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.922 2 195 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9202 1 184 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8954 1 198 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8879 1 184 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A068S3H5-F1-model_v4 Pyruvate carboxylase 0.967 2 93 GO:0005524
GO:0008654
GO:0016020
GO:0016780
GO:0016874
GO:0046872
AF-R8BT71-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9586 2 198 GO:0008654
GO:0012505
GO:0016020
GO:0016780
GO:0022857
AF-A0A507CX03-F1-model_v4 RNA polymerase II transcription factor B subunit 2 0.9571 2 198 GO:0000439
GO:0001671
GO:0003690
GO:0005675
GO:0006289
GO:0008654
GO:0016020
GO:0016780
AF-A0A4S4LPZ1-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.3.2.27) (EC 2.7.8.8) (Non-structural maintenance of chromosomes element 1 homolog) (Phosphatidylserine synthase) 0.9529 2 188 GO:0000724
GO:0004842
GO:0005634
GO:0008654
GO:0012505
GO:0016020
GO:0016780
GO:0030915
AF-A0A2J6PJA2-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9522 1 198 GO:0005737
GO:0008654
GO:0012505
GO:0016020
GO:0016780

Map