F472117

General Info

Members Datasets Scaffolds Average Seq Length
645 190 645 306

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100153718|Ga0068862_1001537182
Length 346
Sequence MFARAAFASLLLATAATAQFTIPLGKAPRQIERPIHPLEEWGPLWAKACGDSTDWDRPAPPVRIHGNTYLVGTCGISAILVTGDEGHVLIDAGTERGADLIADNIRELGFKLSDIKYLLISHEHFDHVGGAARLQQLTGATLVTSAPAEKVLNSGVPSTDDPQSGMHKPFPAANVGRVVGDGSEVRFGNLLLTAITTPGHTPGALSWRWESCDGGVCRTMVYADSLTPISRDDYRFSDHPEYLAAYRASIAKIAAGRCEILLTPHPSASAMKERMTGKLPLFDLDGCKKYAARVSNMLDERLAKEATPPRNGEGDHSTDGGGVDKAASTPPSALRAATSPFRGGAN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.48
Rhizosphere 97.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002302 3300001979 Bacteria 8686
2 JGI24740J21852_10021054 3300001979 Bacteria 2265
3 JGI24739J22299_10000793 3300001989 Bacteria 11546
4 JGI24737J22298_10000350 3300001990 Bacteria 15509
5 JGI24737J22298_10006127 3300001990 Bacteria 4119
6 JGI24735J21928_10001840 3300002067 Bacteria 7442
7 JGI24738J21930_10000467 3300002075 Bacteria 11481
8 JGI24738J21930_10008252 3300002075 Bacteria 2373
9 JGI24034J26672_10001073 3300002239 Bacteria 3576
10 Ga0065715_10013711 3300005293 Bacteria 3361
11 Ga0070658_10000876 3300005327 Bacteria 25753
12 Ga0070658_10013311 3300005327 Bacteria 6601
13 Ga0070658_10039100 3300005327 Bacteria 3826
14 Ga0070658_10068348 3300005327 Bacteria 2904
15 Ga0070658_10124540 3300005327 Bacteria 2144
16 Ga0070658_10166062 3300005327 Bacteria 1853
17 Ga0070658_10218306 3300005327 Bacteria 1612
18 Ga0070658_10262229 3300005327 Bacteria 1468
19 Ga0070676_10000734 3300005328 Bacteria 16070
20 Ga0070676_10003403 3300005328 Bacteria 8279
21 Ga0070676_10392890 3300005328 Bacteria 963
22 Ga0070683_100086759 3300005329 Bacteria 2934
23 Ga0070683_100125044 3300005329 Bacteria 2431
24 Ga0070690_100012570 3300005330 Bacteria 4982
25 Ga0070670_100004152 3300005331 Bacteria 12112
26 Ga0070670_100020507 3300005331 Bacteria 5683
27 Ga0070670_100030540 3300005331 Bacteria 4640
28 Ga0070670_100034246 3300005331 Bacteria 4371
29 Ga0070670_100072317 3300005331 Bacteria 2961
30 Ga0070670_100086806 3300005331 Bacteria 2688
31 Ga0070670_100149130 3300005331 Bacteria 2024
32 Ga0070670_100338527 3300005331 Bacteria 1320
33 Ga0070677_10009258 3300005333 Bacteria 3336
34 Ga0070677_10098019 3300005333 Bacteria 1287
35 Ga0068869_100000074 3300005334 Bacteria 45153
36 Ga0070666_10005823 3300005335 Bacteria 7573
37 Ga0070666_10087949 3300005335 Bacteria 2130
38 Ga0070666_10107565 3300005335 Bacteria 1927
39 Ga0070680_100165227 3300005336 Unclassified 1861
40 Ga0070682_100095638 3300005337 Bacteria 1951
41 Ga0068868_100000398 3300005338 Bacteria 29556
42 Ga0070660_100000487 3300005339 Bacteria 26540
43 Ga0070660_100014181 3300005339 Bacteria 5739
44 Ga0070660_100094162 3300005339 Bacteria 2366
45 Ga0070660_100295632 3300005339 Bacteria 1327
46 Ga0070689_100386805 3300005340 Bacteria 1180
47 Ga0070691_10029852 3300005341 Bacteria 2552
48 Ga0070687_100123771 3300005343 Bacteria 1483
49 Ga0070661_100036486 3300005344 Bacteria 3573
50 Ga0070661_100054274 3300005344 Bacteria 2935
51 Ga0070661_100229742 3300005344 Bacteria 1425
52 Ga0070661_100269215 3300005344 Bacteria 1319
53 Ga0070692_10002031 3300005345 Bacteria 7689
54 Ga0070668_100004873 3300005347 Bacteria 9944
55 Ga0070668_100005256 3300005347 Bacteria 9604
56 Ga0070668_100465013 3300005347 Bacteria 1090
57 Ga0070669_100000197 3300005353 Bacteria 52472
58 Ga0070669_100010130 3300005353 Bacteria 6704
59 Ga0070669_100052853 3300005353 Bacteria 2973
60 Ga0070669_100222893 3300005353 Bacteria 1491
61 Ga0070669_100243675 3300005353 Bacteria 1429
62 Ga0070669_100328651 3300005353 Bacteria 1236
63 Ga0070675_100001671 3300005354 Bacteria 16350
64 Ga0070675_100012981 3300005354 Bacteria 6541
65 Ga0070675_100013376 3300005354 Bacteria 6450
66 Ga0070675_100014143 3300005354 Bacteria 6290
67 Ga0070675_100019757 3300005354 Bacteria 5372
68 Ga0070675_100137479 3300005354 Bacteria 2086
69 Ga0070675_100212663 3300005354 Bacteria 1681
70 Ga0070671_100010345 3300005355 Bacteria 7484
71 Ga0070671_100012902 3300005355 Bacteria 6736
72 Ga0070671_100029594 3300005355 Bacteria 4516
73 Ga0070671_100042665 3300005355 Bacteria 3770
74 Ga0070671_100302946 3300005355 Unclassified 1361
75 Ga0070674_100086676 3300005356 Bacteria 2250
76 Ga0070674_100091528 3300005356 Bacteria 2197
77 Ga0070674_100166429 3300005356 Bacteria 1677
78 Ga0070673_100000899 3300005364 Bacteria 16794
79 Ga0070673_100082937 3300005364 Bacteria 2603
80 Ga0070673_100154949 3300005364 Bacteria 1943
81 Ga0070659_100000791 3300005366 Bacteria 23054
82 Ga0070659_100001985 3300005366 Bacteria 14617
83 Ga0070659_100010425 3300005366 Bacteria 6834
84 Ga0070659_100019139 3300005366 Bacteria 5181
85 Ga0070659_100023457 3300005366 Bacteria 4721
86 Ga0070659_100024119 3300005366 Bacteria 4662
87 Ga0070659_100043914 3300005366 Bacteria 3497
88 Ga0070659_100065219 3300005366 Bacteria 2884
89 Ga0070659_100075882 3300005366 Bacteria 2680
90 Ga0070667_100000876 3300005367 Bacteria 27838
91 Ga0070667_100031405 3300005367 Bacteria 4430
92 Ga0070667_100038852 3300005367 Bacteria 3990
93 Ga0070667_100052950 3300005367 Bacteria 3425
94 Ga0070714_100035653 3300005435 Bacteria 4170
95 Ga0070714_100045874 3300005435 Bacteria 3706
96 Ga0070701_10032861 3300005438 Bacteria 2587
97 Ga0070705_100331199 3300005440 Bacteria 1103
98 Ga0070663_100041092 3300005455 Bacteria 3241
99 Ga0070663_100080086 3300005455 Bacteria 2398
100 Ga0070663_100221703 3300005455 Unclassified 1485
101 Ga0070678_100022762 3300005456 Bacteria 4160
102 Ga0070678_100050997 3300005456 Bacteria 2997
103 Ga0070662_100000334 3300005457 Bacteria 28255
104 Ga0070662_100007905 3300005457 Bacteria 6915
105 Ga0070662_100011566 3300005457 Bacteria 5823
106 Ga0070662_100018282 3300005457 Bacteria 4740
107 Ga0070662_100032417 3300005457 Bacteria 3672
108 Ga0070662_100042995 3300005457 Bacteria 3230
109 Ga0070662_100071950 3300005457 Bacteria 2551
110 Ga0070662_100080348 3300005457 Bacteria 2427
111 Ga0070662_100112261 3300005457 Bacteria 2078
112 Ga0070662_100433434 3300005457 Bacteria 1089
113 Ga0070681_10040275 3300005458 Bacteria 4682
114 Ga0068867_100000836 3300005459 Bacteria 20707
115 Ga0068867_100090577 3300005459 Bacteria 2320
116 Ga0068867_100283251 3300005459 Bacteria 1360
117 Ga0070679_100024934 3300005530 Bacteria 5864
118 Ga0070679_100096843 3300005530 Bacteria 2938
119 Ga0070679_100149972 3300005530 Bacteria 2309
120 Ga0070679_100249135 3300005530 Bacteria 1733
121 Ga0070679_100253036 3300005530 Bacteria 1717
122 Ga0070684_100351839 3300005535 Unclassified 1355
123 Ga0068853_100004030 3300005539 Bacteria 11300
124 Ga0068853_100040493 3300005539 Bacteria 3975
125 Ga0068853_100048087 3300005539 Bacteria 3662
126 Ga0068853_100097434 3300005539 Bacteria 2596
127 Ga0068853_100166676 3300005539 Bacteria 1991
128 Ga0068853_100402036 3300005539 Unclassified 1282
129 Ga0068853_100471468 3300005539 Bacteria 1183
130 Ga0070672_100000227 3300005543 Bacteria 31347
131 Ga0070672_100001472 3300005543 Bacteria 14619
132 Ga0070672_100270631 3300005543 Bacteria 1434
133 Ga0070696_100016330 3300005546 Bacteria 4997
134 Ga0070693_100037979 3300005547 Bacteria 2689
135 Ga0070665_100065609 3300005548 Bacteria 3641
136 Ga0070665_100066840 3300005548 Bacteria 3606
137 Ga0070665_100136561 3300005548 Bacteria 2455
138 Ga0070665_100277481 3300005548 Bacteria 1678
139 Ga0068855_100001413 3300005563 Bacteria 29812
140 Ga0068855_100025484 3300005563 Bacteria 7074
141 Ga0068855_100061293 3300005563 Bacteria 4396
142 Ga0068855_100527692 3300005563 Bacteria 1280
143 Ga0070664_100050108 3300005564 Bacteria 3533
144 Ga0070664_100067183 3300005564 Bacteria 3064
145 Ga0070664_100069100 3300005564 Bacteria 3022
146 Ga0070664_100153530 3300005564 Bacteria 2034
147 Ga0070664_100165814 3300005564 Bacteria 1957
148 Ga0068857_100003529 3300005577 Bacteria 13072
149 Ga0068857_100016405 3300005577 Bacteria 6491
150 Ga0068857_100019160 3300005577 Bacteria 6006
151 Ga0068857_100035549 3300005577 Bacteria 4412
152 Ga0068857_100101609 3300005577 Bacteria 2580
153 Ga0068857_100111118 3300005577 Bacteria 2463
154 Ga0068857_100159626 3300005577 Bacteria 2045
155 Ga0068854_100000549 3300005578 Bacteria 22654
156 Ga0068854_100006059 3300005578 Bacteria 7667
157 Ga0068854_100017461 3300005578 Bacteria 4800
158 Ga0068854_100022038 3300005578 Bacteria 4332
159 Ga0068854_100035421 3300005578 Bacteria 3493
160 Ga0068854_100044978 3300005578 Bacteria 3137
161 Ga0068856_100038336 3300005614 Bacteria 4704
162 Ga0068856_100060412 3300005614 Bacteria 3744
163 Ga0068856_100103385 3300005614 Bacteria 2842
164 Ga0068856_100121059 3300005614 Bacteria 2618
165 Ga0068852_100000835 3300005616 Bacteria 20409
166 Ga0068852_100011477 3300005616 Bacteria 6671
167 Ga0068852_100011667 3300005616 Bacteria 6628
168 Ga0068852_100151839 3300005616 Bacteria 2155
169 Ga0068859_100001673 3300005617 Bacteria 22582
170 Ga0068859_100019739 3300005617 Bacteria 6766
171 Ga0068859_100044184 3300005617 Bacteria 4477
172 Ga0068859_100098138 3300005617 Bacteria 2984
173 Ga0068859_100103455 3300005617 Bacteria 2905
174 Ga0068864_100000393 3300005618 Bacteria 38029
175 Ga0068864_100017702 3300005618 Bacteria 5943
176 Ga0068864_100050575 3300005618 Bacteria 3578
177 Ga0068864_100074102 3300005618 Bacteria 2970
178 Ga0068864_100096566 3300005618 Bacteria 2615
179 Ga0068864_100319027 3300005618 Bacteria 1459
180 Ga0068866_10152292 3300005718 Unclassified 1340
181 Ga0068861_100050985 3300005719 Bacteria 3140
182 Ga0068861_100094314 3300005719 Bacteria 2368
183 Ga0068851_10004608 3300005834 Bacteria 6221
184 Ga0068851_10034705 3300005834 Bacteria 2518
185 Ga0068863_100002359 3300005841 Bacteria 18786
186 Ga0068863_100003094 3300005841 Bacteria 16438
187 Ga0068863_100059852 3300005841 Bacteria 3603
188 Ga0068863_100115707 3300005841 Bacteria 2555
189 Ga0068863_100244597 3300005841 Bacteria 1732
190 Ga0068863_100327335 3300005841 Bacteria 1489
191 Ga0068858_100014208 3300005842 Bacteria 7507
192 Ga0068858_100030145 3300005842 Bacteria 5037
193 Ga0068858_100078820 3300005842 Bacteria 3061
194 Ga0068858_100092411 3300005842 Bacteria 2816
195 Ga0068860_100000516 3300005843 Bacteria 47373
196 Ga0068860_100007613 3300005843 Bacteria 10836
197 Ga0068860_100014445 3300005843 Bacteria 7735
198 Ga0068860_100104970 3300005843 Bacteria 2698
199 Ga0068862_100007818 3300005844 Bacteria 8843
200 Ga0068862_100027637 3300005844 Bacteria 4776
201 Ga0068862_100153718 3300005844 Bacteria 2049
202 Ga0068862_100158182 3300005844 Bacteria 2021
203 Ga0097621_100027147 3300006237 Bacteria 4499
204 Ga0097621_100116221 3300006237 Bacteria 2265
205 Ga0068871_100244065 3300006358 Bacteria 1562
206 Ga0075431_100049960 3300006847 Bacteria 4312
207 Ga0068865_100105291 3300006881 Bacteria 2072
208 Ga0097620_100001673 3300006931 Bacteria 22582
209 Ga0097620_100019684 3300006931 Bacteria 6778
210 Ga0097620_100019739 3300006931 Bacteria 6766
211 Ga0097620_100044180 3300006931 Bacteria 4477
212 Ga0097620_100098134 3300006931 Bacteria 2984
213 Ga0097620_100103455 3300006931 Bacteria 2905
214 Ga0105240_10011911 3300009093 Bacteria 12062
215 Ga0105240_10028918 3300009093 Bacteria 7230
216 Ga0105245_10000068 3300009098 Bacteria 106973
217 Ga0105243_10062506 3300009148 Bacteria 2981
218 Ga0105241_10180765 3300009174 Bacteria 1749
219 Ga0105248_10001005 3300009177 Bacteria 31178
220 Ga0105248_10118736 3300009177 Bacteria 2983
221 Ga0105237_10228324 3300009545 Bacteria 1862
222 Ga0105238_10014999 3300009551 Bacteria 7845
223 Ga0105238_10017606 3300009551 Bacteria 7263
224 Ga0105238_10045378 3300009551 Bacteria 4439
225 Ga0105238_10182018 3300009551 Bacteria 2078
226 Ga0105249_10015431 3300009553 Bacteria 6761
227 Ga0105249_10196875 3300009553 Bacteria 1970
228 Ga0105249_10241368 3300009553 Bacteria 1787
229 Ga0105239_10024161 3300010375 Bacteria 6694
230 Ga0105239_10287913 3300010375 Bacteria 1850
231 Ga0105246_10010038 3300011119 Bacteria 5842
232 Ga0105246_10105152 3300011119 Bacteria 2063
233 Ga0157373_10049117 3300013100 Bacteria 3007
234 Ga0157373_10121640 3300013100 Bacteria 1835
235 Ga0157373_10134657 3300013100 Bacteria 1737
236 Ga0157373_10187721 3300013100 Unclassified 1456
237 Ga0157371_10003274 3300013102 Bacteria 14842
238 Ga0157371_10138607 3300013102 Bacteria 1733
239 Ga0157371_10305813 3300013102 Bacteria 1152
240 Ga0157371_10316476 3300013102 Bacteria 1132
241 Ga0157370_10045418 3300013104 Bacteria 4215
242 Ga0157370_10110244 3300013104 Bacteria 2573
243 Ga0157370_10126560 3300013104 Bacteria 2384
244 Ga0157370_10128035 3300013104 Bacteria 2369
245 Ga0157370_10204851 3300013104 Bacteria 1829
246 Ga0157369_10002175 3300013105 Bacteria 23611
247 Ga0157369_10069904 3300013105 Bacteria 3772
248 Ga0157378_10012488 3300013297 Bacteria 7437
249 Ga0163162_10075213 3300013306 Bacteria 3438
250 Ga0157372_10160663 3300013307 Bacteria 2597
251 Ga0157372_10177391 3300013307 Bacteria 2466
252 Ga0157372_10442824 3300013307 Bacteria 1514
253 Ga0157375_10029627 3300013308 Bacteria 5151
254 Ga0157375_10052488 3300013308 Bacteria 4008
255 Ga0157375_10212621 3300013308 Bacteria 2092
256 Ga0157375_10222464 3300013308 Bacteria 2046
257 Ga0157380_10068377 3300014326 Bacteria 2863
258 Ga0157380_10375143 3300014326 Bacteria 1340
259 Ga0157379_10024258 3300014968 Bacteria 5384
260 Ga0207697_10000007 3300025315 Bacteria 81785
261 Ga0207697_10002575 3300025315 Bacteria 9336
262 Ga0207697_10054234 3300025315 Bacteria 1661
263 Ga0207656_10014433 3300025321 Bacteria 3043
264 Ga0207682_10005767 3300025893 Bacteria 5023
265 Ga0207688_10000333 3300025901 Bacteria 21890
266 Ga0207688_10030623 3300025901 Bacteria 2968
267 Ga0207680_10003077 3300025903 Bacteria 7827
268 Ga0207680_10107466 3300025903 Bacteria 1803
269 Ga0207647_10001004 3300025904 Bacteria 21904
270 Ga0207647_10007592 3300025904 Bacteria 7815
271 Ga0207647_10016708 3300025904 Bacteria 5001
272 Ga0207647_10031988 3300025904 Bacteria 3383
273 Ga0207647_10050303 3300025904 Bacteria 2581
274 Ga0207647_10109294 3300025904 Bacteria 1635
275 Ga0207645_10001287 3300025907 Bacteria 20599
276 Ga0207645_10012375 3300025907 Bacteria 5788
277 Ga0207645_10018174 3300025907 Bacteria 4633
278 Ga0207645_10118284 3300025907 Bacteria 1719
279 Ga0207643_10046997 3300025908 Bacteria 2440
280 Ga0207705_10000003 3300025909 Bacteria 709270
281 Ga0207705_10000749 3300025909 Bacteria 26722
282 Ga0207705_10010424 3300025909 Bacteria 6755
283 Ga0207705_10097029 3300025909 Bacteria 2164
284 Ga0207705_10125282 3300025909 Bacteria 1909
285 Ga0207705_10159129 3300025909 Bacteria 1696
286 Ga0207705_10351960 3300025909 Bacteria 1135
287 Ga0207654_10082848 3300025911 Bacteria 1935
288 Ga0207707_10029977 3300025912 Bacteria 4757
289 Ga0207695_10073014 3300025913 Bacteria 3498
290 Ga0207660_10000864 3300025917 Bacteria 20005
291 Ga0207660_10173751 3300025917 Unclassified 1669
292 Ga0207657_10000431 3300025919 Bacteria 44557
293 Ga0207657_10010311 3300025919 Bacteria 9330
294 Ga0207657_10011983 3300025919 Bacteria 8577
295 Ga0207657_10014679 3300025919 Bacteria 7632
296 Ga0207657_10198005 3300025919 Unclassified 1617
297 Ga0207657_10252250 3300025919 Unclassified 1406
298 Ga0207657_10350004 3300025919 Bacteria 1165
299 Ga0207649_10007623 3300025920 Bacteria 5885
300 Ga0207649_10083898 3300025920 Bacteria 2069
301 Ga0207649_10160586 3300025920 Bacteria 1557
302 Ga0207649_10197588 3300025920 Bacteria 1418
303 Ga0207652_10020560 3300025921 Bacteria 5439
304 Ga0207652_10157079 3300025921 Bacteria 2038
305 Ga0207652_10177559 3300025921 Bacteria 1913
306 Ga0207652_10248159 3300025921 Bacteria 1605
307 Ga0207681_10000695 3300025923 Bacteria 22118
308 Ga0207681_10049871 3300025923 Bacteria 2831
309 Ga0207681_10097853 3300025923 Bacteria 2110
310 Ga0207681_10100119 3300025923 Bacteria 2088
311 Ga0207681_10113225 3300025923 Bacteria 1977
312 Ga0207681_10394542 3300025923 Unclassified 1116
313 Ga0207694_10006461 3300025924 Bacteria 8931
314 Ga0207694_10012784 3300025924 Bacteria 6324
315 Ga0207694_10108893 3300025924 Bacteria 2202
316 Ga0207694_10201620 3300025924 Bacteria 1619
317 Ga0207650_10003428 3300025925 Bacteria 10903
318 Ga0207650_10005581 3300025925 Bacteria 8591
319 Ga0207650_10020423 3300025925 Bacteria 4672
320 Ga0207650_10029190 3300025925 Bacteria 3962
321 Ga0207650_10075907 3300025925 Bacteria 2538
322 Ga0207650_10085904 3300025925 Bacteria 2394
323 Ga0207650_10097067 3300025925 Bacteria 2262
324 Ga0207659_10010125 3300025926 Bacteria 5911
325 Ga0207659_10017319 3300025926 Bacteria 4706
326 Ga0207659_10020590 3300025926 Bacteria 4363
327 Ga0207659_10030125 3300025926 Bacteria 3704
328 Ga0207659_10107981 3300025926 Bacteria 2110
329 Ga0207644_10019319 3300025931 Bacteria 4621
330 Ga0207644_10032443 3300025931 Bacteria 3644
331 Ga0207644_10062034 3300025931 Bacteria 2709
332 Ga0207690_10001169 3300025932 Bacteria 16613
333 Ga0207690_10004108 3300025932 Bacteria 8598
334 Ga0207690_10016706 3300025932 Bacteria 4471
335 Ga0207690_10021356 3300025932 Bacteria 4014
336 Ga0207690_10032878 3300025932 Bacteria 3331
337 Ga0207690_10038555 3300025932 Bacteria 3111
338 Ga0207690_10040610 3300025932 Bacteria 3043
339 Ga0207690_10068595 3300025932 Bacteria 2437
340 Ga0207690_10239713 3300025932 Bacteria 1396
341 Ga0207706_10000766 3300025933 Bacteria 33391
342 Ga0207706_10002443 3300025933 Bacteria 18135
343 Ga0207706_10008288 3300025933 Bacteria 9585
344 Ga0207706_10020491 3300025933 Bacteria 5944
345 Ga0207706_10031630 3300025933 Bacteria 4713
346 Ga0207706_10044020 3300025933 Bacteria 3956
347 Ga0207706_10060109 3300025933 Bacteria 3347
348 Ga0207706_10064275 3300025933 Bacteria 3231
349 Ga0207670_10231913 3300025936 Bacteria 1418
350 Ga0207669_10060629 3300025937 Bacteria 2320
351 Ga0207669_10095778 3300025937 Bacteria 1946
352 Ga0207669_10207879 3300025937 Bacteria 1426
353 Ga0207704_10079889 3300025938 Bacteria 2109
354 Ga0207691_10000493 3300025940 Bacteria 39268
355 Ga0207691_10002544 3300025940 Bacteria 17820
356 Ga0207711_10000591 3300025941 Bacteria 36753
357 Ga0207711_10007329 3300025941 Bacteria 9235
358 Ga0207711_10079003 3300025941 Bacteria 2871
359 Ga0207689_10000131 3300025942 Bacteria 63353
360 Ga0207689_10082861 3300025942 Bacteria 2637
361 Ga0207689_10108220 3300025942 Bacteria 2284
362 Ga0207679_10019457 3300025945 Bacteria 4561
363 Ga0207679_10040348 3300025945 Bacteria 3341
364 Ga0207679_10128890 3300025945 Bacteria 2026
365 Ga0207679_10138590 3300025945 Bacteria 1963
366 Ga0207667_10001522 3300025949 Bacteria 29145
367 Ga0207667_10017621 3300025949 Bacteria 8034
368 Ga0207667_10125966 3300025949 Bacteria 2638
369 Ga0207667_10135294 3300025949 Bacteria 2538
370 Ga0207667_10230117 3300025949 Bacteria 1898
371 Ga0207667_10263525 3300025949 Bacteria 1762
372 Ga0207667_10299104 3300025949 Unclassified 1644
373 Ga0207712_10029662 3300025961 Bacteria 3672
374 Ga0207668_10000107 3300025972 Bacteria 59177
375 Ga0207668_10051351 3300025972 Bacteria 2847
376 Ga0207640_10000518 3300025981 Bacteria 23254
377 Ga0207640_10001011 3300025981 Bacteria 15551
378 Ga0207640_10019848 3300025981 Bacteria 3979
379 Ga0207640_10033063 3300025981 Bacteria 3213
380 Ga0207640_10054029 3300025981 Bacteria 2624
381 Ga0207640_10108266 3300025981 Bacteria 1964
382 Ga0207640_10124590 3300025981 Bacteria 1853
383 Ga0207658_10005298 3300025986 Bacteria 8870
384 Ga0207658_10010410 3300025986 Bacteria 6317
385 Ga0207658_10030093 3300025986 Bacteria 3841
386 Ga0207658_10048630 3300025986 Bacteria 3110
387 Ga0207658_10076706 3300025986 Bacteria 2547
388 Ga0207658_10108279 3300025986 Bacteria 2191
389 Ga0207677_10001334 3300026023 Bacteria 13241
390 Ga0207703_10002138 3300026035 Bacteria 17367
391 Ga0207703_10064504 3300026035 Bacteria 3007
392 Ga0207703_10093070 3300026035 Bacteria 2538
393 Ga0207703_10203572 3300026035 Bacteria 1760
394 Ga0207639_10000202 3300026041 Bacteria 44984
395 Ga0207639_10050361 3300026041 Bacteria 3163
396 Ga0207639_10136318 3300026041 Bacteria 2039
397 Ga0207639_10346431 3300026041 Unclassified 1326
398 Ga0207678_10010845 3300026067 Bacteria 8008
399 Ga0207678_10036652 3300026067 Bacteria 4269
400 Ga0207678_10063811 3300026067 Bacteria 3165
401 Ga0207678_10065666 3300026067 Bacteria 3116
402 Ga0207678_10391024 3300026067 Unclassified 1203
403 Ga0207708_10160320 3300026075 Bacteria 1776
404 Ga0207702_10007350 3300026078 Bacteria 9410
405 Ga0207702_10013760 3300026078 Bacteria 6720
406 Ga0207702_10040616 3300026078 Bacteria 3899
407 Ga0207702_10066037 3300026078 Bacteria 3100
408 Ga0207702_10107739 3300026078 Bacteria 2471
409 Ga0207641_10003184 3300026088 Bacteria 14693
410 Ga0207641_10045988 3300026088 Bacteria 3678
411 Ga0207641_10167761 3300026088 Bacteria 2001
412 Ga0207641_10329188 3300026088 Unclassified 1450
413 Ga0207641_10363222 3300026088 Unclassified 1383
414 Ga0207648_10000752 3300026089 Bacteria 36454
415 Ga0207648_10007939 3300026089 Bacteria 10350
416 Ga0207648_10091127 3300026089 Bacteria 2665
417 Ga0207648_10159391 3300026089 Bacteria 1993
418 Ga0207676_10000257 3300026095 Bacteria 46040
419 Ga0207676_10006149 3300026095 Bacteria 8476
420 Ga0207676_10018521 3300026095 Bacteria 5062
421 Ga0207676_10019259 3300026095 Bacteria 4975
422 Ga0207676_10056001 3300026095 Bacteria 3098
423 Ga0207676_10154346 3300026095 Bacteria 1981
424 Ga0207674_10000065 3300026116 Bacteria 109485
425 Ga0207674_10000583 3300026116 Bacteria 48003
426 Ga0207674_10000804 3300026116 Bacteria 40816
427 Ga0207674_10007066 3300026116 Bacteria 13121
428 Ga0207674_10009484 3300026116 Bacteria 11115
429 Ga0207674_10080025 3300026116 Bacteria 3271
430 Ga0207675_100003939 3300026118 Bacteria 14410
431 Ga0207683_10151840 3300026121 Bacteria 2090
432 Ga0207683_10183086 3300026121 Bacteria 1900
433 Ga0207698_10001530 3300026142 Bacteria 13471
434 Ga0207698_10002711 3300026142 Bacteria 10538
435 Ga0207698_10003162 3300026142 Bacteria 9874
436 Ga0207698_10008466 3300026142 Bacteria 6509
437 Ga0268266_10006543 3300028379 Bacteria 10664
438 Ga0268266_10020540 3300028379 Bacteria 5628
439 Ga0268265_10010441 3300028380 Bacteria 6271
440 Ga0268265_10012458 3300028380 Bacteria 5762
441 Ga0268265_10115876 3300028380 Bacteria 2197
442 Ga0268265_10130920 3300028380 Bacteria 2084
443 Ga0268264_10001215 3300028381 Bacteria 24779
444 Ga0268264_10035639 3300028381 Bacteria 4096
445 Ga0268264_10166075 3300028381 Bacteria 1993
446 Ga0316182_1061723 3300030745 Bacteria 1965
447 Ga0307408_100011093 3300031548 Bacteria 5951
448 Ga0307408_100013723 3300031548 Bacteria 5378
449 Ga0307408_100177475 3300031548 Unclassified 1705
450 Ga0307408_100187629 3300031548 Bacteria 1663
451 Ga0307408_100190095 3300031548 Bacteria 1653
452 Ga0307408_100319678 3300031548 Bacteria 1307
453 Ga0307408_100578768 3300031548 Bacteria 994
454 Ga0307405_10009934 3300031731 Bacteria 4903
455 Ga0307405_10085845 3300031731 Bacteria 2070
456 Ga0307405_10123012 3300031731 Bacteria 1778
457 Ga0307405_10237623 3300031731 Bacteria 1347
458 Ga0307413_10006906 3300031824 Bacteria 5225
459 Ga0307413_10010230 3300031824 Bacteria 4536
460 Ga0307413_10022165 3300031824 Bacteria 3417
461 Ga0307413_10038941 3300031824 Bacteria 2759
462 Ga0307413_10049713 3300031824 Bacteria 2514
463 Ga0307413_10050864 3300031824 Bacteria 2493
464 Ga0307413_10063074 3300031824 Bacteria 2296
465 Ga0307413_10065318 3300031824 Bacteria 2265
466 Ga0307413_10189227 3300031824 Bacteria 1476
467 Ga0307413_10393544 3300031824 Bacteria 1083
468 Ga0307410_10011689 3300031852 Bacteria 5034
469 Ga0307410_10019447 3300031852 Bacteria 4131
470 Ga0307410_10021704 3300031852 Bacteria 3954
471 Ga0307410_10029143 3300031852 Bacteria 3511
472 Ga0307410_10072988 3300031852 Bacteria 2385
473 Ga0307410_10075984 3300031852 Bacteria 2343
474 Ga0307410_10169065 3300031852 Bacteria 1645
475 Ga0307410_10270081 3300031852 Bacteria 1330
476 Ga0307410_10293405 3300031852 Bacteria 1280
477 Ga0307406_10011076 3300031901 Bacteria 5108
478 Ga0307406_10039078 3300031901 Bacteria 2941
479 Ga0307406_10148416 3300031901 Bacteria 1669
480 Ga0307406_10245514 3300031901 Bacteria 1346
481 Ga0307407_10025711 3300031903 Bacteria 3107
482 Ga0307407_10071926 3300031903 Bacteria 2061
483 Ga0307412_10018536 3300031911 Bacteria 4191
484 Ga0307412_10038934 3300031911 Bacteria 3065
485 Ga0307412_10077963 3300031911 Bacteria 2280
486 Ga0307412_10214802 3300031911 Bacteria 1470
487 Ga0307409_100023077 3300031995 Bacteria 4303
488 Ga0307409_100026476 3300031995 Bacteria 4090
489 Ga0307409_100028887 3300031995 Bacteria 3959
490 Ga0307409_100045589 3300031995 Bacteria 3311
491 Ga0307409_100048803 3300031995 Bacteria 3224
492 Ga0307409_100054276 3300031995 Bacteria 3085
493 Ga0307409_100150156 3300031995 Bacteria 2021
494 Ga0307409_100172093 3300031995 Bacteria 1907
495 Ga0307409_100195087 3300031995 Bacteria 1806
496 Ga0307409_100246204 3300031995 Bacteria 1631
497 Ga0307409_100283924 3300031995 Bacteria 1531
498 Ga0307409_100349180 3300031995 Bacteria 1395
499 Ga0307409_100460415 3300031995 Bacteria 1229
500 Ga0307416_100006639 3300032002 Bacteria 7262
501 Ga0307416_100042470 3300032002 Bacteria 3550
502 Ga0307416_100053177 3300032002 Bacteria 3247
503 Ga0307416_100069133 3300032002 Bacteria 2921
504 Ga0307416_100093301 3300032002 Bacteria 2592
505 Ga0307416_100103747 3300032002 Bacteria 2484
506 Ga0307416_100107416 3300032002 Bacteria 2449
507 Ga0307416_100353974 3300032002 Bacteria 1487
508 Ga0307416_100360400 3300032002 Bacteria 1476
509 Ga0307414_10010639 3300032004 Bacteria 5350
510 Ga0307414_10012098 3300032004 Bacteria 5091
511 Ga0307414_10012727 3300032004 Bacteria 4988
512 Ga0307414_10036496 3300032004 Bacteria 3282
513 Ga0307414_10048198 3300032004 Bacteria 2938
514 Ga0307414_10094603 3300032004 Bacteria 2230
515 Ga0307414_10105999 3300032004 Bacteria 2126
516 Ga0307414_10282044 3300032004 Unclassified 1396
517 Ga0307414_10482406 3300032004 Bacteria 1094
518 Ga0307411_10000956 3300032005 Bacteria 11041
519 Ga0307411_10003484 3300032005 Bacteria 7308
520 Ga0307411_10007304 3300032005 Bacteria 5612
521 Ga0307411_10009714 3300032005 Bacteria 5080
522 Ga0307411_10029381 3300032005 Bacteria 3355
523 Ga0307411_10078788 3300032005 Bacteria 2260
524 Ga0307411_10078899 3300032005 Bacteria 2259
525 Ga0307411_10088975 3300032005 Bacteria 2149
526 Ga0307411_10104808 3300032005 Bacteria 2009
527 Ga0307411_10126835 3300032005 Bacteria 1857
528 Ga0307411_10345290 3300032005 Unclassified 1211
529 Ga0307411_10482927 3300032005 Bacteria 1044
530 Ga0307415_100035198 3300032126 Bacteria 3269
531 Ga0307415_100051944 3300032126 Bacteria 2785
532 Ga0307415_100062112 3300032126 Bacteria 2589
533 Ga0307415_100094803 3300032126 Bacteria 2171
534 Ga0307415_100112844 3300032126 Bacteria 2020
535 Ga0307415_100123313 3300032126 Bacteria 1947
536 Ga0307415_100158232 3300032126 Bacteria 1752
537 Ga0307415_100280224 3300032126 Bacteria 1370
538 Ga0307415_100282508 3300032126 Bacteria 1366
539 Ga0307415_100487700 3300032126 Bacteria 1074
540 Ga0373931_0089212 3300035691 Bacteria 1715
541 Ga0395899_0002137 3300037312 Bacteria 16249
542 Ga0395899_0008059 3300037312 Bacteria 8112
543 Ga0395899_0020942 3300037312 Bacteria 4959
544 Ga0395899_0056894 3300037312 Bacteria 2889
545 Ga0395899_0103100 3300037312 Bacteria 2058
546 Ga0395899_0205327 3300037312 Bacteria 1371
547 Ga0395900_0000547 3300037418 Bacteria 52367
548 Ga0395900_0032140 3300037418 Bacteria 5395
549 Ga0395900_0047865 3300037418 Bacteria 4404
550 Ga0395900_0054101 3300037418 Bacteria 4132
551 Ga0395900_0103899 3300037418 Bacteria 2918
552 Ga0395900_0136916 3300037418 Bacteria 2509
553 Ga0395900_0156038 3300037418 Bacteria 2331
554 Ga0395900_0164139 3300037418 Bacteria 2264
555 Ga0395898_0006208 3300037466 Bacteria 12803
556 Ga0395898_0016331 3300037466 Bacteria 7598
557 Ga0395898_0020677 3300037466 Bacteria 6682
558 Ga0395898_0022731 3300037466 Bacteria 6347
559 Ga0395898_0051673 3300037466 Bacteria 4018
560 Ga0395898_0130558 3300037466 Bacteria 2407
561 Ga0395898_0132574 3300037466 Bacteria 2386
562 Ga0395898_0629039 3300037466 Bacteria 1016
563 Ga0395905_0001585 3300037471 Bacteria 27082
564 Ga0395905_0002176 3300037471 Bacteria 22155
565 Ga0395905_0003180 3300037471 Bacteria 17680
566 Ga0395905_0003255 3300037471 Bacteria 17461
567 Ga0395905_0006103 3300037471 Bacteria 12175
568 Ga0395905_0011267 3300037471 Bacteria 8646
569 Ga0395905_0014142 3300037471 Bacteria 7626
570 Ga0395905_0019351 3300037471 Bacteria 6454
571 Ga0395905_0031020 3300037471 Bacteria 5034
572 Ga0395905_0037451 3300037471 Bacteria 4553
573 Ga0395905_0047470 3300037471 Bacteria 4024
574 Ga0395905_0051975 3300037471 Bacteria 3838
575 Ga0395905_0084062 3300037471 Bacteria 2982
576 Ga0395905_0084257 3300037471 Bacteria 2978
577 Ga0395905_0142305 3300037471 Bacteria 2256
578 Ga0395905_0205698 3300037471 Bacteria 1845
579 Ga0395905_0290919 3300037471 Bacteria 1520
580 Ga0395905_0308119 3300037471 Bacteria 1472
581 Ga0395905_0386448 3300037471 Bacteria 1294
582 Ga0395901_0000390 3300038443 Bacteria 52341
583 Ga0395901_0018305 3300038443 Bacteria 7152
584 Ga0395901_0026298 3300038443 Bacteria 5976
585 Ga0395901_0032024 3300038443 Bacteria 5424
586 Ga0395901_0189345 3300038443 Bacteria 2158
587 Ga0395901_0288444 3300038443 Bacteria 1704
588 Ga0439465_0014777 3300041413 Bacteria 2435
589 Ga0439445_0004822 3300042004 Bacteria 3061
590 Ga0439432_021453 3300042006 Bacteria 2141
591 Ga0439434_0040011 3300042435 Bacteria 1439
592 Ga0466969_0003940 3300044656 Bacteria 7884
593 Ga0466966_0001131 3300044684 Bacteria 17137
594 Ga0466966_0032948 3300044684 Bacteria 3354
595 Ga0466963_0000058 3300044694 Bacteria 37428
596 Ga0466963_0002122 3300044694 Bacteria 10968
597 Ga0466963_0056485 3300044694 Bacteria 2612
598 Ga0466963_0112894 3300044694 Bacteria 1866
599 Ga0466963_0202328 3300044694 Bacteria 1389
600 Ga0466971_0008191 3300044719 Bacteria 4557
601 Ga0466970_0012351 3300044765 Bacteria 4365
602 Ga0466957_0008998 3300044842 Bacteria 5691
603 Ga0466957_0048412 3300044842 Bacteria 2584
604 Ga0466959_0001847 3300045049 Bacteria 13294
605 Ga0466959_0035853 3300045049 Bacteria 3665
606 Ga0466959_0065125 3300045049 Bacteria 2645
607 Ga0466958_0001033 3300045836 Bacteria 12717
608 Ga0466967_0000120 3300045976 Bacteria 29412
609 Ga0466967_0011883 3300045976 Bacteria 6627
610 Ga0466967_0035268 3300045976 Bacteria 4256
611 Ga0466967_0068972 3300045976 Bacteria 3159
612 Ga0466967_0101208 3300045976 Bacteria 2633
613 Ga0466967_0115942 3300045976 Bacteria 2467
614 Ga0466967_0139145 3300045976 Bacteria 2260
615 Ga0466967_0403626 3300045976 Bacteria 1330
616 Ga0466967_0542252 3300045976 Unclassified 1144
617 Ga0495663_0012690 3300046525 Bacteria 2350
618 Ga0495621_0000052 3300046539 Bacteria 22615
619 Ga0495621_0100409 3300046539 Bacteria 1100
620 Ga0495659_0031306 3300046664 Bacteria 1856
621 Ga0495669_0008078 3300046684 Bacteria 4416
622 Ga0495669_0023548 3300046684 Bacteria 2681
623 Ga0495669_0044512 3300046684 Bacteria 1978
624 Ga0495677_0011550 3300047445 Bacteria 3229
625 Ga0495677_0076828 3300047445 Bacteria 1249
626 Ga0496101_0024964 3300048904 Bacteria 4143
627 Ga0496103_0075859 3300048906 Bacteria 2109
628 Ga0496104_0141197 3300048907 Bacteria 2314
629 Ga0496107_0011979 3300048910 Bacteria 6051
630 Ga0496107_0079335 3300048910 Bacteria 2393
631 Ga0496108_0009406 3300048911 Bacteria 7914
632 Ga0496108_0022077 3300048911 Bacteria 5232
633 Ga0496109_0010251 3300048912 Bacteria 8002
634 Ga0496109_0030504 3300048912 Bacteria 4832
635 Ga0496110_0022920 3300048913 Bacteria 5306
636 Ga0496110_0053652 3300048913 Bacteria 3545
637 Ga0496111_0004353 3300048914 Bacteria 8935
638 Ga0496112_0048035 3300048915 Bacteria 4186
639 Ga0496112_0115595 3300048915 Bacteria 2653
640 Ga0496114_0067747 3300048917 Bacteria 2995
641 Ga0496115_0000395 3300048918 Bacteria 35926
642 Ga0501067_0029118 3300049583 Bacteria 3061
643 Ga0501069_0273207 3300049585 Bacteria 988
644 nmdc:mga06r32_47184_c1 3300050510 Bacteria 4113
645 Ga0466962_0014601 3300061719 Bacteria 3785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0273207 Ga0501069_0273207_15_857 279
2 3300031824 Ga0307413_10063074 Ga0307413_100630742 289
3 3300031852 Ga0307410_10072988 Ga0307410_100729884 289
4 3300032005 Ga0307411_10088975 Ga0307411_100889753 289
5 3300005457 Ga0070662_100011566 Ga0070662_1000115666 290
6 3300005564 Ga0070664_100153530 Ga0070664_1001535302 290
7 3300025933 Ga0207706_10008288 Ga0207706_1000828810 290
8 3300005327 Ga0070658_10262229 Ga0070658_102622292 292
9 3300025909 Ga0207705_10159129 Ga0207705_101591292 292
10 3300009551 Ga0105238_10182018 Ga0105238_101820183 293
11 3300050510 nmdc:mga06r32_47184_c1 nmdc:mga06r32_47184_c1_289_1173 293
12 3300002239 JGI24034J26672_10001073 JGI24034J26672_100010734 294
13 3300005293 Ga0065715_10013711 Ga0065715_100137113 294
14 3300005333 Ga0070677_10009258 Ga0070677_100092583 294
15 3300005353 Ga0070669_100052853 Ga0070669_1000528532 294
16 3300005354 Ga0070675_100012981 Ga0070675_1000129817 294
17 3300005355 Ga0070671_100012902 Ga0070671_1000129023 294
18 3300005366 Ga0070659_100043914 Ga0070659_1000439142 294
19 3300005367 Ga0070667_100031405 Ga0070667_1000314052 294
20 3300005456 Ga0070678_100050997 Ga0070678_1000509973 294
21 3300005457 Ga0070662_100007905 Ga0070662_1000079056 294
22 3300005577 Ga0068857_100111118 Ga0068857_1001111182 294
23 3300013100 Ga0157373_10187721 Ga0157373_101877212 294
24 3300013102 Ga0157371_10316476 Ga0157371_103164762 294
25 3300044842 Ga0466957_0048412 Ga0466957_0048412_545_1450 294
26 3300045976 Ga0466967_0101208 Ga0466967_0101208_371_1282 294
27 3300046684 Ga0495669_0044512 Ga0495669_0044512_794_1690 294
28 3300048915 Ga0496112_0048035 Ga0496112_0048035_796_1686 294
29 3300047445 Ga0495677_0076828 Ga0495677_0076828_171_1064 296
30 3300042435 Ga0439434_0040011 Ga0439434_0040011_288_1199 297
31 3300005331 Ga0070670_100149130 Ga0070670_1001491302 298
32 3300005333 Ga0070677_10098019 Ga0070677_100980192 298
33 3300005353 Ga0070669_100243675 Ga0070669_1002436752 298
34 3300005353 Ga0070669_100328651 Ga0070669_1003286512 298
35 3300005354 Ga0070675_100014143 Ga0070675_1000141433 298
36 3300005530 Ga0070679_100096843 Ga0070679_1000968432 298
37 3300005543 Ga0070672_100270631 Ga0070672_1002706312 298
38 3300005564 Ga0070664_100069100 Ga0070664_1000691003 298
39 3300025315 Ga0207697_10054234 Ga0207697_100542341 298
40 3300025923 Ga0207681_10049871 Ga0207681_100498713 298
41 3300025923 Ga0207681_10097853 Ga0207681_100978533 298
42 3300025926 Ga0207659_10010125 Ga0207659_100101252 298
43 3300025945 Ga0207679_10040348 Ga0207679_100403483 298
44 3300031548 Ga0307408_100190095 Ga0307408_1001900952 298
45 3300031548 Ga0307408_100578768 Ga0307408_1005787681 298
46 3300031824 Ga0307413_10006906 Ga0307413_100069063 298
47 3300031824 Ga0307413_10065318 Ga0307413_100653182 298
48 3300031824 Ga0307413_10189227 Ga0307413_101892271 298
49 3300031852 Ga0307410_10011689 Ga0307410_100116894 298
50 3300031852 Ga0307410_10021704 Ga0307410_100217044 298
51 3300031852 Ga0307410_10169065 Ga0307410_101690652 298
52 3300031911 Ga0307412_10077963 Ga0307412_100779631 298
53 3300031995 Ga0307409_100048803 Ga0307409_1000488032 298
54 3300031995 Ga0307409_100054276 Ga0307409_1000542764 298
55 3300031995 Ga0307409_100150156 Ga0307409_1001501563 298
56 3300031995 Ga0307409_100246204 Ga0307409_1002462042 298
57 3300031995 Ga0307409_100283924 Ga0307409_1002839242 298
58 3300032002 Ga0307416_100353974 Ga0307416_1003539742 298
59 3300032004 Ga0307414_10010639 Ga0307414_100106397 298
60 3300032004 Ga0307414_10012098 Ga0307414_100120985 298
61 3300032004 Ga0307414_10105999 Ga0307414_101059991 298
62 3300032004 Ga0307414_10482406 Ga0307414_104824062 298
63 3300032005 Ga0307411_10003484 Ga0307411_100034843 298
64 3300032005 Ga0307411_10007304 Ga0307411_100073042 298
65 3300032126 Ga0307415_100282508 Ga0307415_1002825082 298
66 3300037466 Ga0395898_0130558 Ga0395898_0130558_101_1012 298
67 3300037471 Ga0395905_0002176 Ga0395905_0002176_12472_13383 298
68 3300044694 Ga0466963_0056485 Ga0466963_0056485_182_1090 298
69 3300045976 Ga0466967_0115942 Ga0466967_0115942_849_1757 298
70 3300005366 Ga0070659_100065219 Ga0070659_1000652194 299
71 3300005530 Ga0070679_100253036 Ga0070679_1002530362 299
72 3300006847 Ga0075431_100049960 Ga0075431_1000499603 299
73 3300025921 Ga0207652_10248159 Ga0207652_102481592 299
74 3300025932 Ga0207690_10068595 Ga0207690_100685954 299
75 3300025981 Ga0207640_10124590 Ga0207640_101245902 299
76 3300030745 Ga0316182_1061723 Ga0316182_10617232 299
77 3300031731 Ga0307405_10237623 Ga0307405_102376232 299
78 3300031824 Ga0307413_10010230 Ga0307413_100102301 299
79 3300031824 Ga0307413_10393544 Ga0307413_103935442 299
80 3300031901 Ga0307406_10148416 Ga0307406_101484161 299
81 3300031903 Ga0307407_10071926 Ga0307407_100719262 299
82 3300031911 Ga0307412_10214802 Ga0307412_102148022 299
83 3300031995 Ga0307409_100045589 Ga0307409_1000455894 299
84 3300032004 Ga0307414_10048198 Ga0307414_100481983 299
85 3300032005 Ga0307411_10104808 Ga0307411_101048082 299
86 3300032005 Ga0307411_10482927 Ga0307411_104829271 299
87 3300032126 Ga0307415_100062112 Ga0307415_1000621122 299
88 3300032126 Ga0307415_100158232 Ga0307415_1001582321 299
89 3300032126 Ga0307415_100280224 Ga0307415_1002802242 299
90 3300044684 Ga0466966_0032948 Ga0466966_0032948_900_1808 299
91 3300045049 Ga0466959_0035853 Ga0466959_0035853_2510_3418 299
92 3300005327 Ga0070658_10068348 Ga0070658_100683482 300
93 3300005327 Ga0070658_10218306 Ga0070658_102183062 300
94 3300005331 Ga0070670_100034246 Ga0070670_1000342464 300
95 3300005331 Ga0070670_100086806 Ga0070670_1000868063 300
96 3300005335 Ga0070666_10107565 Ga0070666_101075652 300
97 3300005339 Ga0070660_100295632 Ga0070660_1002956322 300
98 3300005340 Ga0070689_100386805 Ga0070689_1003868051 300
99 3300005347 Ga0070668_100005256 Ga0070668_1000052563 300
100 3300005353 Ga0070669_100222893 Ga0070669_1002228931 300
101 3300005364 Ga0070673_100154949 Ga0070673_1001549492 300
102 3300005366 Ga0070659_100024119 Ga0070659_1000241192 300
103 3300005366 Ga0070659_100075882 Ga0070659_1000758823 300
104 3300005438 Ga0070701_10032861 Ga0070701_100328613 300
105 3300005440 Ga0070705_100331199 Ga0070705_1003311992 300
106 3300005530 Ga0070679_100249135 Ga0070679_1002491352 300
107 3300005539 Ga0068853_100040493 Ga0068853_1000404934 300
108 3300005539 Ga0068853_100048087 Ga0068853_1000480873 300
109 3300005539 Ga0068853_100166676 Ga0068853_1001666762 300
110 3300005543 Ga0070672_100001472 Ga0070672_10000147213 300
111 3300005563 Ga0068855_100061293 Ga0068855_1000612935 300
112 3300005563 Ga0068855_100527692 Ga0068855_1005276922 300
113 3300005577 Ga0068857_100019160 Ga0068857_1000191606 300
114 3300005577 Ga0068857_100159626 Ga0068857_1001596263 300
115 3300005578 Ga0068854_100035421 Ga0068854_1000354212 300
116 3300005616 Ga0068852_100011477 Ga0068852_1000114773 300
117 3300005616 Ga0068852_100011667 Ga0068852_1000116676 300
118 3300005617 Ga0068859_100019739 Ga0068859_1000197393 300
119 3300005617 Ga0068859_100103455 Ga0068859_1001034553 300
120 3300005618 Ga0068864_100017702 Ga0068864_1000177024 300
121 3300005618 Ga0068864_100096566 Ga0068864_1000965663 300
122 3300005618 Ga0068864_100319027 Ga0068864_1003190272 300
123 3300005719 Ga0068861_100050985 Ga0068861_1000509853 300
124 3300005841 Ga0068863_100003094 Ga0068863_10000309413 300
125 3300005841 Ga0068863_100115707 Ga0068863_1001157073 300
126 3300005841 Ga0068863_100244597 Ga0068863_1002445972 300
127 3300005842 Ga0068858_100030145 Ga0068858_1000301453 300
128 3300005842 Ga0068858_100078820 Ga0068858_1000788203 300
129 3300005843 Ga0068860_100007613 Ga0068860_1000076137 300
130 3300005844 Ga0068862_100007818 Ga0068862_10000781810 300
131 3300005844 Ga0068862_100027637 Ga0068862_1000276376 300
132 3300005844 Ga0068862_100158182 Ga0068862_1001581822 300
133 3300006931 Ga0097620_100019739 Ga0097620_1000197393 300
134 3300006931 Ga0097620_100103455 Ga0097620_1001034553 300
135 3300009177 Ga0105248_10118736 Ga0105248_101187362 300
136 3300009551 Ga0105238_10014999 Ga0105238_100149996 300
137 3300009553 Ga0105249_10015431 Ga0105249_100154317 300
138 3300009553 Ga0105249_10196875 Ga0105249_101968751 300
139 3300009553 Ga0105249_10241368 Ga0105249_102413682 300
140 3300011119 Ga0105246_10105152 Ga0105246_101051522 300
141 3300013100 Ga0157373_10049117 Ga0157373_100491173 300
142 3300013102 Ga0157371_10138607 Ga0157371_101386072 300
143 3300013104 Ga0157370_10045418 Ga0157370_100454182 300
144 3300013104 Ga0157370_10110244 Ga0157370_101102442 300
145 3300013105 Ga0157369_10002175 Ga0157369_1000217517 300
146 3300013306 Ga0163162_10075213 Ga0163162_100752136 300
147 3300014326 Ga0157380_10068377 Ga0157380_100683772 300
148 3300014326 Ga0157380_10375143 Ga0157380_103751432 300
149 3300025315 Ga0207697_10002575 Ga0207697_1000257510 300
150 3300025893 Ga0207682_10005767 Ga0207682_100057674 300
151 3300025903 Ga0207680_10107466 Ga0207680_101074662 300
152 3300025904 Ga0207647_10109294 Ga0207647_101092942 300
153 3300025907 Ga0207645_10018174 Ga0207645_100181744 300
154 3300025917 Ga0207660_10000864 Ga0207660_1000086419 300
155 3300025919 Ga0207657_10198005 Ga0207657_101980052 300
156 3300025919 Ga0207657_10350004 Ga0207657_103500042 300
157 3300025920 Ga0207649_10160586 Ga0207649_101605862 300
158 3300025921 Ga0207652_10177559 Ga0207652_101775592 300
159 3300025923 Ga0207681_10113225 Ga0207681_101132252 300
160 3300025924 Ga0207694_10006461 Ga0207694_100064614 300
161 3300025924 Ga0207694_10108893 Ga0207694_101088933 300
162 3300025925 Ga0207650_10003428 Ga0207650_100034282 300
163 3300025925 Ga0207650_10097067 Ga0207650_100970672 300
164 3300025926 Ga0207659_10107981 Ga0207659_101079812 300
165 3300025932 Ga0207690_10016706 Ga0207690_100167064 300
166 3300025932 Ga0207690_10038555 Ga0207690_100385553 300
167 3300025932 Ga0207690_10239713 Ga0207690_102397132 300
168 3300025933 Ga0207706_10002443 Ga0207706_1000244320 300
169 3300025936 Ga0207670_10231913 Ga0207670_102319132 300
170 3300025937 Ga0207669_10060629 Ga0207669_100606292 300
171 3300025940 Ga0207691_10002544 Ga0207691_100025443 300
172 3300025942 Ga0207689_10082861 Ga0207689_100828612 300
173 3300025945 Ga0207679_10128890 Ga0207679_101288903 300
174 3300025949 Ga0207667_10135294 Ga0207667_101352943 300
175 3300025949 Ga0207667_10230117 Ga0207667_102301172 300
176 3300025961 Ga0207712_10029662 Ga0207712_100296623 300
177 3300025972 Ga0207668_10051351 Ga0207668_100513512 300
178 3300025981 Ga0207640_10108266 Ga0207640_101082662 300
179 3300025986 Ga0207658_10030093 Ga0207658_100300932 300
180 3300026035 Ga0207703_10064504 Ga0207703_100645042 300
181 3300026035 Ga0207703_10093070 Ga0207703_100930702 300
182 3300026041 Ga0207639_10050361 Ga0207639_100503612 300
183 3300026041 Ga0207639_10136318 Ga0207639_101363183 300
184 3300026067 Ga0207678_10036652 Ga0207678_100366524 300
185 3300026095 Ga0207676_10006149 Ga0207676_100061498 300
186 3300026095 Ga0207676_10018521 Ga0207676_100185212 300
187 3300026116 Ga0207674_10000065 Ga0207674_10000065105 300
188 3300026116 Ga0207674_10000804 Ga0207674_1000080434 300
189 3300026118 Ga0207675_100003939 Ga0207675_1000039393 300
190 3300026121 Ga0207683_10183086 Ga0207683_101830862 300
191 3300026142 Ga0207698_10001530 Ga0207698_1000153012 300
192 3300026142 Ga0207698_10003162 Ga0207698_100031626 300
193 3300028380 Ga0268265_10012458 Ga0268265_100124584 300
194 3300028380 Ga0268265_10115876 Ga0268265_101158762 300
195 3300028380 Ga0268265_10130920 Ga0268265_101309201 300
196 3300028381 Ga0268264_10035639 Ga0268264_100356394 300
197 3300031548 Ga0307408_100011093 Ga0307408_1000110932 300
198 3300031548 Ga0307408_100013723 Ga0307408_1000137232 300
199 3300031548 Ga0307408_100177475 Ga0307408_1001774752 300
200 3300031731 Ga0307405_10123012 Ga0307405_101230121 300
201 3300031824 Ga0307413_10022165 Ga0307413_100221653 300
202 3300031824 Ga0307413_10050864 Ga0307413_100508643 300
203 3300031852 Ga0307410_10293405 Ga0307410_102934051 300
204 3300031901 Ga0307406_10039078 Ga0307406_100390782 300
205 3300031901 Ga0307406_10245514 Ga0307406_102455142 300
206 3300031911 Ga0307412_10018536 Ga0307412_100185362 300
207 3300031911 Ga0307412_10038934 Ga0307412_100389341 300
208 3300031995 Ga0307409_100026476 Ga0307409_1000264763 300
209 3300031995 Ga0307409_100460415 Ga0307409_1004604151 300
210 3300032002 Ga0307416_100093301 Ga0307416_1000933013 300
211 3300032004 Ga0307414_10094603 Ga0307414_100946032 300
212 3300032004 Ga0307414_10282044 Ga0307414_102820442 300
213 3300032005 Ga0307411_10000956 Ga0307411_100009562 300
214 3300032005 Ga0307411_10078899 Ga0307411_100788992 300
215 3300032126 Ga0307415_100123313 Ga0307415_1001233131 300
216 3300037312 Ga0395899_0020942 Ga0395899_0020942_3966_4874 300
217 3300037312 Ga0395899_0205327 Ga0395899_0205327_148_1059 300
218 3300037418 Ga0395900_0164139 Ga0395900_0164139_133_1044 300
219 3300037466 Ga0395898_0016331 Ga0395898_0016331_4356_5267 300
220 3300037466 Ga0395898_0051673 Ga0395898_0051673_2453_3361 300
221 3300037466 Ga0395898_0629039 Ga0395898_0629039_53_964 300
222 3300037471 Ga0395905_0003180 Ga0395905_0003180_118_1032 300
223 3300037471 Ga0395905_0047470 Ga0395905_0047470_731_1642 300
224 3300037471 Ga0395905_0051975 Ga0395905_0051975_229_1140 300
225 3300037471 Ga0395905_0084257 Ga0395905_0084257_1611_2519 300
226 3300037471 Ga0395905_0386448 Ga0395905_0386448_74_979 300
227 3300038443 Ga0395901_0032024 Ga0395901_0032024_2110_3018 300
228 3300041413 Ga0439465_0014777 Ga0439465_0014777_113_1027 300
229 3300044694 Ga0466963_0000058 Ga0466963_0000058_8792_9709 300
230 3300044694 Ga0466963_0112894 Ga0466963_0112894_774_1679 300
231 3300044842 Ga0466957_0008998 Ga0466957_0008998_3288_4205 300
232 3300045049 Ga0466959_0065125 Ga0466959_0065125_282_1193 300
233 3300045976 Ga0466967_0000120 Ga0466967_0000120_10173_11090 300
234 3300045976 Ga0466967_0068972 Ga0466967_0068972_1527_2438 300
235 3300045976 Ga0466967_0542252 Ga0466967_0542252_194_1102 300
236 3300046539 Ga0495621_0000052 Ga0495621_0000052_5670_6611 300
237 3300046664 Ga0495659_0031306 Ga0495659_0031306_273_1202 300
238 3300061719 Ga0466962_0014601 Ga0466962_0014601_1365_2282 300
239 3300001990 JGI24737J22298_10006127 JGI24737J22298_100061272 301
240 3300005327 Ga0070658_10000876 Ga0070658_100008763 301
241 3300005327 Ga0070658_10166062 Ga0070658_101660622 301
242 3300005328 Ga0070676_10003403 Ga0070676_100034035 301
243 3300005328 Ga0070676_10392890 Ga0070676_103928901 301
244 3300005331 Ga0070670_100030540 Ga0070670_1000305403 301
245 3300005339 Ga0070660_100000487 Ga0070660_10000048722 301
246 3300005344 Ga0070661_100054274 Ga0070661_1000542743 301
247 3300005345 Ga0070692_10002031 Ga0070692_100020316 301
248 3300005347 Ga0070668_100004873 Ga0070668_1000048738 301
249 3300005347 Ga0070668_100465013 Ga0070668_1004650131 301
250 3300005353 Ga0070669_100010130 Ga0070669_1000101305 301
251 3300005354 Ga0070675_100001671 Ga0070675_10000167115 301
252 3300005354 Ga0070675_100212663 Ga0070675_1002126632 301
253 3300005356 Ga0070674_100086676 Ga0070674_1000866762 301
254 3300005356 Ga0070674_100091528 Ga0070674_1000915282 301
255 3300005366 Ga0070659_100001985 Ga0070659_10000198511 301
256 3300005366 Ga0070659_100010425 Ga0070659_1000104254 301
257 3300005366 Ga0070659_100019139 Ga0070659_1000191394 301
258 3300005435 Ga0070714_100035653 Ga0070714_1000356533 301
259 3300005435 Ga0070714_100045874 Ga0070714_1000458743 301
260 3300005455 Ga0070663_100041092 Ga0070663_1000410923 301
261 3300005456 Ga0070678_100022762 Ga0070678_1000227622 301
262 3300005457 Ga0070662_100018282 Ga0070662_1000182822 301
263 3300005457 Ga0070662_100032417 Ga0070662_1000324174 301
264 3300005457 Ga0070662_100071950 Ga0070662_1000719501 301
265 3300005457 Ga0070662_100112261 Ga0070662_1001122611 301
266 3300005458 Ga0070681_10040275 Ga0070681_100402752 301
267 3300005459 Ga0068867_100090577 Ga0068867_1000905772 301
268 3300005459 Ga0068867_100283251 Ga0068867_1002832512 301
269 3300005530 Ga0070679_100024934 Ga0070679_1000249346 301
270 3300005539 Ga0068853_100402036 Ga0068853_1004020362 301
271 3300005546 Ga0070696_100016330 Ga0070696_1000163306 301
272 3300005547 Ga0070693_100037979 Ga0070693_1000379793 301
273 3300005548 Ga0070665_100065609 Ga0070665_1000656093 301
274 3300005578 Ga0068854_100006059 Ga0068854_1000060593 301
275 3300005578 Ga0068854_100022038 Ga0068854_1000220383 301
276 3300005614 Ga0068856_100038336 Ga0068856_1000383363 301
277 3300005614 Ga0068856_100121059 Ga0068856_1001210592 301
278 3300009093 Ga0105240_10011911 Ga0105240_100119119 301
279 3300009551 Ga0105238_10045378 Ga0105238_100453782 301
280 3300013104 Ga0157370_10128035 Ga0157370_101280352 301
281 3300013104 Ga0157370_10204851 Ga0157370_102048511 301
282 3300013105 Ga0157369_10069904 Ga0157369_100699042 301
283 3300013307 Ga0157372_10177391 Ga0157372_101773913 301
284 3300025904 Ga0207647_10016708 Ga0207647_100167084 301
285 3300025904 Ga0207647_10031988 Ga0207647_100319882 301
286 3300025904 Ga0207647_10050303 Ga0207647_100503033 301
287 3300025907 Ga0207645_10012375 Ga0207645_100123753 301
288 3300025907 Ga0207645_10118284 Ga0207645_101182842 301
289 3300025909 Ga0207705_10000003 Ga0207705_1000000392 301
290 3300025909 Ga0207705_10000749 Ga0207705_100007498 301
291 3300025909 Ga0207705_10097029 Ga0207705_100970292 301
292 3300025909 Ga0207705_10351960 Ga0207705_103519602 301
293 3300025912 Ga0207707_10029977 Ga0207707_100299773 301
294 3300025919 Ga0207657_10000431 Ga0207657_1000043129 301
295 3300025919 Ga0207657_10014679 Ga0207657_100146795 301
296 3300025919 Ga0207657_10252250 Ga0207657_102522502 301
297 3300025920 Ga0207649_10007623 Ga0207649_100076232 301
298 3300025921 Ga0207652_10020560 Ga0207652_100205603 301
299 3300025923 Ga0207681_10100119 Ga0207681_101001192 301
300 3300025925 Ga0207650_10029190 Ga0207650_100291902 301
301 3300025926 Ga0207659_10030125 Ga0207659_100301252 301
302 3300025932 Ga0207690_10004108 Ga0207690_100041083 301
303 3300025932 Ga0207690_10021356 Ga0207690_100213565 301
304 3300025932 Ga0207690_10032878 Ga0207690_100328783 301
305 3300025933 Ga0207706_10020491 Ga0207706_100204916 301
306 3300025933 Ga0207706_10031630 Ga0207706_100316302 301
307 3300025933 Ga0207706_10060109 Ga0207706_100601092 301
308 3300025937 Ga0207669_10095778 Ga0207669_100957782 301
309 3300025937 Ga0207669_10207879 Ga0207669_102078792 301
310 3300025942 Ga0207689_10108220 Ga0207689_101082203 301
311 3300025949 Ga0207667_10125966 Ga0207667_101259662 301
312 3300025949 Ga0207667_10263525 Ga0207667_102635252 301
313 3300025972 Ga0207668_10000107 Ga0207668_1000010747 301
314 3300025981 Ga0207640_10000518 Ga0207640_1000051826 301
315 3300025981 Ga0207640_10019848 Ga0207640_100198482 301
316 3300026041 Ga0207639_10346431 Ga0207639_103464312 301
317 3300026067 Ga0207678_10063811 Ga0207678_100638112 301
318 3300026067 Ga0207678_10391024 Ga0207678_103910242 301
319 3300026078 Ga0207702_10007350 Ga0207702_100073505 301
320 3300026078 Ga0207702_10040616 Ga0207702_100406163 301
321 3300026078 Ga0207702_10107739 Ga0207702_101077393 301
322 3300026089 Ga0207648_10091127 Ga0207648_100911273 301
323 3300026089 Ga0207648_10159391 Ga0207648_101593912 301
324 3300026121 Ga0207683_10151840 Ga0207683_101518402 301
325 3300031548 Ga0307408_100187629 Ga0307408_1001876291 301
326 3300031731 Ga0307405_10009934 Ga0307405_100099343 301
327 3300031731 Ga0307405_10085845 Ga0307405_100858451 301
328 3300031824 Ga0307413_10038941 Ga0307413_100389412 301
329 3300031824 Ga0307413_10049713 Ga0307413_100497131 301
330 3300031852 Ga0307410_10019447 Ga0307410_100194473 301
331 3300031852 Ga0307410_10029143 Ga0307410_100291432 301
332 3300031852 Ga0307410_10075984 Ga0307410_100759841 301
333 3300031852 Ga0307410_10270081 Ga0307410_102700811 301
334 3300031901 Ga0307406_10011076 Ga0307406_100110764 301
335 3300031995 Ga0307409_100023077 Ga0307409_1000230774 301
336 3300031995 Ga0307409_100028887 Ga0307409_1000288872 301
337 3300031995 Ga0307409_100195087 Ga0307409_1001950872 301
338 3300031995 Ga0307409_100349180 Ga0307409_1003491802 301
339 3300032002 Ga0307416_100006639 Ga0307416_1000066394 301
340 3300032002 Ga0307416_100053177 Ga0307416_1000531771 301
341 3300032002 Ga0307416_100103747 Ga0307416_1001037472 301
342 3300032002 Ga0307416_100360400 Ga0307416_1003604002 301
343 3300032004 Ga0307414_10036496 Ga0307414_100364963 301
344 3300032005 Ga0307411_10009714 Ga0307411_100097143 301
345 3300032005 Ga0307411_10029381 Ga0307411_100293813 301
346 3300032005 Ga0307411_10078788 Ga0307411_100787882 301
347 3300032005 Ga0307411_10126835 Ga0307411_101268352 301
348 3300032126 Ga0307415_100051944 Ga0307415_1000519442 301
349 3300032126 Ga0307415_100112844 Ga0307415_1001128443 301
350 3300037312 Ga0395899_0002137 Ga0395899_0002137_8789_9703 301
351 3300037312 Ga0395899_0008059 Ga0395899_0008059_6828_7748 301
352 3300037418 Ga0395900_0000547 Ga0395900_0000547_7130_8044 301
353 3300037418 Ga0395900_0047865 Ga0395900_0047865_2736_3662 301
354 3300037418 Ga0395900_0103899 Ga0395900_0103899_1369_2289 301
355 3300037418 Ga0395900_0136916 Ga0395900_0136916_129_1046 301
356 3300037418 Ga0395900_0156038 Ga0395900_0156038_446_1366 301
357 3300037466 Ga0395898_0006208 Ga0395898_0006208_11564_12478 301
358 3300037466 Ga0395898_0020677 Ga0395898_0020677_1130_2050 301
359 3300037471 Ga0395905_0001585 Ga0395905_0001585_22326_23240 301
360 3300037471 Ga0395905_0014142 Ga0395905_0014142_3694_4620 301
361 3300037471 Ga0395905_0031020 Ga0395905_0031020_677_1603 301
362 3300037471 Ga0395905_0142305 Ga0395905_0142305_1009_1917 301
363 3300037471 Ga0395905_0290919 Ga0395905_0290919_342_1262 301
364 3300037471 Ga0395905_0308119 Ga0395905_0308119_72_992 301
365 3300038443 Ga0395901_0000390 Ga0395901_0000390_44298_45212 301
366 3300038443 Ga0395901_0018305 Ga0395901_0018305_2588_3514 301
367 3300038443 Ga0395901_0026298 Ga0395901_0026298_1700_2626 301
368 3300038443 Ga0395901_0288444 Ga0395901_0288444_244_1164 301
369 3300042004 Ga0439445_0004822 Ga0439445_0004822_1014_1937 301
370 3300044656 Ga0466969_0003940 Ga0466969_0003940_2324_3244 301
371 3300044684 Ga0466966_0001131 Ga0466966_0001131_9247_10167 301
372 3300044694 Ga0466963_0002122 Ga0466963_0002122_8628_9548 301
373 3300044694 Ga0466963_0202328 Ga0466963_0202328_27_941 301
374 3300044719 Ga0466971_0008191 Ga0466971_0008191_2030_2950 301
375 3300044765 Ga0466970_0012351 Ga0466970_0012351_2445_3365 301
376 3300045049 Ga0466959_0001847 Ga0466959_0001847_6631_7551 301
377 3300045836 Ga0466958_0001033 Ga0466958_0001033_236_1156 301
378 3300045976 Ga0466967_0011883 Ga0466967_0011883_5545_6468 301
379 3300045976 Ga0466967_0035268 Ga0466967_0035268_2071_2985 301
380 3300045976 Ga0466967_0139145 Ga0466967_0139145_1259_2173 301
381 3300045976 Ga0466967_0403626 Ga0466967_0403626_159_1079 301
382 3300046539 Ga0495621_0100409 Ga0495621_0100409_28_945 301
383 3300001979 JGI24740J21852_10021054 JGI24740J21852_100210542 302
384 3300002075 JGI24738J21930_10008252 JGI24738J21930_100082523 302
385 3300005327 Ga0070658_10013311 Ga0070658_100133115 302
386 3300005327 Ga0070658_10124540 Ga0070658_101245402 302
387 3300005329 Ga0070683_100086759 Ga0070683_1000867592 302
388 3300005331 Ga0070670_100020507 Ga0070670_1000205072 302
389 3300005331 Ga0070670_100072317 Ga0070670_1000723172 302
390 3300005331 Ga0070670_100338527 Ga0070670_1003385272 302
391 3300005335 Ga0070666_10087949 Ga0070666_100879492 302
392 3300005337 Ga0070682_100095638 Ga0070682_1000956382 302
393 3300005344 Ga0070661_100229742 Ga0070661_1002297422 302
394 3300005344 Ga0070661_100269215 Ga0070661_1002692151 302
395 3300005354 Ga0070675_100013376 Ga0070675_1000133765 302
396 3300005355 Ga0070671_100042665 Ga0070671_1000426654 302
397 3300005355 Ga0070671_100302946 Ga0070671_1003029462 302
398 3300005364 Ga0070673_100082937 Ga0070673_1000829372 302
399 3300005367 Ga0070667_100038852 Ga0070667_1000388522 302
400 3300005455 Ga0070663_100221703 Ga0070663_1002217032 302
401 3300005457 Ga0070662_100042995 Ga0070662_1000429953 302
402 3300005457 Ga0070662_100433434 Ga0070662_1004334341 302
403 3300005535 Ga0070684_100351839 Ga0070684_1003518392 302
404 3300005539 Ga0068853_100471468 Ga0068853_1004714682 302
405 3300005548 Ga0070665_100136561 Ga0070665_1001365613 302
406 3300005564 Ga0070664_100050108 Ga0070664_1000501083 302
407 3300005564 Ga0070664_100165814 Ga0070664_1001658142 302
408 3300005577 Ga0068857_100016405 Ga0068857_1000164053 302
409 3300005577 Ga0068857_100101609 Ga0068857_1001016093 302
410 3300005578 Ga0068854_100017461 Ga0068854_1000174616 302
411 3300005614 Ga0068856_100060412 Ga0068856_1000604122 302
412 3300005614 Ga0068856_100103385 Ga0068856_1001033853 302
413 3300005616 Ga0068852_100151839 Ga0068852_1001518393 302
414 3300005617 Ga0068859_100044184 Ga0068859_1000441845 302
415 3300005617 Ga0068859_100098138 Ga0068859_1000981382 302
416 3300005618 Ga0068864_100050575 Ga0068864_1000505754 302
417 3300005618 Ga0068864_100074102 Ga0068864_1000741021 302
418 3300005834 Ga0068851_10004608 Ga0068851_100046082 302
419 3300005841 Ga0068863_100059852 Ga0068863_1000598523 302
420 3300005841 Ga0068863_100327335 Ga0068863_1003273352 302
421 3300005842 Ga0068858_100092411 Ga0068858_1000924112 302
422 3300006931 Ga0097620_100044180 Ga0097620_1000441802 302
423 3300006931 Ga0097620_100098134 Ga0097620_1000981342 302
424 3300013100 Ga0157373_10121640 Ga0157373_101216402 302
425 3300013102 Ga0157371_10305813 Ga0157371_103058132 302
426 3300013307 Ga0157372_10442824 Ga0157372_104428242 302
427 3300013308 Ga0157375_10212621 Ga0157375_102126213 302
428 3300014968 Ga0157379_10024258 Ga0157379_100242586 302
429 3300025321 Ga0207656_10014433 Ga0207656_100144332 302
430 3300025909 Ga0207705_10010424 Ga0207705_100104243 302
431 3300025919 Ga0207657_10011983 Ga0207657_100119837 302
432 3300025920 Ga0207649_10083898 Ga0207649_100838982 302
433 3300025920 Ga0207649_10197588 Ga0207649_101975882 302
434 3300025925 Ga0207650_10020423 Ga0207650_100204233 302
435 3300025925 Ga0207650_10075907 Ga0207650_100759072 302
436 3300025925 Ga0207650_10085904 Ga0207650_100859043 302
437 3300025926 Ga0207659_10017319 Ga0207659_100173194 302
438 3300025931 Ga0207644_10019319 Ga0207644_100193192 302
439 3300025933 Ga0207706_10064275 Ga0207706_100642752 302
440 3300025941 Ga0207711_10007329 Ga0207711_100073296 302
441 3300025945 Ga0207679_10019457 Ga0207679_100194575 302
442 3300025949 Ga0207667_10299104 Ga0207667_102991042 302
443 3300025981 Ga0207640_10033063 Ga0207640_100330633 302
444 3300025986 Ga0207658_10010410 Ga0207658_100104102 302
445 3300025986 Ga0207658_10076706 Ga0207658_100767063 302
446 3300025986 Ga0207658_10108279 Ga0207658_101082793 302
447 3300026035 Ga0207703_10203572 Ga0207703_102035722 302
448 3300026067 Ga0207678_10010845 Ga0207678_100108453 302
449 3300026078 Ga0207702_10013760 Ga0207702_100137603 302
450 3300026088 Ga0207641_10045988 Ga0207641_100459882 302
451 3300026088 Ga0207641_10329188 Ga0207641_103291882 302
452 3300026095 Ga0207676_10019259 Ga0207676_100192593 302
453 3300026095 Ga0207676_10056001 Ga0207676_100560014 302
454 3300026116 Ga0207674_10000583 Ga0207674_1000058319 302
455 3300026116 Ga0207674_10009484 Ga0207674_1000948410 302
456 3300031548 Ga0307408_100319678 Ga0307408_1003196782 302
457 3300031995 Ga0307409_100172093 Ga0307409_1001720933 302
458 3300032002 Ga0307416_100042470 Ga0307416_1000424703 302
459 3300032002 Ga0307416_100069133 Ga0307416_1000691333 302
460 3300032004 Ga0307414_10012727 Ga0307414_100127273 302
461 3300032005 Ga0307411_10345290 Ga0307411_103452901 302
462 3300032126 Ga0307415_100035198 Ga0307415_1000351983 302
463 3300032126 Ga0307415_100487700 Ga0307415_1004877001 302
464 3300037466 Ga0395898_0022731 Ga0395898_0022731_4130_5047 302
465 3300037471 Ga0395905_0003255 Ga0395905_0003255_15724_16641 302
466 3300037471 Ga0395905_0011267 Ga0395905_0011267_3546_4466 302
467 3300037471 Ga0395905_0019351 Ga0395905_0019351_2812_3729 302
468 3300037471 Ga0395905_0084062 Ga0395905_0084062_1562_2473 302
469 3300037471 Ga0395905_0205698 Ga0395905_0205698_142_1062 302
470 3300048906 Ga0496103_0075859 Ga0496103_0075859_672_1592 302
471 3300048907 Ga0496104_0141197 Ga0496104_0141197_44_961 302
472 3300048910 Ga0496107_0011979 Ga0496107_0011979_3782_4702 302
473 3300048911 Ga0496108_0009406 Ga0496108_0009406_354_1274 302
474 3300048911 Ga0496108_0022077 Ga0496108_0022077_462_1379 302
475 3300048912 Ga0496109_0010251 Ga0496109_0010251_6771_7691 302
476 3300048912 Ga0496109_0030504 Ga0496109_0030504_997_1914 302
477 3300048913 Ga0496110_0022920 Ga0496110_0022920_1118_2035 302
478 3300048913 Ga0496110_0053652 Ga0496110_0053652_1321_2241 302
479 3300048914 Ga0496111_0004353 Ga0496111_0004353_3966_4886 302
480 3300048915 Ga0496112_0115595 Ga0496112_0115595_370_1290 302
481 3300049583 Ga0501067_0029118 Ga0501067_0029118_20_937 302
482 3300037312 Ga0395899_0056894 Ga0395899_0056894_1945_2877 304
483 3300037418 Ga0395900_0032140 Ga0395900_0032140_895_1827 304
484 3300037471 Ga0395905_0006103 Ga0395905_0006103_6251_7183 304
485 3300042006 Ga0439432_021453 Ga0439432_021453_138_1067 304
486 3300002067 JGI24735J21928_10001840 JGI24735J21928_100018406 305
487 3300005327 Ga0070658_10039100 Ga0070658_100391003 305
488 3300005329 Ga0070683_100125044 Ga0070683_1001250442 305
489 3300005336 Ga0070680_100165227 Ga0070680_1001652272 305
490 3300005339 Ga0070660_100094162 Ga0070660_1000941622 305
491 3300005341 Ga0070691_10029852 Ga0070691_100298522 305
492 3300005344 Ga0070661_100036486 Ga0070661_1000364863 305
493 3300005355 Ga0070671_100029594 Ga0070671_1000295945 305
494 3300005366 Ga0070659_100023457 Ga0070659_1000234573 305
495 3300005530 Ga0070679_100149972 Ga0070679_1001499722 305
496 3300005539 Ga0068853_100097434 Ga0068853_1000974342 305
497 3300005563 Ga0068855_100025484 Ga0068855_1000254847 305
498 3300005577 Ga0068857_100035549 Ga0068857_1000355496 305
499 3300005578 Ga0068854_100044978 Ga0068854_1000449782 305
500 3300009093 Ga0105240_10028918 Ga0105240_100289183 305
501 3300009174 Ga0105241_10180765 Ga0105241_101807652 305
502 3300009545 Ga0105237_10228324 Ga0105237_102283243 305
503 3300009551 Ga0105238_10017606 Ga0105238_100176063 305
504 3300010375 Ga0105239_10024161 Ga0105239_100241612 305
505 3300013104 Ga0157370_10126560 Ga0157370_101265602 305
506 3300013307 Ga0157372_10160663 Ga0157372_101606632 305
507 3300013308 Ga0157375_10222464 Ga0157375_102224642 305
508 3300025904 Ga0207647_10007592 Ga0207647_100075923 305
509 3300025909 Ga0207705_10125282 Ga0207705_101252822 305
510 3300025911 Ga0207654_10082848 Ga0207654_100828482 305
511 3300025913 Ga0207695_10073014 Ga0207695_100730143 305
512 3300025917 Ga0207660_10173751 Ga0207660_101737512 305
513 3300025919 Ga0207657_10010311 Ga0207657_100103119 305
514 3300025921 Ga0207652_10157079 Ga0207652_101570793 305
515 3300025924 Ga0207694_10012784 Ga0207694_100127845 305
516 3300025931 Ga0207644_10062034 Ga0207644_100620343 305
517 3300025932 Ga0207690_10040610 Ga0207690_100406102 305
518 3300025949 Ga0207667_10017621 Ga0207667_100176219 305
519 3300025981 Ga0207640_10054029 Ga0207640_100540292 305
520 3300026041 Ga0207639_10000202 Ga0207639_1000020247 305
521 3300026116 Ga0207674_10080025 Ga0207674_100800253 305
522 3300046525 Ga0495663_0012690 Ga0495663_0012690_819_1748 305
523 3300046684 Ga0495669_0008078 Ga0495669_0008078_1669_2595 305
524 3300046684 Ga0495669_0023548 Ga0495669_0023548_1459_2388 305
525 3300047445 Ga0495677_0011550 Ga0495677_0011550_1767_2696 305
526 3300048904 Ga0496101_0024964 Ga0496101_0024964_710_1636 305
527 3300048910 Ga0496107_0079335 Ga0496107_0079335_1400_2326 305
528 3300048917 Ga0496114_0067747 Ga0496114_0067747_1756_2682 305
529 3300048918 Ga0496115_0000395 Ga0496115_0000395_9651_10577 305
530 3300005843 Ga0068860_100104970 Ga0068860_1001049702 306
531 3300006931 Ga0097620_100019684 Ga0097620_1000196842 306
532 3300025941 Ga0207711_10079003 Ga0207711_100790032 306
533 3300026088 Ga0207641_10363222 Ga0207641_103632222 306
534 3300028381 Ga0268264_10166075 Ga0268264_101660752 306
535 3300035691 Ga0373931_0089212 Ga0373931_0089212_581_1519 306
536 3300005354 Ga0070675_100137479 Ga0070675_1001374791 307
537 3300005457 Ga0070662_100080348 Ga0070662_1000803483 307
538 3300025933 Ga0207706_10044020 Ga0207706_100440202 307
539 3300026078 Ga0207702_10066037 Ga0207702_100660372 307
540 3300026095 Ga0207676_10154346 Ga0207676_101543461 307
541 3300037312 Ga0395899_0103100 Ga0395899_0103100_779_1702 307
542 3300037418 Ga0395900_0054101 Ga0395900_0054101_3123_4046 307
543 3300037466 Ga0395898_0132574 Ga0395898_0132574_930_1853 307
544 3300037471 Ga0395905_0037451 Ga0395905_0037451_2889_3812 307
545 3300005367 Ga0070667_100052950 Ga0070667_1000529504 308
546 3300005548 Ga0070665_100066840 Ga0070665_1000668403 308
547 3300005548 Ga0070665_100277481 Ga0070665_1002774812 308
548 3300005843 Ga0068860_100014445 Ga0068860_1000144456 308
549 3300005844 Ga0068862_100153718 Ga0068862_1001537182 308
550 3300006237 Ga0097621_100027147 Ga0097621_1000271472 308
551 3300006358 Ga0068871_100244065 Ga0068871_1002440652 308
552 3300013308 Ga0157375_10052488 Ga0157375_100524882 308
553 3300025901 Ga0207688_10030623 Ga0207688_100306233 308
554 3300025923 Ga0207681_10394542 Ga0207681_103945421 308
555 3300025986 Ga0207658_10048630 Ga0207658_100486302 308
556 3300026075 Ga0207708_10160320 Ga0207708_101603202 308
557 3300026088 Ga0207641_10167761 Ga0207641_101677613 308
558 3300028379 Ga0268266_10006543 Ga0268266_1000654312 308
559 3300028379 Ga0268266_10020540 Ga0268266_100205404 308
560 3300028380 Ga0268265_10010441 Ga0268265_100104414 308
561 3300038443 Ga0395901_0189345 Ga0395901_0189345_1036_1977 308
562 3300001979 JGI24740J21852_10002302 JGI24740J21852_100023029 310
563 3300001989 JGI24739J22299_10000793 JGI24739J22299_1000079313 310
564 3300001990 JGI24737J22298_10000350 JGI24737J22298_1000035013 310
565 3300002075 JGI24738J21930_10000467 JGI24738J21930_1000046712 310
566 3300005328 Ga0070676_10000734 Ga0070676_100007341 310
567 3300005330 Ga0070690_100012570 Ga0070690_1000125704 310
568 3300005331 Ga0070670_100004152 Ga0070670_10000415213 310
569 3300005334 Ga0068869_100000074 Ga0068869_10000007440 310
570 3300005335 Ga0070666_10005823 Ga0070666_100058237 310
571 3300005338 Ga0068868_100000398 Ga0068868_10000039814 310
572 3300005339 Ga0070660_100014181 Ga0070660_1000141816 310
573 3300005343 Ga0070687_100123771 Ga0070687_1001237712 310
574 3300005353 Ga0070669_100000197 Ga0070669_10000019729 310
575 3300005354 Ga0070675_100019757 Ga0070675_1000197576 310
576 3300005355 Ga0070671_100010345 Ga0070671_1000103456 310
577 3300005356 Ga0070674_100166429 Ga0070674_1001664292 310
578 3300005364 Ga0070673_100000899 Ga0070673_10000089915 310
579 3300005366 Ga0070659_100000791 Ga0070659_10000079115 310
580 3300005367 Ga0070667_100000876 Ga0070667_10000087610 310
581 3300005455 Ga0070663_100080086 Ga0070663_1000800862 310
582 3300005457 Ga0070662_100000334 Ga0070662_1000003343 310
583 3300005459 Ga0068867_100000836 Ga0068867_10000083613 310
584 3300005539 Ga0068853_100004030 Ga0068853_1000040304 310
585 3300005543 Ga0070672_100000227 Ga0070672_10000022722 310
586 3300005563 Ga0068855_100001413 Ga0068855_1000014138 310
587 3300005564 Ga0070664_100067183 Ga0070664_1000671833 310
588 3300005577 Ga0068857_100003529 Ga0068857_1000035299 310
589 3300005578 Ga0068854_100000549 Ga0068854_10000054913 310
590 3300005616 Ga0068852_100000835 Ga0068852_10000083513 310
591 3300005617 Ga0068859_100001673 Ga0068859_1000016733 310
592 3300005618 Ga0068864_100000393 Ga0068864_10000039313 310
593 3300005718 Ga0068866_10152292 Ga0068866_101522922 310
594 3300005719 Ga0068861_100094314 Ga0068861_1000943142 310
595 3300005834 Ga0068851_10034705 Ga0068851_100347052 310
596 3300005841 Ga0068863_100002359 Ga0068863_1000023594 310
597 3300005842 Ga0068858_100014208 Ga0068858_1000142086 310
598 3300005843 Ga0068860_100000516 Ga0068860_10000051610 310
599 3300006237 Ga0097621_100116221 Ga0097621_1001162212 310
600 3300006881 Ga0068865_100105291 Ga0068865_1001052913 310
601 3300006931 Ga0097620_100001673 Ga0097620_1000016733 310
602 3300009098 Ga0105245_10000068 Ga0105245_1000006881 310
603 3300009148 Ga0105243_10062506 Ga0105243_100625064 310
604 3300009177 Ga0105248_10001005 Ga0105248_1000100535 310
605 3300010375 Ga0105239_10287913 Ga0105239_102879132 310
606 3300011119 Ga0105246_10010038 Ga0105246_100100386 310
607 3300013100 Ga0157373_10134657 Ga0157373_101346572 310
608 3300013102 Ga0157371_10003274 Ga0157371_100032743 310
609 3300013297 Ga0157378_10012488 Ga0157378_100124888 310
610 3300013308 Ga0157375_10029627 Ga0157375_100296273 310
611 3300025315 Ga0207697_10000007 Ga0207697_1000000733 310
612 3300025901 Ga0207688_10000333 Ga0207688_1000033315 310
613 3300025903 Ga0207680_10003077 Ga0207680_100030777 310
614 3300025904 Ga0207647_10001004 Ga0207647_1000100416 310
615 3300025907 Ga0207645_10001287 Ga0207645_1000128717 310
616 3300025908 Ga0207643_10046997 Ga0207643_100469973 310
617 3300025923 Ga0207681_10000695 Ga0207681_100006952 310
618 3300025924 Ga0207694_10201620 Ga0207694_102016202 310
619 3300025925 Ga0207650_10005581 Ga0207650_100055818 310
620 3300025926 Ga0207659_10020590 Ga0207659_100205905 310
621 3300025931 Ga0207644_10032443 Ga0207644_100324432 310
622 3300025932 Ga0207690_10001169 Ga0207690_1000116913 310
623 3300025933 Ga0207706_10000766 Ga0207706_1000076612 310
624 3300025938 Ga0207704_10079889 Ga0207704_100798892 310
625 3300025940 Ga0207691_10000493 Ga0207691_1000049312 310
626 3300025941 Ga0207711_10000591 Ga0207711_1000059112 310
627 3300025942 Ga0207689_10000131 Ga0207689_1000013112 310
628 3300025945 Ga0207679_10138590 Ga0207679_101385902 310
629 3300025949 Ga0207667_10001522 Ga0207667_1000152229 310
630 3300025981 Ga0207640_10001011 Ga0207640_100010116 310
631 3300025986 Ga0207658_10005298 Ga0207658_1000529811 310
632 3300026023 Ga0207677_10001334 Ga0207677_100013345 310
633 3300026035 Ga0207703_10002138 Ga0207703_100021384 310
634 3300026067 Ga0207678_10065666 Ga0207678_100656663 310
635 3300026088 Ga0207641_10003184 Ga0207641_100031844 310
636 3300026089 Ga0207648_10000752 Ga0207648_1000075235 310
637 3300026089 Ga0207648_10007939 Ga0207648_100079397 310
638 3300026095 Ga0207676_10000257 Ga0207676_1000025753 310
639 3300026116 Ga0207674_10007066 Ga0207674_100070669 310
640 3300026142 Ga0207698_10002711 Ga0207698_100027117 310
641 3300026142 Ga0207698_10008466 Ga0207698_100084662 310
642 3300028381 Ga0268264_10001215 Ga0268264_1000121518 310
643 3300031903 Ga0307407_10025711 Ga0307407_100257113 310
644 3300032002 Ga0307416_100107416 Ga0307416_1001074163 310
645 3300032126 Ga0307415_100094803 Ga0307415_1000948031 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

71

265

0.84

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

87

229

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mfi-assembly1.cif.gz_A mim-2 metallo-beta-lactamase 0.9852 34 298
4awy-assembly1.cif.gz_B crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157 0.9772 42 300
4ax1-assembly1.cif.gz_B q157n mutant. crystal structure of the mobile metallo-beta-lactamase aim-1 from pseudomonas aeruginosa: insights into antibiotic binding and the role of gln157 0.9769 42 300
4p62-assembly1.cif.gz_A-2 directed evolution of a b3 metallo-beta-lactamase aim-1 0.9763 46 300
6auf-assembly1.cif.gz_B crystal structure of metalo beta lactamases mim-1 from novosphingobium pentaromativorans 0.9746 38 301
ID Description Score Start End Superfamily
4awzB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9777 42 300 3.60.15.10
5iqkA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9663 49 299 3.60.15.10
3vqzA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9633 48 298 3.60.15.10
4awzB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9453 42 300 3.60.15.10
3vqzA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9376 48 298 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A0U2ZZ06-F1-model_v4 Metallo-beta-lactamase superfamily 0.992 52 134
AF-A0A3D4LXV3-F1-model_v4 deleted 0.9896 43 243
AF-A0A520XXA2-F1-model_v4 Subclass B3 metallo-beta-lactamase 0.9894 48 299
AF-A0A2V8K2U4-F1-model_v4 Subclass B3 metallo-beta-lactamase 0.9848 51 136
AF-A0A059WNY4-F1-model_v4 ClassB_beta_lactamase 0.9847 49 121

Feature Viewer

pLDDT pTM Quality
91.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map