F472091

General Info

Members Datasets Scaffolds Average Seq Length
645 358 1290 620

Family's Representative Sequence

Representative Sequence 3300002126|JGI24035J26624_1000858|JGI24035J26624_10008582
Length 747
Sequence VELLSALKKHFGYDQFRPLQREIMHDALAGRDLFVLMPTGGGKSLCFQLPALMRDGLTIVVSPLIALMKDQVDGLQTSGIPATYLNSTLDRAEAKARWRGLHRGQYRMLYVAPERLMLDTFLERALNWDIAQFAIDEAHCISEWGHDFRPEYRELKKLRKQLPDVPIMALTATATERVRVDIIKELELRDPRAYVASFNRPNLTYRVVPKTAPYDQLLTFIRSRPNDSGIIYCASRKSTESLARNLNEDGITAKPYHAGLTNAERTKHQDAFLRDDVRVITATIAFGMGINKPNVRFVVHYDLPKNIESYYQETGRAGRDGLPSECVLLFSPGDVAKQLHFIDEKTESEARIARAQLQQMVHYAEARECRRTVLLKYFGESYPSNAEAVGDATLPLQISCESCDNCLQPRETFDGTVHAQKFLSCVYRIRARHGFGFGLGHVVDVLRGADTEAIRQRSHNELSTYGIGGELKRSEWQAIGRELLRLGLIECAPGKFATLSLTPTGLEALRKRTSIVLTKQIEIVEKAPRRRAGAIECDEALFERLRALRRKFADERGVPAYIIFSDVSLREMARKYPSNSAXFRRIPGVGEQKSKDYAEPFLIEIRKYLTTSPRRTFPDEVDSSLPQRQVRLNDSQTDTLRRFQRGETVEQIARARGFVSSTIYGHLLAAIECCKLPQARARFFTPVQEKEITAAFHQVPGGTLTDISAILRNKYDIGLLRIFRALKQGRTASQPSKENDGLEAVTP

Samples

Sample ID Description Type Environment
1 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
80 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
81 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
82 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
137 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
140 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
141 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
148 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
196 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
197 2506520008 Serratia plymuthica AS12 Isolate Unclassified
198 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
199 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
200 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
201 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
202 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
203 2547132181 Kosakonia sacchari SP1 Isolate Stem
204 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
205 2561511199 Enterobacter sp. R4-368 Isolate Nodule
206 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
207 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
208 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
209 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
210 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
211 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
212 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
213 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
214 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
215 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
216 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
217 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
218 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
219 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
220 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
221 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
222 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
223 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
224 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
225 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
226 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
227 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
228 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
229 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
230 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
231 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
232 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
233 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
234 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
235 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
236 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
237 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
238 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
239 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
240 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
241 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
242 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
243 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
244 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
245 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
246 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
247 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
248 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
249 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
250 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
251 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
252 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
253 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
254 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
255 2636415599 Klebsiella variicola DX120E Isolate Unclassified
256 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
257 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
258 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
259 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
260 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
261 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
262 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
263 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
264 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
265 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
266 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
267 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
268 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
269 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
270 2751185917 Enterobacter sp. HK169 Isolate Unclassified
271 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
272 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
273 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
274 2775507074 Klebsiella sp. D5A Isolate Unclassified
275 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
276 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
277 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
278 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
279 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
280 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
281 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
282 2821118458 Enterobacter asburiae 609 Isolate Unclassified
283 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
284 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
285 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
286 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
287 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
288 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
289 2847085930 Erwinia persicina B64 Isolate Bulb
290 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
291 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
292 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
293 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
294 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
295 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
296 2865014394 Pantoea sp. R-71966 Isolate Unclassified
297 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
298 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
299 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
300 2876601092 Pantoea endophytica 596 Isolate Unclassified
301 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
302 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
303 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
304 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
305 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
306 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
307 2902330777 Methylobacterium sp. 2A Isolate Unclassified
308 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
309 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
310 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
311 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
312 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
313 2919150387 Rahnella aceris 1817 Isolate Unclassified
314 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
315 2927143783 Rahnella sp. 2050 Isolate Unclassified
316 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
317 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
318 2932406140 Serratia sp. 2723 Isolate Rhizosphere
319 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
320 2937539931 Pantoea sp. LS15 Isolate Unclassified
321 2937967321 Serratia sp. YC16 Isolate Unclassified
322 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
323 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
324 2939577877 Serratia sp. 509 Isolate Rhizosphere
325 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
326 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
327 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
328 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
329 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
330 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
331 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
332 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
333 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
334 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
335 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
336 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
337 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
338 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
339 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
340 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
341 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
342 640753048 Serratia proteamaculans 568 Isolate Endosphere
343 641522639 Methylobacterium sp. 4-46 Isolate Nodule
344 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
345 8004592986 Serratia sp. S119 Isolate Unclassified
346 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
347 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
348 8018221730 Enterobacter sp. CM29 Isolate Unclassified
349 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
350 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
351 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
352 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
353 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
354 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
355 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
356 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
357 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
358 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.73
Metatranscriptomes 0
Isolates 25.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.62
Bulb 0.16
Endosphere 4.03
Nodule 3.72
Rhizoplane 12.09
Rhizosphere 58.45
Stem 0.16
Stem Tuber 0.78
Unclassified 0.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1000858 3300002126 Bacteria 2859
2 RicEn_C1615 2010549000 Bacteria 3193
3 SwRhRL2b_contig_1995509 2162886007 Bacteria 9393
4 JGI24739J22299_10000016 3300001989 Bacteria 51238
5 JGI25162J39368_1002393 3300002737 Bacteria 7368
6 JGI25163J39215_1000498 3300002771 Bacteria 11707
7 JGI25164J39214_1000152 3300002772 Bacteria 65144
8 JGI25406J46586_10003544 3300003203 Bacteria 7319
9 rootH2_10019123 3300003320 Bacteria 25137
10 Ga0055538_1000109 3300003751 Bacteria 65144
11 Ga0055539_1000158 3300003752 Bacteria 65144
12 Ga0055533_1000160 3300003756 Bacteria 65144
13 Ga0055525_1000212 3300003759 Bacteria 65144
14 Ga0055541_1000104 3300003841 Bacteria 65144
15 Ga0058692_1000145 3300003856 Bacteria 44977
16 Ga0058692_1000179 3300003856 Bacteria 38966
17 Ga0058692_1000253 3300003856 Bacteria 29276
18 Ga0058692_1000310 3300003856 Bacteria 24410
19 Ga0058692_1002097 3300003856 Bacteria 6881
20 Ga0058692_1005063 3300003856 Bacteria 3801
21 Ga0058692_1007644 3300003856 Bacteria 2850
22 Ga0065703_1019144 3300005272 Bacteria 3817
23 Ga0065704_10000450 3300005289 Bacteria 46008
24 Ga0065704_10000585 3300005289 Bacteria 32775
25 Ga0065704_10001072 3300005289 Bacteria 11040
26 Ga0065704_10002167 3300005289 Bacteria 11665
27 Ga0065704_10005603 3300005289 Bacteria 5939
28 Ga0065704_10083086 3300005289 Bacteria 3495
29 Ga0070676_10005504 3300005328 Bacteria 6745
30 Ga0070670_100010316 3300005331 Bacteria 7972
31 Ga0070666_10023541 3300005335 Bacteria 4009
32 Ga0068868_100052483 3300005338 Bacteria 3210
33 Ga0070668_100010851 3300005347 Bacteria 6778
34 Ga0070668_100021156 3300005347 Bacteria 4918
35 Ga0070668_100039810 3300005347 Bacteria 3595
36 Ga0070675_100003479 3300005354 Bacteria 11943
37 Ga0070675_100022432 3300005354 Bacteria 5045
38 Ga0070671_100035869 3300005355 Bacteria 4110
39 Ga0070673_100066345 3300005364 Bacteria 2882
40 Ga0070688_100003336 3300005365 Bacteria 8231
41 Ga0070688_100015592 3300005365 Bacteria 4329
42 Ga0070659_100005733 3300005366 Bacteria 8942
43 Ga0070659_100080418 3300005366 Bacteria 2602
44 Ga0070713_100003711 3300005436 Bacteria 10111
45 Ga0070705_100022371 3300005440 Bacteria 3378
46 Ga0070694_100006030 3300005444 Bacteria 7353
47 Ga0070708_100015332 3300005445 Bacteria 6326
48 Ga0070708_100042870 3300005445 Bacteria 3975
49 Ga0070663_100025838 3300005455 Bacteria 3969
50 Ga0070662_100001198 3300005457 Bacteria 15942
51 Ga0070662_100007716 3300005457 Bacteria 6983
52 Ga0068867_100027221 3300005459 Bacteria 4108
53 Ga0070706_100000012 3300005467 Bacteria 195040
54 Ga0070706_100026830 3300005467 Bacteria 5299
55 Ga0070706_100089304 3300005467 Bacteria 2857
56 Ga0070707_100000171 3300005468 Bacteria 63131
57 Ga0070707_100018012 3300005468 Bacteria 6644
58 Ga0070707_100025810 3300005468 Bacteria 5577
59 Ga0070707_100037533 3300005468 Bacteria 4625
60 Ga0070707_100091331 3300005468 Bacteria 2948
61 Ga0070698_100005853 3300005471 Bacteria 13438
62 Ga0070698_100006464 3300005471 Bacteria 12714
63 Ga0070698_100062816 3300005471 Bacteria 3746
64 Ga0070699_100055669 3300005518 Bacteria 3424
65 Ga0070699_100072436 3300005518 Bacteria 2997
66 Ga0070679_100174921 3300005530 Bacteria 2119
67 Ga0070684_100047194 3300005535 Bacteria 3732
68 Ga0070697_100004109 3300005536 Bacteria 11151
69 Ga0070697_100014242 3300005536 Bacteria 6249
70 Ga0070697_100055773 3300005536 Bacteria 3213
71 Ga0070697_100107827 3300005536 Bacteria 2317
72 Ga0070696_100035227 3300005546 Bacteria 3445
73 Ga0070665_100001124 3300005548 Bacteria 32893
74 Ga0070665_100022483 3300005548 Bacteria 6347
75 Ga0070665_100024927 3300005548 Bacteria 6028
76 Ga0070704_100031976 3300005549 Bacteria 3544
77 Ga0070704_100075021 3300005549 Bacteria 2469
78 Ga0068857_100000028 3300005577 Bacteria 81820
79 Ga0068851_10002655 3300005834 Bacteria 7876
80 Ga0068863_100003673 3300005841 Bacteria 15154
81 Ga0068858_100014781 3300005842 Bacteria 7344
82 Ga0068860_100026107 3300005843 Bacteria 5633
83 Ga0081455_10001011 3300005937 Bacteria 35586
84 Ga0081455_10007739 3300005937 Bacteria 11270
85 Ga0081455_10008751 3300005937 Bacteria 10478
86 Ga0081455_10012591 3300005937 Bacteria 8431
87 Ga0081540_1000368 3300005983 Bacteria 45151
88 Ga0081539_10001203 3300005985 Bacteria 46667
89 Ga0081539_10001276 3300005985 Bacteria 44329
90 Ga0081539_10012531 3300005985 Bacteria 6518
91 Ga0070717_10012684 3300006028 Bacteria 6432
92 Ga0075364_10006318 3300006051 Bacteria 6962
93 Ga0075364_10033505 3300006051 Bacteria 3309
94 Ga0097621_100005446 3300006237 Bacteria 8965
95 Ga0079104_1000254 3300006946 Bacteria 71140
96 Ga0079104_1000335 3300006946 Bacteria 57496
97 Ga0079104_1000356 3300006946 Bacteria 55363
98 Ga0079104_1000694 3300006946 Bacteria 30639
99 Ga0079104_1001489 3300006946 Bacteria 15601
100 Ga0079104_1002151 3300006946 Bacteria 11168
101 Ga0079104_1003593 3300006946 Bacteria 7111
102 Ga0079104_1004611 3300006946 Bacteria 5808
103 Ga0079104_1011435 3300006946 Bacteria 2853
104 Ga0105251_10000386 3300009011 Bacteria 43038
105 Ga0105251_10000533 3300009011 Bacteria 35947
106 Ga0105251_10001068 3300009011 Bacteria 24007
107 Ga0105251_10002401 3300009011 Bacteria 14789
108 Ga0105251_10006416 3300009011 Bacteria 7495
109 Ga0105251_10015539 3300009011 Bacteria 4155
110 Ga0105251_10021855 3300009011 Bacteria 3332
111 Ga0105251_10022048 3300009011 Bacteria 3315
112 Ga0105244_10000103 3300009036 Bacteria 87849
113 Ga0105244_10000516 3300009036 Bacteria 34499
114 Ga0105244_10000539 3300009036 Bacteria 33792
115 Ga0105244_10000551 3300009036 Bacteria 33478
116 Ga0105244_10000566 3300009036 Bacteria 33080
117 Ga0105244_10000844 3300009036 Bacteria 25934
118 Ga0105244_10005549 3300009036 Bacteria 8359
119 Ga0105244_10005895 3300009036 Bacteria 8042
120 Ga0105244_10010070 3300009036 Bacteria 5755
121 Ga0105244_10011769 3300009036 Bacteria 5219
122 Ga0105250_10000205 3300009092 Bacteria 49631
123 Ga0105250_10000217 3300009092 Bacteria 47880
124 Ga0105250_10002873 3300009092 Bacteria 8415
125 Ga0105240_10058281 3300009093 Bacteria 4821
126 Ga0114129_10083246 3300009147 Bacteria 4445
127 Ga0114129_10121920 3300009147 Bacteria 3587
128 Ga0105243_10000658 3300009148 Bacteria 34192
129 Ga0105243_10005793 3300009148 Bacteria 9592
130 Ga0105241_10000010 3300009174 Bacteria 253836
131 Ga0105239_10071650 3300010375 Bacteria 3808
132 Ga0105246_10008080 3300011119 Bacteria 6458
133 Ga0105246_10013548 3300011119 Bacteria 5113
134 Ga0157373_10000114 3300013100 Bacteria 63657
135 Ga0157373_10012149 3300013100 Bacteria 6331
136 Ga0157373_10013005 3300013100 Bacteria 6109
137 Ga0157373_10058475 3300013100 Bacteria 2733
138 Ga0157371_10000102 3300013102 Bacteria 129057
139 Ga0157371_10000554 3300013102 Bacteria 44435
140 Ga0157371_10000577 3300013102 Bacteria 43493
141 Ga0157371_10000835 3300013102 Bacteria 35218
142 Ga0157371_10007860 3300013102 Bacteria 8561
143 Ga0157371_10028386 3300013102 Bacteria 4052
144 Ga0157370_10000356 3300013104 Bacteria 58148
145 Ga0157370_10000444 3300013104 Bacteria 51739
146 Ga0157370_10001839 3300013104 Bacteria 26159
147 Ga0157369_10000452 3300013105 Bacteria 54418
148 Ga0157369_10018575 3300013105 Bacteria 7794
149 Ga0157374_10020242 3300013296 Bacteria 5901
150 Ga0157374_10051179 3300013296 Bacteria 3843
151 Ga0157378_10016372 3300013297 Bacteria 6492
152 Ga0163162_10017090 3300013306 Bacteria 7097
153 Ga0163162_10088738 3300013306 Bacteria 3171
154 Ga0157372_10000094 3300013307 Bacteria 91570
155 Ga0157372_10016801 3300013307 Bacteria 7855
156 Ga0157372_10115647 3300013307 Bacteria 3075
157 Ga0157375_10005291 3300013308 Bacteria 11208
158 Ga0182008_10001384 3300014497 Bacteria 16416
159 Ga0157379_10012858 3300014968 Bacteria 7320
160 Ga0182006_1000009 3300015261 Bacteria 438243
161 Ga0182006_1016027 3300015261 Bacteria 3202
162 Ga0182007_10008670 3300015262 Bacteria 4161
163 Ga0183366_1009 3300015679 Bacteria 83233
164 Ga0183370_1009 3300015680 Bacteria 83369
165 Ga0183369_1024 3300015685 Bacteria 83369
166 Ga0183368_1012 3300015687 Bacteria 83369
167 Ga0163161_10000006 3300017792 Bacteria 302708
168 Ga0213876_10000106 3300021384 Bacteria 92733
169 Ga0209760_100370 3300025207 Bacteria 11942
170 Ga0209784_100064 3300025224 Bacteria 158058
171 Ga0209566_100079 3300025225 Bacteria 158058
172 Ga0209674_100194 3300025226 Bacteria 65330
173 Ga0209563_100152 3300025230 Bacteria 65330
174 Ga0207427_100181 3300025231 Bacteria 65330
175 Ga0209437_100092 3300025233 Bacteria 240044
176 Ga0209437_100149 3300025233 Bacteria 158058
177 Ga0209677_100148 3300025253 Bacteria 65330
178 Ga0209129_1000179 3300025258 Bacteria 91892
179 Ga0209233_1003969 3300025261 Bacteria 5125
180 Ga0209050_1001319 3300025298 Bacteria 27765
181 Ga0207697_10000080 3300025315 Bacteria 42127
182 Ga0207697_10000565 3300025315 Bacteria 21021
183 Ga0207697_10001605 3300025315 Bacteria 12214
184 Ga0207697_10001735 3300025315 Bacteria 11709
185 Ga0207697_10001989 3300025315 Bacteria 10851
186 Ga0207656_10002534 3300025321 Bacteria 6175
187 Ga0207696_1000046 3300025711 Bacteria 291327
188 Ga0207696_1000331 3300025711 Bacteria 49639
189 Ga0207696_1000347 3300025711 Bacteria 47888
190 Ga0207696_1000404 3300025711 Bacteria 40294
191 Ga0207696_1000414 3300025711 Bacteria 39676
192 Ga0207696_1000434 3300025711 Bacteria 37870
193 Ga0207696_1000534 3300025711 Bacteria 30992
194 Ga0207696_1000590 3300025711 Bacteria 27786
195 Ga0207696_1011496 3300025711 Bacteria 3183
196 Ga0207655_1000111 3300025728 Bacteria 170772
197 Ga0207655_1000170 3300025728 Bacteria 119267
198 Ga0207655_1000208 3300025728 Bacteria 102775
199 Ga0207655_1000245 3300025728 Bacteria 87921
200 Ga0207655_1000393 3300025728 Bacteria 60847
201 Ga0207655_1000547 3300025728 Bacteria 47308
202 Ga0207655_1000583 3300025728 Bacteria 45119
203 Ga0207655_1001676 3300025728 Bacteria 19510
204 Ga0207655_1002339 3300025728 Bacteria 15522
205 Ga0207655_1003418 3300025728 Bacteria 11839
206 Ga0207655_1004465 3300025728 Bacteria 9917
207 Ga0207655_1004584 3300025728 Bacteria 9732
208 Ga0207655_1009735 3300025728 Bacteria 5927
209 Ga0207655_1015135 3300025728 Bacteria 4309
210 Ga0207713_1000045 3300025735 Bacteria 235202
211 Ga0207713_1000056 3300025735 Bacteria 217615
212 Ga0207713_1000075 3300025735 Bacteria 179242
213 Ga0207713_1000334 3300025735 Bacteria 52545
214 Ga0207713_1000340 3300025735 Bacteria 51524
215 Ga0207713_1000368 3300025735 Bacteria 49034
216 Ga0207713_1000613 3300025735 Bacteria 35114
217 Ga0207713_1005588 3300025735 Bacteria 7828
218 Ga0207713_1005810 3300025735 Bacteria 7635
219 Ga0207713_1012005 3300025735 Bacteria 4663
220 Ga0207710_10000024 3300025900 Bacteria 319633
221 Ga0207685_10013631 3300025905 Bacteria 2520
222 Ga0207699_10042974 3300025906 Bacteria 2622
223 Ga0207645_10001266 3300025907 Bacteria 20804
224 Ga0207684_10000028 3300025910 Bacteria 306450
225 Ga0207654_10000010 3300025911 Bacteria 304367
226 Ga0207693_10022979 3300025915 Bacteria 4951
227 Ga0207663_10049848 3300025916 Bacteria 2600
228 Ga0207652_10144812 3300025921 Bacteria 2126
229 Ga0207646_10000750 3300025922 Bacteria 42120
230 Ga0207646_10005961 3300025922 Bacteria 12710
231 Ga0207659_10054359 3300025926 Bacteria 2859
232 Ga0207700_10041392 3300025928 Bacteria 3370
233 Ga0207700_10045799 3300025928 Bacteria 3231
234 Ga0207700_10062244 3300025928 Bacteria 2833
235 Ga0207644_10019694 3300025931 Bacteria 4581
236 Ga0207690_10054702 3300025932 Bacteria 2685
237 Ga0207706_10000188 3300025933 Bacteria 68890
238 Ga0207706_10006159 3300025933 Bacteria 11140
239 Ga0207706_10022047 3300025933 Bacteria 5717
240 Ga0207709_10000428 3300025935 Bacteria 40164
241 Ga0207709_10008436 3300025935 Bacteria 5699
242 Ga0207691_10013604 3300025940 Bacteria 7778
243 Ga0207689_10037124 3300025942 Bacteria 4043
244 Ga0207668_10018622 3300025972 Bacteria 4374
245 Ga0207658_10017639 3300025986 Bacteria 4922
246 Ga0207678_10033857 3300026067 Bacteria 4450
247 Ga0207648_10014539 3300026089 Bacteria 7268
248 Ga0207674_10000367 3300026116 Bacteria 58646
249 Ga0207675_100019738 3300026118 Bacteria 6291
250 Ga0207675_100032043 3300026118 Bacteria 4896
251 Ga0207683_10017568 3300026121 Bacteria 6099
252 Ga0207683_10040438 3300026121 Bacteria 4068
253 Ga0209281_1000139 3300027111 Bacteria 179588
254 Ga0209281_1000285 3300027111 Bacteria 95379
255 Ga0209281_1000305 3300027111 Bacteria 87790
256 Ga0209281_1000312 3300027111 Bacteria 86565
257 Ga0209281_1000326 3300027111 Bacteria 83038
258 Ga0209281_1000341 3300027111 Bacteria 79173
259 Ga0209281_1000497 3300027111 Bacteria 53471
260 Ga0209281_1000794 3300027111 Bacteria 29597
261 Ga0209281_1000867 3300027111 Bacteria 26345
262 Ga0209281_1001035 3300027111 Bacteria 21254
263 Ga0209281_1002561 3300027111 Bacteria 7074
264 Ga0209371_1000063 3300027312 Bacteria 218863
265 Ga0209371_1000068 3300027312 Bacteria 209008
266 Ga0209371_1000071 3300027312 Bacteria 200748
267 Ga0209371_1000201 3300027312 Bacteria 86471
268 Ga0209371_1000210 3300027312 Bacteria 81841
269 Ga0209371_1000299 3300027312 Bacteria 55390
270 Ga0209371_1000323 3300027312 Bacteria 52340
271 Ga0209371_1000331 3300027312 Bacteria 51486
272 Ga0209371_1000429 3300027312 Bacteria 42773
273 Ga0209371_1000617 3300027312 Bacteria 31694
274 Ga0209371_1001510 3300027312 Bacteria 15464
275 Ga0209371_1001732 3300027312 Bacteria 13756
276 Ga0209371_1002324 3300027312 Bacteria 10815
277 Ga0209371_1003334 3300027312 Bacteria 7897
278 Ga0209371_1003829 3300027312 Bacteria 6981
279 Ga0209371_1008231 3300027312 Bacteria 3502
280 Ga0268266_10000295 3300028379 Bacteria 81170
281 Ga0268266_10011374 3300028379 Bacteria 7740
282 Ga0268266_10026318 3300028379 Bacteria 4949
283 Ga0268264_10081321 3300028381 Bacteria 2768
284 Ga0268256_1000060 3300030500 Bacteria 218807
285 Ga0268256_1000064 3300030500 Bacteria 210320
286 Ga0268256_1000070 3300030500 Bacteria 189040
287 Ga0268256_1000166 3300030500 Bacteria 82045
288 Ga0268256_1000284 3300030500 Bacteria 52338
289 Ga0268256_1000386 3300030500 Bacteria 40664
290 Ga0268256_1000720 3300030500 Bacteria 24458
291 Ga0268256_1000769 3300030500 Bacteria 23396
292 Ga0268256_1000995 3300030500 Bacteria 19246
293 Ga0268256_1001510 3300030500 Bacteria 13751
294 Ga0268256_1002953 3300030500 Bacteria 8086
295 Ga0268256_1003033 3300030500 Bacteria 7897
296 Ga0268256_1003255 3300030500 Bacteria 7480
297 Ga0268256_1008520 3300030500 Bacteria 3502
298 Ga0268256_1010641 3300030500 Bacteria 2964
299 Ga0373947_0047516 3300035725 Bacteria 2572
300 Ga0395899_0053566 3300037312 Bacteria 2987
301 Ga0395900_0004913 3300037418 Bacteria 14075
302 Ga0395900_0191703 3300037418 Bacteria 2073
303 Ga0395901_0103143 3300038443 Bacteria 2993
304 Ga0436365_0083358 3300039437 Bacteria 92482
305 Ga0439438_000014 3300041405 Bacteria 130876
306 Ga0439438_001432 3300041405 Bacteria 10525
307 Ga0439447_001628 3300041407 Bacteria 8233
308 Ga0439447_002527 3300041407 Bacteria 6651
309 Ga0439466_0000008 3300041411 Bacteria 246721
310 Ga0439432_003818 3300042006 Bacteria 5559
311 Ga0439432_012497 3300042006 Bacteria 2902
312 Ga0439452_000010 3300042010 Bacteria 459139
313 Ga0439452_000023 3300042010 Bacteria 232427
314 Ga0439452_000067 3300042010 Bacteria 91480
315 Ga0439452_000092 3300042010 Bacteria 77736
316 Ga0439452_000103 3300042010 Bacteria 70370
317 Ga0439452_000160 3300042010 Bacteria 49961
318 Ga0450907_000030 3300042146 Bacteria 68375
319 Ga0439464_0002326 3300042439 Bacteria 4654
320 Ga0439464_0002690 3300042439 Bacteria 4410
321 Ga0451577_0000018 3300042876 Bacteria 516495
322 Ga0451577_0000193 3300042876 Bacteria 128594
323 Ga0451577_0001262 3300042876 Bacteria 34982
324 Ga0451577_0003489 3300042876 Bacteria 17483
325 Ga0466981_0000022 3300044669 Bacteria 83073
326 Ga0453684_0000090 3300044712 Bacteria 391614
327 Ga0453684_0000166 3300044712 Bacteria 294291
328 Ga0453684_0006193 3300044712 Bacteria 22946
329 Ga0453684_0084749 3300044712 Bacteria 3940
330 Ga0453684_0091396 3300044712 Bacteria 3757
331 Ga0451576_0001179 3300045051 Bacteria 46858
332 Ga0495627_001403 3300046453 Bacteria 14254
333 Ga0495591_000031 3300046458 Bacteria 177747
334 Ga0495591_000148 3300046458 Bacteria 74574
335 Ga0495591_002347 3300046458 Bacteria 10645
336 Ga0495591_003527 3300046458 Bacteria 8030
337 Ga0495650_0000199 3300046471 Bacteria 130411
338 Ga0495650_0000360 3300046471 Bacteria 80145
339 Ga0495650_0000418 3300046471 Bacteria 69242
340 Ga0495605_0010666 3300046474 Bacteria 5135
341 Ga0495584_0005890 3300046491 Bacteria 6460
342 Ga0495596_0003622 3300046500 Bacteria 7763
343 Ga0495607_0002720 3300046501 Bacteria 14105
344 Ga0495606_0000541 3300046507 Bacteria 60650
345 Ga0495620_0025189 3300046515 Bacteria 2818
346 Ga0495644_0008348 3300046523 Bacteria 3989
347 Ga0495648_0002122 3300046524 Bacteria 18682
348 Ga0495648_0015539 3300046524 Bacteria 5525
349 Ga0495654_0000040 3300046530 Bacteria 184580
350 Ga0495654_0000519 3300046530 Bacteria 31360
351 Ga0495654_0001042 3300046530 Bacteria 20292
352 Ga0495597_0004190 3300046542 Bacteria 7993
353 Ga0495625_0040316 3300046660 Bacteria 3407
354 Ga0495588_0003426 3300046674 Bacteria 6894
355 Ga0495669_0036697 3300046684 Bacteria 2167
356 Ga0495671_0004850 3300046692 Bacteria 7952
357 Ga0495649_0009979 3300046694 Bacteria 5613
358 Ga0495649_0013129 3300046694 Bacteria 4787
359 Ga0495589_0000274 3300046794 Bacteria 42043
360 Ga0495589_0004351 3300046794 Bacteria 7554
361 Ga0495660_0000045 3300046810 Bacteria 150303
362 Ga0495660_0000134 3300046810 Bacteria 80417
363 Ga0495672_0000083 3300047320 Bacteria 158118
364 Ga0495672_0000224 3300047320 Bacteria 80413
365 Ga0495672_0000225 3300047320 Bacteria 80331
366 Ga0495679_000178 3300047446 Bacteria 57765
367 Ga0495679_002253 3300047446 Bacteria 9983
368 Ga0495679_004186 3300047446 Bacteria 6731
369 Ga0495673_0000216 3300047469 Bacteria 85578
370 Ga0495673_0000622 3300047469 Bacteria 34841
371 Ga0496100_0013822 3300048903 Bacteria 4670
372 Ga0496100_0033456 3300048903 Bacteria 3217
373 Ga0496100_0044670 3300048903 Bacteria 2839
374 Ga0496101_0000119 3300048904 Bacteria 77119
375 Ga0496101_0027293 3300048904 Bacteria 3976
376 Ga0496101_0036427 3300048904 Bacteria 3485
377 Ga0496102_0012173 3300048905 Bacteria 7437
378 Ga0496102_0109050 3300048905 Bacteria 2579
379 Ga0496103_0047363 3300048906 Bacteria 2657
380 Ga0496104_0002540 3300048907 Bacteria 15716
381 Ga0496104_0043728 3300048907 Bacteria 4207
382 Ga0496104_0135936 3300048907 Bacteria 2362
383 Ga0496105_0003574 3300048908 Bacteria 11535
384 Ga0496105_0033590 3300048908 Bacteria 4214
385 Ga0496105_0087023 3300048908 Bacteria 2582
386 Ga0496106_0078425 3300048909 Bacteria 2535
387 Ga0496108_0223940 3300048911 Unclassified 1634
388 Ga0496111_0092232 3300048914 Bacteria 2220
389 Ga0496112_0028605 3300048915 Bacteria 5381
390 Ga0496112_0035677 3300048915 Bacteria 4847
391 Ga0496112_0090606 3300048915 Bacteria 3027
392 Ga0496112_0110272 3300048915 Bacteria 2722
393 Ga0496112_0144760 3300048915 Bacteria 2345
394 Ga0496115_0001677 3300048918 Bacteria 15930
395 Ga0496116_0000058 3300048919 Bacteria 279767
396 Ga0496116_0000282 3300048919 Bacteria 87438
397 Ga0496116_0000521 3300048919 Bacteria 51818
398 Ga0496116_0000739 3300048919 Bacteria 41626
399 Ga0496116_0001084 3300048919 Bacteria 32785
400 Ga0496116_0007283 3300048919 Bacteria 9854
401 Ga0496116_0020140 3300048919 Bacteria 5075
402 Ga0496116_0020922 3300048919 Bacteria 4950
403 Ga0496117_0000450 3300048920 Bacteria 68428
404 Ga0496117_0000470 3300048920 Bacteria 66974
405 Ga0496117_0000830 3300048920 Bacteria 47853
406 Ga0496117_0001133 3300048920 Bacteria 40208
407 Ga0496117_0001270 3300048920 Bacteria 37430
408 Ga0496117_0006340 3300048920 Bacteria 12029
409 Ga0496117_0011036 3300048920 Bacteria 8135
410 Ga0496117_0018381 3300048920 Bacteria 5790
411 Ga0496118_0000490 3300048921 Bacteria 65592
412 Ga0496118_0002159 3300048921 Bacteria 27410
413 Ga0496118_0002301 3300048921 Bacteria 25935
414 Ga0496118_0004618 3300048921 Bacteria 16173
415 Ga0496118_0010354 3300048921 Bacteria 9239
416 Ga0496118_0010600 3300048921 Bacteria 9103
417 Ga0496118_0023219 3300048921 Bacteria 5392
418 Ga0496119_0000170 3300048922 Bacteria 91584
419 Ga0496119_0000219 3300048922 Bacteria 81203
420 Ga0496119_0000490 3300048922 Bacteria 53979
421 Ga0496119_0000680 3300048922 Bacteria 45409
422 Ga0496119_0000706 3300048922 Bacteria 44781
423 Ga0496119_0005425 3300048922 Bacteria 12228
424 Ga0496119_0006097 3300048922 Bacteria 11294
425 Ga0496119_0006499 3300048922 Bacteria 10795
426 Ga0496119_0006577 3300048922 Bacteria 10713
427 Ga0496119_0008481 3300048922 Bacteria 9019
428 Ga0496119_0009261 3300048922 Bacteria 8484
429 Ga0496120_0000108 3300048923 Bacteria 138566
430 Ga0496120_0000279 3300048923 Bacteria 85805
431 Ga0496120_0000301 3300048923 Bacteria 82406
432 Ga0496120_0000476 3300048923 Bacteria 62924
433 Ga0496120_0000813 3300048923 Bacteria 44710
434 Ga0496120_0001708 3300048923 Bacteria 25110
435 Ga0496120_0002528 3300048923 Bacteria 18270
436 Ga0496120_0003918 3300048923 Bacteria 12988
437 Ga0496120_0004377 3300048923 Bacteria 11905
438 Ga0496121_0000074 3300048924 Bacteria 243022
439 Ga0496121_0004066 3300048924 Bacteria 20091
440 Ga0496121_0007430 3300048924 Bacteria 13242
441 Ga0496121_0014648 3300048924 Bacteria 8292
442 Ga0496121_0021651 3300048924 Bacteria 6286
443 Ga0496121_0031269 3300048924 Bacteria 4865
444 Ga0496121_0036728 3300048924 Bacteria 4361
445 Ga0496122_0000467 3300048925 Bacteria 84380
446 Ga0496122_0000607 3300048925 Bacteria 73586
447 Ga0496122_0001119 3300048925 Bacteria 46163
448 Ga0496122_0001849 3300048925 Bacteria 32269
449 Ga0496122_0002360 3300048925 Bacteria 27157
450 Ga0496122_0003475 3300048925 Bacteria 20727
451 Ga0496123_0000322 3300048926 Bacteria 91507
452 Ga0496123_0000370 3300048926 Bacteria 84376
453 Ga0496123_0000451 3300048926 Bacteria 73603
454 Ga0496123_0000918 3300048926 Bacteria 46163
455 Ga0496123_0002061 3300048926 Bacteria 25933
456 Ga0496123_0002686 3300048926 Bacteria 21408
457 Ga0496123_0004991 3300048926 Bacteria 13591
458 Ga0496123_0011336 3300048926 Bacteria 7741
459 Ga0496123_0039168 3300048926 Bacteria 3318
460 Ga0496123_0076191 3300048926 Bacteria 2066
461 Ga0496124_0000304 3300048927 Bacteria 90806
462 Ga0496124_0000514 3300048927 Bacteria 66747
463 Ga0496124_0000583 3300048927 Bacteria 61571
464 Ga0496124_0002602 3300048927 Bacteria 23337
465 Ga0496124_0009646 3300048927 Bacteria 9888
466 Ga0496124_0019622 3300048927 Bacteria 6282
467 Ga0496124_0020453 3300048927 Bacteria 6112
468 Ga0496124_0036725 3300048927 Bacteria 4269
469 Ga0496125_0000534 3300048928 Bacteria 65468
470 Ga0496125_0000563 3300048928 Bacteria 63847
471 Ga0496125_0001797 3300048928 Bacteria 29634
472 Ga0496125_0002298 3300048928 Bacteria 25235
473 Ga0496125_0002977 3300048928 Bacteria 21285
474 Ga0496125_0024605 3300048928 Bacteria 5532
475 Ga0496126_0000648 3300048929 Bacteria 64533
476 Ga0496126_0009913 3300048929 Bacteria 10064
477 Ga0496126_0012282 3300048929 Bacteria 8788
478 Ga0496126_0015373 3300048929 Bacteria 7699
479 Ga0495678_000337 3300049459 Bacteria 49208
480 Ga0495682_0000139 3300049460 Bacteria 62814
481 nmdc:mga00v17_1593_c1 3300050491 Bacteria 11847
482 Ga0500621_000018 3300053126 Bacteria 80374
483 2506576165 2506520007 Bacteria 5442880
484 2506581303 2506520008 Bacteria 5443009
485 2508850134 2508501071 Bacteria 5454741
486 2511380459 2511231025 Bacteria 5324661
487 2511435569 2511231035 Bacteria 5341610
488 2538425110 2537561728 Bacteria 5149301
489 2545677610 2545555834 Bacteria 8130841
490 2547698525 2547132181 Bacteria 4945084
491 2555262463 2554235234 Bacteria 5762085
492 2562465375 2561511199 Bacteria 5155034
493 2585829012 2585427591 Bacteria 5482980
494 2585833783 2585427592 Bacteria 5370892
495 2596374988 2595698237 Bacteria 6712432
496 2599413413 2599185169 Bacteria 5441380
497 2599925161 2599185299 Bacteria 4854625
498 2601526159 2600255254 Bacteria 5281859
499 2601531189 2600255255 Bacteria 5282785
500 2601536430 2600255256 Bacteria 5597742
501 2601541795 2600255257 Bacteria 5597196
502 2601618051 2600255280 Bacteria 5292309
503 2601623085 2600255281 Bacteria 5288753
504 2601646438 2600255287 Bacteria 5210468
505 2601651441 2600255288 Bacteria 5282738
506 2601656499 2600255289 Bacteria 5281907
507 2601661403 2600255290 Bacteria 5282218
508 2601666462 2600255291 Bacteria 5217298
509 2601699421 2600255298 Bacteria 5215185
510 2601704333 2600255299 Bacteria 5218662
511 2601709272 2600255300 Bacteria 5287774
512 2601714294 2600255301 Bacteria 5280532
513 2601719356 2600255302 Bacteria 5288235
514 2601724242 2600255303 Bacteria 5219315
515 2601729250 2600255304 Bacteria 5283973
516 2601734275 2600255305 Bacteria 5282329
517 2601739262 2600255306 Bacteria 5281613
518 2601743965 2600255307 Bacteria 5439064
519 2601754800 2600255309 Bacteria 5431045
520 2601760161 2600255310 Bacteria 5600903
521 2601765557 2600255311 Bacteria 5598766
522 2602021979 2600255392 Bacteria 5437392
523 2603641595 2602042046 Bacteria 5483348
524 2603641764 2602042047 Bacteria 4697674
525 2603659200 2602042052 Bacteria 5215873
526 2603664093 2602042053 Bacteria 5214361
527 2603701445 2602042066 Bacteria 4423871
528 2603706808 2602042067 Bacteria 4863713
529 2603836622 2602042103 Bacteria 5284714
530 2603841728 2602042104 Bacteria 5281639
531 2603846799 2602042105 Bacteria 5282303
532 2603851844 2602042106 Bacteria 5282744
533 2603864792 2602042109 Bacteria 5152801
534 2603869418 2602042110 Bacteria 5283285
535 2603874693 2602042111 Bacteria 5212080
536 2606046628 2603880178 Bacteria 5283018
537 2606068496 2603880184 Bacteria 5217896
538 2606144301 2603880202 Bacteria 5284684
539 2606174492 2603880211 Bacteria 5284226
540 2608671363 2608642108 Bacteria 4104624
541 2609914200 2609459761 Bacteria 5513740
542 2637227714 2636415599 Bacteria 5718434
543 2650897276 2648501693 Bacteria 5069560
544 2656277215 2654587920 Bacteria 5475511
545 2671105821 2667528172 Bacteria 5170840
546 2671110349 2667528173 Bacteria 5375747
547 2671588213 2671180115 Bacteria 5353919
548 2676410188 2675903046 Bacteria 5451247
549 2681995194 2681812866 Bacteria 4552357
550 2682009998 2681812869 Bacteria 5014465
551 2686356234 2684622997 Bacteria 4624240
552 2689442596 2687453601 Bacteria 5546041
553 2707100907 2706794495 Bacteria 4536932
554 2712471589 2711768156 Bacteria 4471618
555 2738743151 2738541281 Bacteria 5112672
556 2739352768 2738543032 Bacteria 5115625
557 2753858051 2751185917 Bacteria 4551186
558 2765591217 2765235842 Bacteria 4799256
559 2772436740 2772190666 Bacteria 5117644
560 2775538418 2775506706 Bacteria 4873073
561 2777024309 2775507074 Bacteria 5532402
562 2791923175 2791354903 Bacteria 4937680
563 2792314570 2791355010 Bacteria 4864581
564 2793403532 2791355275 Bacteria 4429597
565 2807179016 2806310673 Bacteria 4801221
566 2809126599 2808606414 Bacteria 4917181
567 2813731187 2811995292 Bacteria 5303342
568 2814698878 2814123068 Bacteria 5687681
569 2821122993 2821118458 Bacteria 4714306
570 2823378518 2823373977 Bacteria 4779415
571 2829746408 2829745981 Bacteria 5406054
572 2842700430 2842698319 Bacteria 5190321
573 2844429559 2844425489 Bacteria 4854065
574 2844531907 2844528606 Bacteria 4733806
575 2846544576 2846540461 Bacteria 5471451
576 2847089602 2847085930 Bacteria 5070450
577 2847801896 2847797336 Bacteria 5176640
578 2852104315 2852103415 Bacteria 5193810
579 2854603340 2854601825 Bacteria 4797592
580 2855199036 2855195626 Bacteria 4927512
581 2858466793 2858466076 Bacteria 4722413
582 2861692983 2861691609 Bacteria 5628931
583 2865018707 2865014394 Bacteria 4764573
584 2869552010 2869551831 Bacteria 5474685
585 2871274958 2871272651 Bacteria 5042015
586 2871282486 2871282230 Bacteria 4917173
587 2876603391 2876601092 Bacteria 5114497
588 2881611522 2881609920 Bacteria 4405319
589 2884091020 2884086401 Bacteria 5005459
590 2888366788 2888366609 Bacteria 5155009
591 2888375573 2888373701 Bacteria 5098052
592 2889311889 2889306138 Bacteria 6358934
593 2891673341 2891670763 Bacteria 4967099
594 2902335042 2902330777 Bacteria 6395352
595 2902411383 2902405164 Bacteria 6784948
596 2904478769 2904474040 Bacteria 5504324
597 2904518428 2904513164 Bacteria 5476410
598 2908674557 2908669403 Bacteria 5740494
599 2919113791 2919108558 Bacteria 5897419
600 2919154877 2919150387 Bacteria 5500879
601 2923637077 2923634449 Bacteria 4753480
602 2927148461 2927143783 Bacteria 5504251
603 2927836480 2927833300 Bacteria 4923934
604 2928129911 2928125067 Bacteria 5937560
605 2932409054 2932406140 Bacteria 5134491
606 2935630065 2935625433 Bacteria 5042964
607 2937540958 2937539931 Bacteria 4639830
608 2937971471 2937967321 Bacteria 5094075
609 2939572919 2939568625 Bacteria 4542555
610 2939577682 2939573065 Bacteria 4926053
611 2939581642 2939577877 Bacteria 5132791
612 2939605098 2939602548 Bacteria 4950493
613 2939611825 2939607340 Bacteria 4719256
614 2939622239 2939617950 Bacteria 4820956
615 2939646895 2939642701 Bacteria 4475280
616 2945874994 2945874760 Bacteria 5527237
617 2945954779 2945951305 Bacteria 4918162
618 2969084755 2969079654 Bacteria 5439582
619 2971826281 2971820967 Bacteria 5823634
620 2974314550 2974310843 Bacteria 4947816
621 2974436419 2974435778 Bacteria 4876478
622 2978977269 2978975091 Bacteria 4704313
623 2984498660 2984494565 Bacteria 5000175
624 2984561876 2984559226 Bacteria 5683096
625 2984599942 2984595703 Bacteria 5682994
626 2990264135 2990261002 Bacteria 4919493
627 3000376648 3000376612 Bacteria 4705565
628 3003667325 3003665799 Bacteria 7279786
629 640935684 640753048 Bacteria 5495657
630 641640347 641522639 Bacteria 7737025
631 643597784 643348564 Bacteria 8839022
632 8004593523 8004592986 Bacteria 5122074
633 8015397384 8015394850 Bacteria 5064660
634 8016737732 8016733728 Bacteria 5274317
635 8018224087 8018221730 Bacteria 4616064
636 8018405487 8018405270 Bacteria 4978981
637 8019503558 8019499862 Bacteria 5169538
638 8019509099 8019504834 Bacteria 4819156
639 8054845320 8054844752 Bacteria 4450330
640 8054850295 8054849141 Bacteria 5232694
641 8055090266 8055087960 Bacteria 4784273
642 8055093508 8055092621 Bacteria 4873875
643 8055098018 8055097453 Bacteria 4865496
644 8055694136 8055693939 Bacteria 4772047
645 8057305390 8057304971 Bacteria 4649742
646 JGI24035J26624_1000858
647 RicEn_C1615
648 SwRhRL2b_contig_1995509
649 JGI24739J22299_10000016
650 JGI25162J39368_1002393
651 JGI25163J39215_1000498
652 JGI25164J39214_1000152
653 JGI25406J46586_10003544
654 rootH2_10019123
655 Ga0055538_1000109
656 Ga0055539_1000158
657 Ga0055533_1000160
658 Ga0055525_1000212
659 Ga0055541_1000104
660 Ga0058692_1000145
661 Ga0058692_1000179
662 Ga0058692_1000253
663 Ga0058692_1000310
664 Ga0058692_1002097
665 Ga0058692_1005063
666 Ga0058692_1007644
667 Ga0065703_1019144
668 Ga0065704_10000450
669 Ga0065704_10000585
670 Ga0065704_10001072
671 Ga0065704_10002167
672 Ga0065704_10005603
673 Ga0065704_10083086
674 Ga0070676_10005504
675 Ga0070670_100010316
676 Ga0070666_10023541
677 Ga0068868_100052483
678 Ga0070668_100010851
679 Ga0070668_100021156
680 Ga0070668_100039810
681 Ga0070675_100003479
682 Ga0070675_100022432
683 Ga0070671_100035869
684 Ga0070673_100066345
685 Ga0070688_100003336
686 Ga0070688_100015592
687 Ga0070659_100005733
688 Ga0070659_100080418
689 Ga0070713_100003711
690 Ga0070705_100022371
691 Ga0070694_100006030
692 Ga0070708_100015332
693 Ga0070708_100042870
694 Ga0070663_100025838
695 Ga0070662_100001198
696 Ga0070662_100007716
697 Ga0068867_100027221
698 Ga0070706_100000012
699 Ga0070706_100026830
700 Ga0070706_100089304
701 Ga0070707_100000171
702 Ga0070707_100018012
703 Ga0070707_100025810
704 Ga0070707_100037533
705 Ga0070707_100091331
706 Ga0070698_100005853
707 Ga0070698_100006464
708 Ga0070698_100062816
709 Ga0070699_100055669
710 Ga0070699_100072436
711 Ga0070679_100174921
712 Ga0070684_100047194
713 Ga0070697_100004109
714 Ga0070697_100014242
715 Ga0070697_100055773
716 Ga0070697_100107827
717 Ga0070696_100035227
718 Ga0070665_100001124
719 Ga0070665_100022483
720 Ga0070665_100024927
721 Ga0070704_100031976
722 Ga0070704_100075021
723 Ga0068857_100000028
724 Ga0068851_10002655
725 Ga0068863_100003673
726 Ga0068858_100014781
727 Ga0068860_100026107
728 Ga0081455_10001011
729 Ga0081455_10007739
730 Ga0081455_10008751
731 Ga0081455_10012591
732 Ga0081540_1000368
733 Ga0081539_10001203
734 Ga0081539_10001276
735 Ga0081539_10012531
736 Ga0070717_10012684
737 Ga0075364_10006318
738 Ga0075364_10033505
739 Ga0097621_100005446
740 Ga0079104_1000254
741 Ga0079104_1000335
742 Ga0079104_1000356
743 Ga0079104_1000694
744 Ga0079104_1001489
745 Ga0079104_1002151
746 Ga0079104_1003593
747 Ga0079104_1004611
748 Ga0079104_1011435
749 Ga0105251_10000386
750 Ga0105251_10000533
751 Ga0105251_10001068
752 Ga0105251_10002401
753 Ga0105251_10006416
754 Ga0105251_10015539
755 Ga0105251_10021855
756 Ga0105251_10022048
757 Ga0105244_10000103
758 Ga0105244_10000516
759 Ga0105244_10000539
760 Ga0105244_10000551
761 Ga0105244_10000566
762 Ga0105244_10000844
763 Ga0105244_10005549
764 Ga0105244_10005895
765 Ga0105244_10010070
766 Ga0105244_10011769
767 Ga0105250_10000205
768 Ga0105250_10000217
769 Ga0105250_10002873
770 Ga0105240_10058281
771 Ga0114129_10083246
772 Ga0114129_10121920
773 Ga0105243_10000658
774 Ga0105243_10005793
775 Ga0105241_10000010
776 Ga0105239_10071650
777 Ga0105246_10008080
778 Ga0105246_10013548
779 Ga0157373_10000114
780 Ga0157373_10012149
781 Ga0157373_10013005
782 Ga0157373_10058475
783 Ga0157371_10000102
784 Ga0157371_10000554
785 Ga0157371_10000577
786 Ga0157371_10000835
787 Ga0157371_10007860
788 Ga0157371_10028386
789 Ga0157370_10000356
790 Ga0157370_10000444
791 Ga0157370_10001839
792 Ga0157369_10000452
793 Ga0157369_10018575
794 Ga0157374_10020242
795 Ga0157374_10051179
796 Ga0157378_10016372
797 Ga0163162_10017090
798 Ga0163162_10088738
799 Ga0157372_10000094
800 Ga0157372_10016801
801 Ga0157372_10115647
802 Ga0157375_10005291
803 Ga0182008_10001384
804 Ga0157379_10012858
805 Ga0182006_1000009
806 Ga0182006_1016027
807 Ga0182007_10008670
808 Ga0183366_1009
809 Ga0183370_1009
810 Ga0183369_1024
811 Ga0183368_1012
812 Ga0163161_10000006
813 Ga0213876_10000106
814 Ga0209760_100370
815 Ga0209784_100064
816 Ga0209566_100079
817 Ga0209674_100194
818 Ga0209563_100152
819 Ga0207427_100181
820 Ga0209437_100092
821 Ga0209437_100149
822 Ga0209677_100148
823 Ga0209129_1000179
824 Ga0209233_1003969
825 Ga0209050_1001319
826 Ga0207697_10000080
827 Ga0207697_10000565
828 Ga0207697_10001605
829 Ga0207697_10001735
830 Ga0207697_10001989
831 Ga0207656_10002534
832 Ga0207696_1000046
833 Ga0207696_1000331
834 Ga0207696_1000347
835 Ga0207696_1000404
836 Ga0207696_1000414
837 Ga0207696_1000434
838 Ga0207696_1000534
839 Ga0207696_1000590
840 Ga0207696_1011496
841 Ga0207655_1000111
842 Ga0207655_1000170
843 Ga0207655_1000208
844 Ga0207655_1000245
845 Ga0207655_1000393
846 Ga0207655_1000547
847 Ga0207655_1000583
848 Ga0207655_1001676
849 Ga0207655_1002339
850 Ga0207655_1003418
851 Ga0207655_1004465
852 Ga0207655_1004584
853 Ga0207655_1009735
854 Ga0207655_1015135
855 Ga0207713_1000045
856 Ga0207713_1000056
857 Ga0207713_1000075
858 Ga0207713_1000334
859 Ga0207713_1000340
860 Ga0207713_1000368
861 Ga0207713_1000613
862 Ga0207713_1005588
863 Ga0207713_1005810
864 Ga0207713_1012005
865 Ga0207710_10000024
866 Ga0207685_10013631
867 Ga0207699_10042974
868 Ga0207645_10001266
869 Ga0207684_10000028
870 Ga0207654_10000010
871 Ga0207693_10022979
872 Ga0207663_10049848
873 Ga0207652_10144812
874 Ga0207646_10000750
875 Ga0207646_10005961
876 Ga0207659_10054359
877 Ga0207700_10041392
878 Ga0207700_10045799
879 Ga0207700_10062244
880 Ga0207644_10019694
881 Ga0207690_10054702
882 Ga0207706_10000188
883 Ga0207706_10006159
884 Ga0207706_10022047
885 Ga0207709_10000428
886 Ga0207709_10008436
887 Ga0207691_10013604
888 Ga0207689_10037124
889 Ga0207668_10018622
890 Ga0207658_10017639
891 Ga0207678_10033857
892 Ga0207648_10014539
893 Ga0207674_10000367
894 Ga0207675_100019738
895 Ga0207675_100032043
896 Ga0207683_10017568
897 Ga0207683_10040438
898 Ga0209281_1000139
899 Ga0209281_1000285
900 Ga0209281_1000305
901 Ga0209281_1000312
902 Ga0209281_1000326
903 Ga0209281_1000341
904 Ga0209281_1000497
905 Ga0209281_1000794
906 Ga0209281_1000867
907 Ga0209281_1001035
908 Ga0209281_1002561
909 Ga0209371_1000063
910 Ga0209371_1000068
911 Ga0209371_1000071
912 Ga0209371_1000201
913 Ga0209371_1000210
914 Ga0209371_1000299
915 Ga0209371_1000323
916 Ga0209371_1000331
917 Ga0209371_1000429
918 Ga0209371_1000617
919 Ga0209371_1001510
920 Ga0209371_1001732
921 Ga0209371_1002324
922 Ga0209371_1003334
923 Ga0209371_1003829
924 Ga0209371_1008231
925 Ga0268266_10000295
926 Ga0268266_10011374
927 Ga0268266_10026318
928 Ga0268264_10081321
929 Ga0268256_1000060
930 Ga0268256_1000064
931 Ga0268256_1000070
932 Ga0268256_1000166
933 Ga0268256_1000284
934 Ga0268256_1000386
935 Ga0268256_1000720
936 Ga0268256_1000769
937 Ga0268256_1000995
938 Ga0268256_1001510
939 Ga0268256_1002953
940 Ga0268256_1003033
941 Ga0268256_1003255
942 Ga0268256_1008520
943 Ga0268256_1010641
944 Ga0373947_0047516
945 Ga0395899_0053566
946 Ga0395900_0004913
947 Ga0395900_0191703
948 Ga0395901_0103143
949 Ga0436365_0083358
950 Ga0439438_000014
951 Ga0439438_001432
952 Ga0439447_001628
953 Ga0439447_002527
954 Ga0439466_0000008
955 Ga0439432_003818
956 Ga0439432_012497
957 Ga0439452_000010
958 Ga0439452_000023
959 Ga0439452_000067
960 Ga0439452_000092
961 Ga0439452_000103
962 Ga0439452_000160
963 Ga0450907_000030
964 Ga0439464_0002326
965 Ga0439464_0002690
966 Ga0451577_0000018
967 Ga0451577_0000193
968 Ga0451577_0001262
969 Ga0451577_0003489
970 Ga0466981_0000022
971 Ga0453684_0000090
972 Ga0453684_0000166
973 Ga0453684_0006193
974 Ga0453684_0084749
975 Ga0453684_0091396
976 Ga0451576_0001179
977 Ga0495627_001403
978 Ga0495591_000031
979 Ga0495591_000148
980 Ga0495591_002347
981 Ga0495591_003527
982 Ga0495650_0000199
983 Ga0495650_0000360
984 Ga0495650_0000418
985 Ga0495605_0010666
986 Ga0495584_0005890
987 Ga0495596_0003622
988 Ga0495607_0002720
989 Ga0495606_0000541
990 Ga0495620_0025189
991 Ga0495644_0008348
992 Ga0495648_0002122
993 Ga0495648_0015539
994 Ga0495654_0000040
995 Ga0495654_0000519
996 Ga0495654_0001042
997 Ga0495597_0004190
998 Ga0495625_0040316
999 Ga0495588_0003426
1000 Ga0495669_0036697
1001 Ga0495671_0004850
1002 Ga0495649_0009979
1003 Ga0495649_0013129
1004 Ga0495589_0000274
1005 Ga0495589_0004351
1006 Ga0495660_0000045
1007 Ga0495660_0000134
1008 Ga0495672_0000083
1009 Ga0495672_0000224
1010 Ga0495672_0000225
1011 Ga0495679_000178
1012 Ga0495679_002253
1013 Ga0495679_004186
1014 Ga0495673_0000216
1015 Ga0495673_0000622
1016 Ga0496100_0013822
1017 Ga0496100_0033456
1018 Ga0496100_0044670
1019 Ga0496101_0000119
1020 Ga0496101_0027293
1021 Ga0496101_0036427
1022 Ga0496102_0012173
1023 Ga0496102_0109050
1024 Ga0496103_0047363
1025 Ga0496104_0002540
1026 Ga0496104_0043728
1027 Ga0496104_0135936
1028 Ga0496105_0003574
1029 Ga0496105_0033590
1030 Ga0496105_0087023
1031 Ga0496106_0078425
1032 Ga0496108_0223940
1033 Ga0496111_0092232
1034 Ga0496112_0028605
1035 Ga0496112_0035677
1036 Ga0496112_0090606
1037 Ga0496112_0110272
1038 Ga0496112_0144760
1039 Ga0496115_0001677
1040 Ga0496116_0000058
1041 Ga0496116_0000282
1042 Ga0496116_0000521
1043 Ga0496116_0000739
1044 Ga0496116_0001084
1045 Ga0496116_0007283
1046 Ga0496116_0020140
1047 Ga0496116_0020922
1048 Ga0496117_0000450
1049 Ga0496117_0000470
1050 Ga0496117_0000830
1051 Ga0496117_0001133
1052 Ga0496117_0001270
1053 Ga0496117_0006340
1054 Ga0496117_0011036
1055 Ga0496117_0018381
1056 Ga0496118_0000490
1057 Ga0496118_0002159
1058 Ga0496118_0002301
1059 Ga0496118_0004618
1060 Ga0496118_0010354
1061 Ga0496118_0010600
1062 Ga0496118_0023219
1063 Ga0496119_0000170
1064 Ga0496119_0000219
1065 Ga0496119_0000490
1066 Ga0496119_0000680
1067 Ga0496119_0000706
1068 Ga0496119_0005425
1069 Ga0496119_0006097
1070 Ga0496119_0006499
1071 Ga0496119_0006577
1072 Ga0496119_0008481
1073 Ga0496119_0009261
1074 Ga0496120_0000108
1075 Ga0496120_0000279
1076 Ga0496120_0000301
1077 Ga0496120_0000476
1078 Ga0496120_0000813
1079 Ga0496120_0001708
1080 Ga0496120_0002528
1081 Ga0496120_0003918
1082 Ga0496120_0004377
1083 Ga0496121_0000074
1084 Ga0496121_0004066
1085 Ga0496121_0007430
1086 Ga0496121_0014648
1087 Ga0496121_0021651
1088 Ga0496121_0031269
1089 Ga0496121_0036728
1090 Ga0496122_0000467
1091 Ga0496122_0000607
1092 Ga0496122_0001119
1093 Ga0496122_0001849
1094 Ga0496122_0002360
1095 Ga0496122_0003475
1096 Ga0496123_0000322
1097 Ga0496123_0000370
1098 Ga0496123_0000451
1099 Ga0496123_0000918
1100 Ga0496123_0002061
1101 Ga0496123_0002686
1102 Ga0496123_0004991
1103 Ga0496123_0011336
1104 Ga0496123_0039168
1105 Ga0496123_0076191
1106 Ga0496124_0000304
1107 Ga0496124_0000514
1108 Ga0496124_0000583
1109 Ga0496124_0002602
1110 Ga0496124_0009646
1111 Ga0496124_0019622
1112 Ga0496124_0020453
1113 Ga0496124_0036725
1114 Ga0496125_0000534
1115 Ga0496125_0000563
1116 Ga0496125_0001797
1117 Ga0496125_0002298
1118 Ga0496125_0002977
1119 Ga0496125_0024605
1120 Ga0496126_0000648
1121 Ga0496126_0009913
1122 Ga0496126_0012282
1123 Ga0496126_0015373
1124 Ga0495678_000337
1125 Ga0495682_0000139
1126 nmdc:mga00v17_1593_c1
1127 Ga0500621_000018
1128 2506576165
1129 2506581303
1130 2508850134
1131 2511380459
1132 2511435569
1133 2538425110
1134 2545677610
1135 2547698525
1136 2555262463
1137 2562465375
1138 2585829012
1139 2585833783
1140 2596374988
1141 2599413413
1142 2599925161
1143 2601526159
1144 2601531189
1145 2601536430
1146 2601541795
1147 2601618051
1148 2601623085
1149 2601646438
1150 2601651441
1151 2601656499
1152 2601661403
1153 2601666462
1154 2601699421
1155 2601704333
1156 2601709272
1157 2601714294
1158 2601719356
1159 2601724242
1160 2601729250
1161 2601734275
1162 2601739262
1163 2601743965
1164 2601754800
1165 2601760161
1166 2601765557
1167 2602021979
1168 2603641595
1169 2603641764
1170 2603659200
1171 2603664093
1172 2603701445
1173 2603706808
1174 2603836622
1175 2603841728
1176 2603846799
1177 2603851844
1178 2603864792
1179 2603869418
1180 2603874693
1181 2606046628
1182 2606068496
1183 2606144301
1184 2606174492
1185 2608671363
1186 2609914200
1187 2637227714
1188 2650897276
1189 2656277215
1190 2671105821
1191 2671110349
1192 2671588213
1193 2676410188
1194 2681995194
1195 2682009998
1196 2686356234
1197 2689442596
1198 2707100907
1199 2712471589
1200 2738743151
1201 2739352768
1202 2753858051
1203 2765591217
1204 2772436740
1205 2775538418
1206 2777024309
1207 2791923175
1208 2792314570
1209 2793403532
1210 2807179016
1211 2809126599
1212 2813731187
1213 2814698878
1214 2821122993
1215 2823378518
1216 2829746408
1217 2842700430
1218 2844429559
1219 2844531907
1220 2846544576
1221 2847089602
1222 2847801896
1223 2852104315
1224 2854603340
1225 2855199036
1226 2858466793
1227 2861692983
1228 2865018707
1229 2869552010
1230 2871274958
1231 2871282486
1232 2876603391
1233 2881611522
1234 2884091020
1235 2888366788
1236 2888375573
1237 2889311889
1238 2891673341
1239 2902335042
1240 2902411383
1241 2904478769
1242 2904518428
1243 2908674557
1244 2919113791
1245 2919154877
1246 2923637077
1247 2927148461
1248 2927836480
1249 2928129911
1250 2932409054
1251 2935630065
1252 2937540958
1253 2937971471
1254 2939572919
1255 2939577682
1256 2939581642
1257 2939605098
1258 2939611825
1259 2939622239
1260 2939646895
1261 2945874994
1262 2945954779
1263 2969084755
1264 2971826281
1265 2974314550
1266 2974436419
1267 2978977269
1268 2984498660
1269 2984561876
1270 2984599942
1271 2990264135
1272 3000376648
1273 3003667325
1274 640935684
1275 641640347
1276 643597784
1277 8004593523
1278 8015397384
1279 8016737732
1280 8018224087
1281 8018405487
1282 8019503558
1283 8019509099
1284 8054845320
1285 8054850295
1286 8055090266
1287 8055093508
1288 8055098018
1289 8055694136
1290 8057305390

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00570

HRDC

HRDC domain

538

605

0.96

PF09382

RQC

RQC domain

409

526

0.94

PF16124

RecQ_Zn_bind

RecQ zinc-binding

332

407

0.94

PF00271

Helicase_C

Helicase conserved C-terminal domain

212

321

0.92

PF14493

HTH_40

Helix-turn-helix domain

635

724

0.92

PF00270

DEAD

DEAD/DEAH box helicase

17

181

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 1.001 530 606
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 0.9886 530 606
1oyw-assembly1.cif.gz_A structure of the recq catalytic core 0.9751 8 516
1oyy-assembly1.cif.gz_A structure of the recq catalytic core bound to atp-gamma-s 0.9676 1 516
1oyy-assembly1.cif.gz_A structure of the recq catalytic core bound to atp-gamma-s 0.9657 1 516
ID Description Score Start End Superfamily
1oywA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9809 8 207 3.40.50.300
af_A0A1D6HM55_7_223_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9781 11 209 3.40.50.300
af_A0A1D6H058_407_632_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 13 209 3.40.50.300
af_A0A1D6PNE9_185_410_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9716 13 209 3.40.50.300
1oywA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9715 341 516 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7C7LQR3-F1-model_v4 ATP-dependent DNA helicase RecQ (EC 5.6.2.4) (DNA 3'-5' helicase RecQ) 0.9685 13 368 GO:0003676
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0030894
GO:0043138
GO:0043590
AF-A0A832MV41-F1-model_v4 ATP-dependent DNA helicase RecQ (EC 5.6.2.4) (DNA 3'-5' helicase RecQ) 0.9659 13 357 GO:0003676
GO:0005524
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0030894
GO:0043138
GO:0043590
AF-A0A0S7H1A3-F1-model_v4 deleted 0.9586 47 406
AF-A0A7G7WNI0-F1-model_v4 ATP-dependent DNA helicase (EC 5.6.2.4) 0.9564 9 406 GO:0000724
GO:0003676
GO:0005524
GO:0005634
GO:0005694
GO:0005737
GO:0006268
GO:0006355
GO:0009378
GO:0016787
GO:0036121
GO:0061749
GO:1990518
AF-A0A7V9FI46-F1-model_v4 ATP-dependent DNA helicase RecQ (EC 5.6.2.4) (DNA 3'-5' helicase RecQ) 0.9499 8 340 GO:0003676
GO:0005524
GO:0005694
GO:0005737
GO:0006281
GO:0006310
GO:0009378
GO:0016787
GO:0043138

Map