F472145
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 645 | 191 | 645 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_1299699|Ga0395901_1299699_174_602 |
| Length | 142 |
| Sequence | LGSLSQGVQALTTRTASCRCGQLAVTVSGDPVRVSVCHCLACQKRTGSIFSAQARWPAECVTIEGRSNSWTRTADSGQTTTYHFCPDCGSTVHYSGGNFPDVIAVPLGAFDDPYIASPDYSVWERRRHDWIEILGDDVQHSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 147 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.2 |
| Rhizosphere | 93.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1004450 | 3300001976 | Bacteria | 1838 |
| 2 | Ga0070658_10158939 | 3300005327 | Bacteria | 1895 |
| 3 | Ga0070658_10408021 | 3300005327 | Bacteria | 1167 |
| 4 | Ga0070658_10505161 | 3300005327 | Bacteria | 1044 |
| 5 | Ga0070658_10509695 | 3300005327 | Bacteria | 1040 |
| 6 | Ga0070658_10593048 | 3300005327 | Unclassified | 960 |
| 7 | Ga0070658_10980099 | 3300005327 | Bacteria | 735 |
| 8 | Ga0070676_10038579 | 3300005328 | Bacteria | 2759 |
| 9 | Ga0070676_10112069 | 3300005328 | Bacteria | 1700 |
| 10 | Ga0070676_10139686 | 3300005328 | Bacteria | 1541 |
| 11 | Ga0070676_10227229 | 3300005328 | Bacteria | 1235 |
| 12 | Ga0070676_10704290 | 3300005328 | Bacteria | 738 |
| 13 | Ga0070683_100758703 | 3300005329 | Bacteria | 929 |
| 14 | Ga0070683_101835939 | 3300005329 | Bacteria | 583 |
| 15 | Ga0070690_100053796 | 3300005330 | Bacteria | 2576 |
| 16 | Ga0070690_100524191 | 3300005330 | Bacteria | 890 |
| 17 | Ga0070690_101153317 | 3300005330 | Unclassified | 616 |
| 18 | Ga0070670_100005424 | 3300005331 | Bacteria | 10761 |
| 19 | Ga0070670_100008941 | 3300005331 | Bacteria | 8555 |
| 20 | Ga0070670_100043864 | 3300005331 | Bacteria | 3845 |
| 21 | Ga0070670_101379691 | 3300005331 | Bacteria | 646 |
| 22 | Ga0070677_10053294 | 3300005333 | Bacteria | 1644 |
| 23 | Ga0068869_100202591 | 3300005334 | Bacteria | 1565 |
| 24 | Ga0070666_10051732 | 3300005335 | Bacteria | 2767 |
| 25 | Ga0070666_10072580 | 3300005335 | Bacteria | 2343 |
| 26 | Ga0070666_10101684 | 3300005335 | Bacteria | 1981 |
| 27 | Ga0070666_10158072 | 3300005335 | Bacteria | 1583 |
| 28 | Ga0070666_10637048 | 3300005335 | Bacteria | 779 |
| 29 | Ga0070680_100247940 | 3300005336 | Bacteria | 1506 |
| 30 | Ga0070682_100306371 | 3300005337 | Bacteria | 1168 |
| 31 | Ga0068868_100000540 | 3300005338 | Bacteria | 25382 |
| 32 | Ga0068868_100072054 | 3300005338 | Bacteria | 2756 |
| 33 | Ga0068868_100092462 | 3300005338 | Bacteria | 2438 |
| 34 | Ga0068868_100104094 | 3300005338 | Bacteria | 2300 |
| 35 | Ga0068868_100160360 | 3300005338 | Bacteria | 1857 |
| 36 | Ga0068868_101185848 | 3300005338 | Bacteria | 705 |
| 37 | Ga0070660_100061065 | 3300005339 | Bacteria | 2926 |
| 38 | Ga0070660_100171735 | 3300005339 | Bacteria | 1751 |
| 39 | Ga0070660_100250894 | 3300005339 | Bacteria | 1443 |
| 40 | Ga0070660_100337498 | 3300005339 | Bacteria | 1240 |
| 41 | Ga0070691_10464412 | 3300005341 | Bacteria | 725 |
| 42 | Ga0070661_100001787 | 3300005344 | Bacteria | 14912 |
| 43 | Ga0070661_100132888 | 3300005344 | Bacteria | 1870 |
| 44 | Ga0070661_100170200 | 3300005344 | Bacteria | 1654 |
| 45 | Ga0070661_100225175 | 3300005344 | Bacteria | 1440 |
| 46 | Ga0070661_100229785 | 3300005344 | Bacteria | 1425 |
| 47 | Ga0070661_100482783 | 3300005344 | Bacteria | 990 |
| 48 | Ga0070661_100567258 | 3300005344 | Bacteria | 915 |
| 49 | Ga0070668_100065229 | 3300005347 | Bacteria | 2824 |
| 50 | Ga0070668_100488648 | 3300005347 | Bacteria | 1064 |
| 51 | Ga0070668_100699248 | 3300005347 | Bacteria | 894 |
| 52 | Ga0070668_101556798 | 3300005347 | Bacteria | 605 |
| 53 | Ga0070669_101349363 | 3300005353 | Unclassified | 618 |
| 54 | Ga0070675_100128723 | 3300005354 | Bacteria | 2156 |
| 55 | Ga0070675_100528418 | 3300005354 | Bacteria | 1065 |
| 56 | Ga0070675_101247776 | 3300005354 | Bacteria | 684 |
| 57 | Ga0070671_100004155 | 3300005355 | Bacteria | 11437 |
| 58 | Ga0070671_100010022 | 3300005355 | Bacteria | 7610 |
| 59 | Ga0070671_100013985 | 3300005355 | Bacteria | 6479 |
| 60 | Ga0070671_100040667 | 3300005355 | Bacteria | 3862 |
| 61 | Ga0070671_100120942 | 3300005355 | Bacteria | 2203 |
| 62 | Ga0070671_100143244 | 3300005355 | Bacteria | 2017 |
| 63 | Ga0070671_100209701 | 3300005355 | Bacteria | 1652 |
| 64 | Ga0070671_100451106 | 3300005355 | Bacteria | 1103 |
| 65 | Ga0070671_100910496 | 3300005355 | Bacteria | 768 |
| 66 | Ga0070671_101148186 | 3300005355 | Bacteria | 683 |
| 67 | Ga0070674_100128411 | 3300005356 | Bacteria | 1886 |
| 68 | Ga0070674_100182251 | 3300005356 | Bacteria | 1609 |
| 69 | Ga0070674_100372069 | 3300005356 | Bacteria | 1160 |
| 70 | Ga0070674_100481754 | 3300005356 | Bacteria | 1030 |
| 71 | Ga0070674_101146326 | 3300005356 | Unclassified | 688 |
| 72 | Ga0070674_101385008 | 3300005356 | Bacteria | 629 |
| 73 | Ga0070673_100018567 | 3300005364 | Bacteria | 4972 |
| 74 | Ga0070673_100025353 | 3300005364 | Bacteria | 4363 |
| 75 | Ga0070673_100028572 | 3300005364 | Bacteria | 4149 |
| 76 | Ga0070673_100260650 | 3300005364 | Bacteria | 1514 |
| 77 | Ga0070673_100370795 | 3300005364 | Bacteria | 1275 |
| 78 | Ga0070673_100563574 | 3300005364 | Bacteria | 1036 |
| 79 | Ga0070673_100961889 | 3300005364 | Bacteria | 794 |
| 80 | Ga0070673_100974861 | 3300005364 | Bacteria | 788 |
| 81 | Ga0070673_101273476 | 3300005364 | Bacteria | 690 |
| 82 | Ga0070688_100583001 | 3300005365 | Bacteria | 854 |
| 83 | Ga0070659_100046830 | 3300005366 | Bacteria | 3390 |
| 84 | Ga0070659_100059277 | 3300005366 | Bacteria | 3022 |
| 85 | Ga0070659_100155664 | 3300005366 | Bacteria | 1866 |
| 86 | Ga0070659_100269345 | 3300005366 | Bacteria | 1415 |
| 87 | Ga0070659_100370805 | 3300005366 | Bacteria | 1204 |
| 88 | Ga0070659_100387064 | 3300005366 | Bacteria | 1179 |
| 89 | Ga0070659_100394480 | 3300005366 | Bacteria | 1167 |
| 90 | Ga0070659_100418808 | 3300005366 | Bacteria | 1133 |
| 91 | Ga0070659_101146618 | 3300005366 | Bacteria | 686 |
| 92 | Ga0070659_101328501 | 3300005366 | Unclassified | 638 |
| 93 | Ga0070659_101416061 | 3300005366 | Bacteria | 618 |
| 94 | Ga0070667_100001880 | 3300005367 | Bacteria | 18647 |
| 95 | Ga0070667_100020050 | 3300005367 | Bacteria | 5551 |
| 96 | Ga0070667_100141414 | 3300005367 | Bacteria | 2108 |
| 97 | Ga0070667_100234708 | 3300005367 | Bacteria | 1636 |
| 98 | Ga0070667_100868521 | 3300005367 | Bacteria | 839 |
| 99 | Ga0070709_10003770 | 3300005434 | Bacteria | 8148 |
| 100 | Ga0070714_100048977 | 3300005435 | Bacteria | 3596 |
| 101 | Ga0070714_100062778 | 3300005435 | Bacteria | 3193 |
| 102 | Ga0070714_100152133 | 3300005435 | Bacteria | 2086 |
| 103 | Ga0070714_100196179 | 3300005435 | Bacteria | 1845 |
| 104 | Ga0070713_100047052 | 3300005436 | Bacteria | 3543 |
| 105 | Ga0070713_100385239 | 3300005436 | Bacteria | 1307 |
| 106 | Ga0070713_100569164 | 3300005436 | Bacteria | 1074 |
| 107 | Ga0070663_100044752 | 3300005455 | Bacteria | 3123 |
| 108 | Ga0070663_100184951 | 3300005455 | Bacteria | 1619 |
| 109 | Ga0070663_100653755 | 3300005455 | Bacteria | 889 |
| 110 | Ga0070663_101049410 | 3300005455 | Bacteria | 710 |
| 111 | Ga0070678_100010304 | 3300005456 | Bacteria | 5702 |
| 112 | Ga0070678_100036424 | 3300005456 | Bacteria | 3444 |
| 113 | Ga0070678_100040711 | 3300005456 | Bacteria | 3289 |
| 114 | Ga0070678_100213112 | 3300005456 | Bacteria | 1601 |
| 115 | Ga0070678_100570838 | 3300005456 | Bacteria | 1006 |
| 116 | Ga0070662_100019488 | 3300005457 | Bacteria | 4605 |
| 117 | Ga0070662_100069793 | 3300005457 | Bacteria | 2588 |
| 118 | Ga0070662_100145706 | 3300005457 | Bacteria | 1839 |
| 119 | Ga0070662_100204462 | 3300005457 | Bacteria | 1568 |
| 120 | Ga0070662_100266010 | 3300005457 | Bacteria | 1383 |
| 121 | Ga0070662_101115523 | 3300005457 | Bacteria | 677 |
| 122 | Ga0070662_101502810 | 3300005457 | Bacteria | 581 |
| 123 | Ga0070681_10010289 | 3300005458 | Bacteria | 9233 |
| 124 | Ga0070681_10177119 | 3300005458 | Bacteria | 2054 |
| 125 | Ga0068867_100188650 | 3300005459 | Bacteria | 1644 |
| 126 | Ga0068867_100203682 | 3300005459 | Bacteria | 1585 |
| 127 | Ga0068867_100948852 | 3300005459 | Unclassified | 777 |
| 128 | Ga0068867_102102630 | 3300005459 | Bacteria | 535 |
| 129 | Ga0070685_10082358 | 3300005466 | Bacteria | 1931 |
| 130 | Ga0070679_101268783 | 3300005530 | Bacteria | 682 |
| 131 | Ga0068853_100064967 | 3300005539 | Bacteria | 3166 |
| 132 | Ga0068853_100397631 | 3300005539 | Bacteria | 1289 |
| 133 | Ga0068853_100645894 | 3300005539 | Bacteria | 1007 |
| 134 | Ga0068853_100737957 | 3300005539 | Bacteria | 941 |
| 135 | Ga0068853_101051084 | 3300005539 | Bacteria | 785 |
| 136 | Ga0068853_101534087 | 3300005539 | Unclassified | 645 |
| 137 | Ga0070672_100007583 | 3300005543 | Bacteria | 7375 |
| 138 | Ga0070672_100173189 | 3300005543 | Bacteria | 1796 |
| 139 | Ga0070672_100240337 | 3300005543 | Bacteria | 1523 |
| 140 | Ga0070672_100591832 | 3300005543 | Bacteria | 965 |
| 141 | Ga0070672_100602163 | 3300005543 | Bacteria | 957 |
| 142 | Ga0070672_100796245 | 3300005543 | Bacteria | 831 |
| 143 | Ga0070672_100831396 | 3300005543 | Bacteria | 814 |
| 144 | Ga0070686_100022420 | 3300005544 | Bacteria | 3761 |
| 145 | Ga0070686_100197270 | 3300005544 | Bacteria | 1440 |
| 146 | Ga0070686_100450563 | 3300005544 | Bacteria | 989 |
| 147 | Ga0070696_100377654 | 3300005546 | Bacteria | 1104 |
| 148 | Ga0070693_100018738 | 3300005547 | Bacteria | 3620 |
| 149 | Ga0070693_100744407 | 3300005547 | Bacteria | 722 |
| 150 | Ga0070665_100378184 | 3300005548 | Bacteria | 1423 |
| 151 | Ga0070665_100683022 | 3300005548 | Bacteria | 1040 |
| 152 | Ga0070665_100839882 | 3300005548 | Unclassified | 932 |
| 153 | Ga0068855_100534714 | 3300005563 | Bacteria | 1270 |
| 154 | Ga0068855_100788904 | 3300005563 | Unclassified | 1010 |
| 155 | Ga0068855_100941403 | 3300005563 | Bacteria | 910 |
| 156 | Ga0068855_102089893 | 3300005563 | Bacteria | 570 |
| 157 | Ga0070664_100007255 | 3300005564 | Bacteria | 8935 |
| 158 | Ga0070664_100015505 | 3300005564 | Bacteria | 6235 |
| 159 | Ga0070664_100284958 | 3300005564 | Bacteria | 1490 |
| 160 | Ga0070664_100425667 | 3300005564 | Bacteria | 1216 |
| 161 | Ga0070664_100650032 | 3300005564 | Bacteria | 980 |
| 162 | Ga0070664_100801285 | 3300005564 | Bacteria | 881 |
| 163 | Ga0070664_100891242 | 3300005564 | Bacteria | 834 |
| 164 | Ga0070664_100919151 | 3300005564 | Bacteria | 821 |
| 165 | Ga0070664_101685349 | 3300005564 | Bacteria | 601 |
| 166 | Ga0068857_100063269 | 3300005577 | Bacteria | 3289 |
| 167 | Ga0068854_100013020 | 3300005578 | Bacteria | 5451 |
| 168 | Ga0068854_100202678 | 3300005578 | Bacteria | 1560 |
| 169 | Ga0068854_100396082 | 3300005578 | Bacteria | 1141 |
| 170 | Ga0068854_100653950 | 3300005578 | Bacteria | 903 |
| 171 | Ga0068854_100796394 | 3300005578 | Bacteria | 823 |
| 172 | Ga0068854_101078855 | 3300005578 | Bacteria | 714 |
| 173 | Ga0068856_100282835 | 3300005614 | Bacteria | 1675 |
| 174 | Ga0068856_100536898 | 3300005614 | Bacteria | 1191 |
| 175 | Ga0068856_102551716 | 3300005614 | Unclassified | 517 |
| 176 | Ga0068852_100013389 | 3300005616 | Bacteria | 6278 |
| 177 | Ga0068852_100056428 | 3300005616 | Bacteria | 3394 |
| 178 | Ga0068852_100084393 | 3300005616 | Bacteria | 2827 |
| 179 | Ga0068852_100137216 | 3300005616 | Bacteria | 2259 |
| 180 | Ga0068852_100751407 | 3300005616 | Bacteria | 987 |
| 181 | Ga0068852_101091303 | 3300005616 | Bacteria | 818 |
| 182 | Ga0068859_100114674 | 3300005617 | Bacteria | 2759 |
| 183 | Ga0068859_100140847 | 3300005617 | Bacteria | 2485 |
| 184 | Ga0068859_100224941 | 3300005617 | Bacteria | 1964 |
| 185 | Ga0068859_101566274 | 3300005617 | Unclassified | 728 |
| 186 | Ga0068864_100071466 | 3300005618 | Bacteria | 3022 |
| 187 | Ga0068864_100491847 | 3300005618 | Bacteria | 1179 |
| 188 | Ga0068864_100860862 | 3300005618 | Bacteria | 893 |
| 189 | Ga0068864_101611672 | 3300005618 | Bacteria | 653 |
| 190 | Ga0068866_10740771 | 3300005718 | Bacteria | 678 |
| 191 | Ga0068851_10193500 | 3300005834 | Bacteria | 1132 |
| 192 | Ga0068851_10559476 | 3300005834 | Bacteria | 692 |
| 193 | Ga0068851_10688108 | 3300005834 | Bacteria | 629 |
| 194 | Ga0068863_100061135 | 3300005841 | Bacteria | 3561 |
| 195 | Ga0068863_100448267 | 3300005841 | Bacteria | 1266 |
| 196 | Ga0068863_100828140 | 3300005841 | Bacteria | 924 |
| 197 | Ga0068858_100014273 | 3300005842 | Bacteria | 7490 |
| 198 | Ga0068858_100014925 | 3300005842 | Bacteria | 7309 |
| 199 | Ga0068858_100079403 | 3300005842 | Bacteria | 3049 |
| 200 | Ga0068858_100440726 | 3300005842 | Bacteria | 1254 |
| 201 | Ga0068858_101292395 | 3300005842 | Bacteria | 718 |
| 202 | Ga0068858_101959175 | 3300005842 | Bacteria | 579 |
| 203 | Ga0068858_102393672 | 3300005842 | Bacteria | 522 |
| 204 | Ga0068860_100110137 | 3300005843 | Bacteria | 2632 |
| 205 | Ga0068862_100007719 | 3300005844 | Bacteria | 8898 |
| 206 | Ga0068862_101381899 | 3300005844 | Bacteria | 707 |
| 207 | Ga0070717_10005953 | 3300006028 | Bacteria | 8929 |
| 208 | Ga0070717_10300641 | 3300006028 | Bacteria | 1427 |
| 209 | Ga0070717_10482695 | 3300006028 | Bacteria | 1119 |
| 210 | Ga0070716_100060089 | 3300006173 | Bacteria | 2194 |
| 211 | Ga0070712_100035780 | 3300006175 | Bacteria | 3373 |
| 212 | Ga0097621_100507081 | 3300006237 | Bacteria | 1093 |
| 213 | Ga0097621_100607773 | 3300006237 | Bacteria | 1000 |
| 214 | Ga0097621_102266349 | 3300006237 | Unclassified | 520 |
| 215 | Ga0068871_100028454 | 3300006358 | Bacteria | 4381 |
| 216 | Ga0068871_100128772 | 3300006358 | Bacteria | 2144 |
| 217 | Ga0068871_100388942 | 3300006358 | Bacteria | 1240 |
| 218 | Ga0097620_100114673 | 3300006931 | Bacteria | 2759 |
| 219 | Ga0097620_100140845 | 3300006931 | Bacteria | 2485 |
| 220 | Ga0097620_100224935 | 3300006931 | Bacteria | 1964 |
| 221 | Ga0097620_101566326 | 3300006931 | Unclassified | 728 |
| 222 | Ga0105245_10105004 | 3300009098 | Bacteria | 2620 |
| 223 | Ga0105245_10469794 | 3300009098 | Bacteria | 1269 |
| 224 | Ga0105247_11194476 | 3300009101 | Bacteria | 605 |
| 225 | Ga0105241_11096558 | 3300009174 | Bacteria | 749 |
| 226 | Ga0105241_11247336 | 3300009174 | Bacteria | 706 |
| 227 | Ga0105248_10002275 | 3300009177 | Bacteria | 21260 |
| 228 | Ga0105248_10054556 | 3300009177 | Bacteria | 4482 |
| 229 | Ga0105248_10178932 | 3300009177 | Bacteria | 2390 |
| 230 | Ga0105248_10434885 | 3300009177 | Bacteria | 1478 |
| 231 | Ga0105248_10438163 | 3300009177 | Bacteria | 1472 |
| 232 | Ga0105248_10481895 | 3300009177 | Bacteria | 1398 |
| 233 | Ga0105248_11171501 | 3300009177 | Bacteria | 869 |
| 234 | Ga0105237_12342428 | 3300009545 | Unclassified | 544 |
| 235 | Ga0105238_10249509 | 3300009551 | Bacteria | 1753 |
| 236 | Ga0105249_10171397 | 3300009553 | Bacteria | 2105 |
| 237 | Ga0105246_10985726 | 3300011119 | Unclassified | 762 |
| 238 | Ga0105246_11049524 | 3300011119 | Bacteria | 741 |
| 239 | Ga0157373_10007653 | 3300013100 | Bacteria | 8027 |
| 240 | Ga0157373_10144492 | 3300013100 | Bacteria | 1673 |
| 241 | Ga0157373_10165418 | 3300013100 | Unclassified | 1557 |
| 242 | Ga0157373_10192740 | 3300013100 | Bacteria | 1436 |
| 243 | Ga0157373_10916228 | 3300013100 | Bacteria | 651 |
| 244 | Ga0157371_10367166 | 3300013102 | Bacteria | 1049 |
| 245 | Ga0157371_10506977 | 3300013102 | Bacteria | 891 |
| 246 | Ga0157371_11178765 | 3300013102 | Bacteria | 590 |
| 247 | Ga0157371_11593654 | 3300013102 | Bacteria | 511 |
| 248 | Ga0157370_10267251 | 3300013104 | Bacteria | 1580 |
| 249 | Ga0157370_10444054 | 3300013104 | Bacteria | 1193 |
| 250 | Ga0157369_10233366 | 3300013105 | Bacteria | 1923 |
| 251 | Ga0157374_10006812 | 3300013296 | Bacteria | 9720 |
| 252 | Ga0157374_10060461 | 3300013296 | Bacteria | 3545 |
| 253 | Ga0157374_10622018 | 3300013296 | Bacteria | 1090 |
| 254 | Ga0157374_11922130 | 3300013296 | Bacteria | 618 |
| 255 | Ga0157378_10142862 | 3300013297 | Bacteria | 2224 |
| 256 | Ga0157378_10763158 | 3300013297 | Bacteria | 991 |
| 257 | Ga0163162_10060277 | 3300013306 | Bacteria | 3830 |
| 258 | Ga0163162_10297777 | 3300013306 | Bacteria | 1745 |
| 259 | Ga0163162_11291182 | 3300013306 | Bacteria | 829 |
| 260 | Ga0157372_10897301 | 3300013307 | Bacteria | 1028 |
| 261 | Ga0157372_12451678 | 3300013307 | Bacteria | 599 |
| 262 | Ga0157372_13166674 | 3300013307 | Bacteria | 525 |
| 263 | Ga0157375_10002069 | 3300013308 | Bacteria | 17350 |
| 264 | Ga0157375_10970534 | 3300013308 | Bacteria | 991 |
| 265 | Ga0157375_11191729 | 3300013308 | Bacteria | 893 |
| 266 | Ga0157375_13747907 | 3300013308 | Bacteria | 505 |
| 267 | Ga0157375_13747909 | 3300013308 | Unclassified | 505 |
| 268 | Ga0163163_10132101 | 3300014325 | Bacteria | 2537 |
| 269 | Ga0182008_10218369 | 3300014497 | Bacteria | 975 |
| 270 | Ga0157379_10185574 | 3300014968 | Bacteria | 1879 |
| 271 | Ga0157379_10330052 | 3300014968 | Bacteria | 1394 |
| 272 | Ga0157379_10957066 | 3300014968 | Bacteria | 814 |
| 273 | Ga0163161_10754500 | 3300017792 | Unclassified | 814 |
| 274 | Ga0207697_10226495 | 3300025315 | Bacteria | 825 |
| 275 | Ga0207697_10331490 | 3300025315 | Unclassified | 676 |
| 276 | Ga0207656_10439753 | 3300025321 | Bacteria | 658 |
| 277 | Ga0207682_10103223 | 3300025893 | Bacteria | 1248 |
| 278 | Ga0207682_10376467 | 3300025893 | Bacteria | 670 |
| 279 | Ga0207710_10324980 | 3300025900 | Bacteria | 780 |
| 280 | Ga0207688_10181146 | 3300025901 | Bacteria | 1256 |
| 281 | Ga0207688_10221714 | 3300025901 | Bacteria | 1139 |
| 282 | Ga0207688_10331347 | 3300025901 | Bacteria | 935 |
| 283 | Ga0207680_10001045 | 3300025903 | Bacteria | 13070 |
| 284 | Ga0207680_10074839 | 3300025903 | Bacteria | 2110 |
| 285 | Ga0207680_10098215 | 3300025903 | Bacteria | 1876 |
| 286 | Ga0207680_10166118 | 3300025903 | Bacteria | 1483 |
| 287 | Ga0207680_10280832 | 3300025903 | Bacteria | 1157 |
| 288 | Ga0207680_10289930 | 3300025903 | Bacteria | 1139 |
| 289 | Ga0207680_10375760 | 3300025903 | Bacteria | 1001 |
| 290 | Ga0207647_10151397 | 3300025904 | Bacteria | 1356 |
| 291 | Ga0207699_10084968 | 3300025906 | Bacteria | 1972 |
| 292 | Ga0207645_10071914 | 3300025907 | Bacteria | 2214 |
| 293 | Ga0207645_10102506 | 3300025907 | Bacteria | 1847 |
| 294 | Ga0207645_10325531 | 3300025907 | Bacteria | 1026 |
| 295 | Ga0207645_10644589 | 3300025907 | Bacteria | 720 |
| 296 | Ga0207645_10874531 | 3300025907 | Unclassified | 611 |
| 297 | Ga0207705_10038128 | 3300025909 | Bacteria | 3440 |
| 298 | Ga0207705_10110496 | 3300025909 | Bacteria | 2031 |
| 299 | Ga0207705_10133292 | 3300025909 | Bacteria | 1850 |
| 300 | Ga0207705_10197698 | 3300025909 | Bacteria | 1523 |
| 301 | Ga0207705_10651975 | 3300025909 | Bacteria | 819 |
| 302 | Ga0207705_10902217 | 3300025909 | Bacteria | 685 |
| 303 | Ga0207705_11209844 | 3300025909 | Bacteria | 579 |
| 304 | Ga0207654_11387068 | 3300025911 | Bacteria | 512 |
| 305 | Ga0207707_10716013 | 3300025912 | Bacteria | 839 |
| 306 | Ga0207695_11348552 | 3300025913 | Bacteria | 594 |
| 307 | Ga0207693_10006527 | 3300025915 | Bacteria | 9654 |
| 308 | Ga0207657_10015919 | 3300025919 | Bacteria | 7265 |
| 309 | Ga0207657_10030402 | 3300025919 | Bacteria | 4902 |
| 310 | Ga0207657_10077058 | 3300025919 | Bacteria | 2811 |
| 311 | Ga0207657_10208809 | 3300025919 | Bacteria | 1568 |
| 312 | Ga0207657_10287448 | 3300025919 | Bacteria | 1304 |
| 313 | Ga0207657_10355658 | 3300025919 | Bacteria | 1155 |
| 314 | Ga0207657_10542512 | 3300025919 | Bacteria | 909 |
| 315 | Ga0207657_10645177 | 3300025919 | Bacteria | 824 |
| 316 | Ga0207657_11179770 | 3300025919 | Bacteria | 583 |
| 317 | Ga0207649_10033848 | 3300025920 | Bacteria | 3057 |
| 318 | Ga0207649_10043747 | 3300025920 | Bacteria | 2740 |
| 319 | Ga0207649_10062674 | 3300025920 | Bacteria | 2345 |
| 320 | Ga0207649_10248986 | 3300025920 | Bacteria | 1279 |
| 321 | Ga0207649_10265702 | 3300025920 | Unclassified | 1241 |
| 322 | Ga0207649_10364158 | 3300025920 | Bacteria | 1074 |
| 323 | Ga0207649_10396457 | 3300025920 | Unclassified | 1032 |
| 324 | Ga0207652_10336882 | 3300025921 | Bacteria | 1362 |
| 325 | Ga0207652_10631382 | 3300025921 | Bacteria | 959 |
| 326 | Ga0207681_10200143 | 3300025923 | Bacteria | 1533 |
| 327 | Ga0207694_10192731 | 3300025924 | Bacteria | 1656 |
| 328 | Ga0207694_10272791 | 3300025924 | Bacteria | 1388 |
| 329 | Ga0207650_10128250 | 3300025925 | Bacteria | 1982 |
| 330 | Ga0207650_10135623 | 3300025925 | Bacteria | 1930 |
| 331 | Ga0207650_10225311 | 3300025925 | Bacteria | 1510 |
| 332 | Ga0207650_10657602 | 3300025925 | Bacteria | 884 |
| 333 | Ga0207650_11018551 | 3300025925 | Bacteria | 704 |
| 334 | Ga0207659_10394184 | 3300025926 | Bacteria | 1157 |
| 335 | Ga0207659_10650981 | 3300025926 | Bacteria | 900 |
| 336 | Ga0207687_10874780 | 3300025927 | Bacteria | 768 |
| 337 | Ga0207700_10135095 | 3300025928 | Bacteria | 2019 |
| 338 | Ga0207700_10352237 | 3300025928 | Bacteria | 1282 |
| 339 | Ga0207700_10772137 | 3300025928 | Bacteria | 859 |
| 340 | Ga0207700_10985797 | 3300025928 | Bacteria | 754 |
| 341 | Ga0207700_11785957 | 3300025928 | Bacteria | 541 |
| 342 | Ga0207664_10043273 | 3300025929 | Bacteria | 3520 |
| 343 | Ga0207664_10281559 | 3300025929 | Bacteria | 1459 |
| 344 | Ga0207664_10730771 | 3300025929 | Bacteria | 890 |
| 345 | Ga0207644_10000773 | 3300025931 | Bacteria | 20259 |
| 346 | Ga0207644_10000847 | 3300025931 | Bacteria | 19396 |
| 347 | Ga0207644_10011794 | 3300025931 | Bacteria | 5788 |
| 348 | Ga0207644_10023868 | 3300025931 | Bacteria | 4194 |
| 349 | Ga0207644_10034654 | 3300025931 | Bacteria | 3533 |
| 350 | Ga0207644_10069347 | 3300025931 | Bacteria | 2574 |
| 351 | Ga0207644_10238171 | 3300025931 | Bacteria | 1448 |
| 352 | Ga0207644_10682077 | 3300025931 | Bacteria | 856 |
| 353 | Ga0207644_11037995 | 3300025931 | Bacteria | 688 |
| 354 | Ga0207644_11188349 | 3300025931 | Unclassified | 641 |
| 355 | Ga0207690_10228167 | 3300025932 | Bacteria | 1428 |
| 356 | Ga0207690_10277051 | 3300025932 | Bacteria | 1305 |
| 357 | Ga0207690_10298268 | 3300025932 | Bacteria | 1260 |
| 358 | Ga0207690_10367097 | 3300025932 | Bacteria | 1141 |
| 359 | Ga0207690_10376653 | 3300025932 | Bacteria | 1127 |
| 360 | Ga0207690_10471279 | 3300025932 | Bacteria | 1012 |
| 361 | Ga0207690_11115537 | 3300025932 | Bacteria | 658 |
| 362 | Ga0207690_11239821 | 3300025932 | Unclassified | 623 |
| 363 | Ga0207706_10000253 | 3300025933 | Bacteria | 58135 |
| 364 | Ga0207706_10003262 | 3300025933 | Bacteria | 15536 |
| 365 | Ga0207706_10004173 | 3300025933 | Bacteria | 13606 |
| 366 | Ga0207706_10005402 | 3300025933 | Bacteria | 11912 |
| 367 | Ga0207706_10055811 | 3300025933 | Bacteria | 3483 |
| 368 | Ga0207706_10060026 | 3300025933 | Bacteria | 3349 |
| 369 | Ga0207706_10282862 | 3300025933 | Bacteria | 1446 |
| 370 | Ga0207706_10354629 | 3300025933 | Bacteria | 1275 |
| 371 | Ga0207706_10679275 | 3300025933 | Bacteria | 881 |
| 372 | Ga0207706_10777166 | 3300025933 | Bacteria | 815 |
| 373 | Ga0207706_10936011 | 3300025933 | Bacteria | 731 |
| 374 | Ga0207669_10035217 | 3300025937 | Bacteria | 2846 |
| 375 | Ga0207669_10070448 | 3300025937 | Bacteria | 2192 |
| 376 | Ga0207669_10396507 | 3300025937 | Bacteria | 1080 |
| 377 | Ga0207669_10528940 | 3300025937 | Bacteria | 948 |
| 378 | Ga0207669_11244531 | 3300025937 | Bacteria | 631 |
| 379 | Ga0207669_11478669 | 3300025937 | Bacteria | 579 |
| 380 | Ga0207665_10150585 | 3300025939 | Bacteria | 1666 |
| 381 | Ga0207691_10004350 | 3300025940 | Bacteria | 13742 |
| 382 | Ga0207691_10027663 | 3300025940 | Bacteria | 5316 |
| 383 | Ga0207691_10096941 | 3300025940 | Bacteria | 2636 |
| 384 | Ga0207691_10137747 | 3300025940 | Bacteria | 2152 |
| 385 | Ga0207691_10221124 | 3300025940 | Bacteria | 1642 |
| 386 | Ga0207691_10228433 | 3300025940 | Bacteria | 1612 |
| 387 | Ga0207691_10369005 | 3300025940 | Bacteria | 1226 |
| 388 | Ga0207711_10000309 | 3300025941 | Bacteria | 52342 |
| 389 | Ga0207711_10002790 | 3300025941 | Bacteria | 15368 |
| 390 | Ga0207711_10024125 | 3300025941 | Bacteria | 5090 |
| 391 | Ga0207711_10113799 | 3300025941 | Bacteria | 2409 |
| 392 | Ga0207711_10145943 | 3300025941 | Bacteria | 2132 |
| 393 | Ga0207711_10473852 | 3300025941 | Bacteria | 1166 |
| 394 | Ga0207689_10156323 | 3300025942 | Bacteria | 1880 |
| 395 | Ga0207679_10038485 | 3300025945 | Bacteria | 3407 |
| 396 | Ga0207679_10059628 | 3300025945 | Bacteria | 2832 |
| 397 | Ga0207679_10178336 | 3300025945 | Bacteria | 1755 |
| 398 | Ga0207679_10230107 | 3300025945 | Bacteria | 1564 |
| 399 | Ga0207679_10519864 | 3300025945 | Bacteria | 1064 |
| 400 | Ga0207679_11036325 | 3300025945 | Bacteria | 752 |
| 401 | Ga0207679_11201249 | 3300025945 | Bacteria | 696 |
| 402 | Ga0207679_11222780 | 3300025945 | Bacteria | 689 |
| 403 | Ga0207679_11261496 | 3300025945 | Bacteria | 678 |
| 404 | Ga0207679_11414551 | 3300025945 | Bacteria | 638 |
| 405 | Ga0207667_10097958 | 3300025949 | Bacteria | 3026 |
| 406 | Ga0207667_10317951 | 3300025949 | Bacteria | 1590 |
| 407 | Ga0207667_10421941 | 3300025949 | Bacteria | 1357 |
| 408 | Ga0207667_11157918 | 3300025949 | Unclassified | 754 |
| 409 | Ga0207651_10014293 | 3300025960 | Bacteria | 4577 |
| 410 | Ga0207651_10024871 | 3300025960 | Bacteria | 3712 |
| 411 | Ga0207651_10047390 | 3300025960 | Bacteria | 2897 |
| 412 | Ga0207651_10056300 | 3300025960 | Bacteria | 2705 |
| 413 | Ga0207651_10112290 | 3300025960 | Bacteria | 2048 |
| 414 | Ga0207651_10296759 | 3300025960 | Bacteria | 1342 |
| 415 | Ga0207651_10958373 | 3300025960 | Bacteria | 763 |
| 416 | Ga0207712_10139451 | 3300025961 | Bacteria | 1859 |
| 417 | Ga0207668_10135900 | 3300025972 | Bacteria | 1884 |
| 418 | Ga0207668_10505476 | 3300025972 | Bacteria | 1040 |
| 419 | Ga0207640_10016718 | 3300025981 | Bacteria | 4275 |
| 420 | Ga0207640_10133642 | 3300025981 | Unclassified | 1797 |
| 421 | Ga0207640_10252858 | 3300025981 | Bacteria | 1369 |
| 422 | Ga0207640_10255497 | 3300025981 | Bacteria | 1362 |
| 423 | Ga0207640_10282198 | 3300025981 | Bacteria | 1305 |
| 424 | Ga0207640_10791873 | 3300025981 | Bacteria | 820 |
| 425 | Ga0207658_10080839 | 3300025986 | Bacteria | 2490 |
| 426 | Ga0207658_10130613 | 3300025986 | Bacteria | 2017 |
| 427 | Ga0207658_10167084 | 3300025986 | Bacteria | 1808 |
| 428 | Ga0207658_10204778 | 3300025986 | Bacteria | 1650 |
| 429 | Ga0207658_10996567 | 3300025986 | Bacteria | 764 |
| 430 | Ga0207658_11240859 | 3300025986 | Bacteria | 681 |
| 431 | Ga0207677_10019204 | 3300026023 | Bacteria | 4122 |
| 432 | Ga0207677_10248012 | 3300026023 | Bacteria | 1444 |
| 433 | Ga0207703_10001905 | 3300026035 | Bacteria | 18500 |
| 434 | Ga0207703_10031527 | 3300026035 | Bacteria | 4192 |
| 435 | Ga0207703_10047014 | 3300026035 | Bacteria | 3478 |
| 436 | Ga0207703_10079230 | 3300026035 | Bacteria | 2732 |
| 437 | Ga0207639_10049224 | 3300026041 | Bacteria | 3194 |
| 438 | Ga0207639_10326827 | 3300026041 | Bacteria | 1363 |
| 439 | Ga0207639_10659652 | 3300026041 | Bacteria | 968 |
| 440 | Ga0207639_10705611 | 3300026041 | Bacteria | 936 |
| 441 | Ga0207639_11056184 | 3300026041 | Bacteria | 761 |
| 442 | Ga0207639_11489900 | 3300026041 | Bacteria | 635 |
| 443 | Ga0207678_10016793 | 3300026067 | Bacteria | 6429 |
| 444 | Ga0207678_10081603 | 3300026067 | Bacteria | 2768 |
| 445 | Ga0207678_10114121 | 3300026067 | Bacteria | 2305 |
| 446 | Ga0207678_10172330 | 3300026067 | Bacteria | 1848 |
| 447 | Ga0207678_10222422 | 3300026067 | Bacteria | 1616 |
| 448 | Ga0207678_10276911 | 3300026067 | Bacteria | 1439 |
| 449 | Ga0207678_10699177 | 3300026067 | Bacteria | 892 |
| 450 | Ga0207678_11378426 | 3300026067 | Bacteria | 623 |
| 451 | Ga0207702_10444675 | 3300026078 | Bacteria | 1257 |
| 452 | Ga0207641_10120626 | 3300026088 | Bacteria | 2339 |
| 453 | Ga0207641_10319703 | 3300026088 | Bacteria | 1471 |
| 454 | Ga0207641_10711446 | 3300026088 | Bacteria | 990 |
| 455 | Ga0207648_10017417 | 3300026089 | Bacteria | 6539 |
| 456 | Ga0207648_10049684 | 3300026089 | Bacteria | 3669 |
| 457 | Ga0207648_10622079 | 3300026089 | Bacteria | 996 |
| 458 | Ga0207676_10016579 | 3300026095 | Bacteria | 5335 |
| 459 | Ga0207676_10027536 | 3300026095 | Bacteria | 4234 |
| 460 | Ga0207676_10270319 | 3300026095 | Bacteria | 1539 |
| 461 | Ga0207676_11552566 | 3300026095 | Bacteria | 659 |
| 462 | Ga0207676_12076361 | 3300026095 | Bacteria | 567 |
| 463 | Ga0207674_10083533 | 3300026116 | Bacteria | 3193 |
| 464 | Ga0207674_10135320 | 3300026116 | Bacteria | 2426 |
| 465 | Ga0207683_10001185 | 3300026121 | Bacteria | 23609 |
| 466 | Ga0207683_10002289 | 3300026121 | Bacteria | 16796 |
| 467 | Ga0207683_10031898 | 3300026121 | Bacteria | 4575 |
| 468 | Ga0207683_10095107 | 3300026121 | Bacteria | 2656 |
| 469 | Ga0207683_10173531 | 3300026121 | Bacteria | 1953 |
| 470 | Ga0207683_10207231 | 3300026121 | Bacteria | 1783 |
| 471 | Ga0207698_10025991 | 3300026142 | Bacteria | 4135 |
| 472 | Ga0207698_10060036 | 3300026142 | Bacteria | 2955 |
| 473 | Ga0207698_10177393 | 3300026142 | Bacteria | 1883 |
| 474 | Ga0207698_10180433 | 3300026142 | Bacteria | 1870 |
| 475 | Ga0207698_10317904 | 3300026142 | Bacteria | 1457 |
| 476 | Ga0207698_10319124 | 3300026142 | Bacteria | 1454 |
| 477 | Ga0207698_11112101 | 3300026142 | Unclassified | 803 |
| 478 | Ga0268266_10032604 | 3300028379 | Bacteria | 4426 |
| 479 | Ga0268266_10096853 | 3300028379 | Bacteria | 2594 |
| 480 | Ga0268266_11443414 | 3300028379 | Bacteria | 664 |
| 481 | Ga0268265_10001273 | 3300028380 | Bacteria | 21747 |
| 482 | Ga0268265_10440599 | 3300028380 | Bacteria | 1214 |
| 483 | Ga0268264_10060221 | 3300028381 | Bacteria | 3181 |
| 484 | Ga0268264_10531798 | 3300028381 | Unclassified | 1151 |
| 485 | Ga0268264_10965940 | 3300028381 | Bacteria | 857 |
| 486 | Ga0307413_10278240 | 3300031824 | Bacteria | 1257 |
| 487 | Ga0307406_11696465 | 3300031901 | Bacteria | 560 |
| 488 | Ga0307414_10747327 | 3300032004 | Bacteria | 889 |
| 489 | Ga0307414_11245357 | 3300032004 | Bacteria | 689 |
| 490 | Ga0307411_10787297 | 3300032005 | Bacteria | 836 |
| 491 | Ga0307415_100705931 | 3300032126 | Bacteria | 911 |
| 492 | Ga0373938_0206042 | 3300034957 | Unclassified | 547 |
| 493 | Ga0373931_0062393 | 3300035691 | Bacteria | 2012 |
| 494 | Ga0373935_0015144 | 3300035692 | Bacteria | 4659 |
| 495 | Ga0395899_0023813 | 3300037312 | Bacteria | 4633 |
| 496 | Ga0395899_0031040 | 3300037312 | Bacteria | 4017 |
| 497 | Ga0395899_0045871 | 3300037312 | Bacteria | 3256 |
| 498 | Ga0395899_0079694 | 3300037312 | Bacteria | 2385 |
| 499 | Ga0395899_0115826 | 3300037312 | Bacteria | 1923 |
| 500 | Ga0395899_0952512 | 3300037312 | Bacteria | 520 |
| 501 | Ga0395900_0001256 | 3300037418 | Bacteria | 31067 |
| 502 | Ga0395900_0029387 | 3300037418 | Bacteria | 5638 |
| 503 | Ga0395900_0033179 | 3300037418 | Bacteria | 5313 |
| 504 | Ga0395900_0061036 | 3300037418 | Bacteria | 3877 |
| 505 | Ga0395900_0107691 | 3300037418 | Bacteria | 2863 |
| 506 | Ga0395900_0251170 | 3300037418 | Bacteria | 1770 |
| 507 | Ga0395900_0329722 | 3300037418 | Bacteria | 1504 |
| 508 | Ga0395900_0643361 | 3300037418 | Bacteria | 997 |
| 509 | Ga0395900_0653959 | 3300037418 | Bacteria | 987 |
| 510 | Ga0395900_0688342 | 3300037418 | Bacteria | 957 |
| 511 | Ga0395900_0965935 | 3300037418 | Bacteria | 773 |
| 512 | Ga0395900_1228379 | 3300037418 | Unclassified | 664 |
| 513 | Ga0395900_1576971 | 3300037418 | Bacteria | 568 |
| 514 | Ga0395900_1729246 | 3300037418 | Bacteria | 536 |
| 515 | Ga0395898_0062486 | 3300037466 | Bacteria | 3616 |
| 516 | Ga0395898_0086667 | 3300037466 | Bacteria | 3017 |
| 517 | Ga0395898_0086709 | 3300037466 | Bacteria | 3016 |
| 518 | Ga0395898_0178805 | 3300037466 | Bacteria | 2027 |
| 519 | Ga0395898_0245417 | 3300037466 | Bacteria | 1708 |
| 520 | Ga0395898_0647658 | 3300037466 | Bacteria | 999 |
| 521 | Ga0395898_1905888 | 3300037466 | Bacteria | 514 |
| 522 | Ga0395905_0000610 | 3300037471 | Bacteria | 47892 |
| 523 | Ga0395905_0002249 | 3300037471 | Bacteria | 21706 |
| 524 | Ga0395905_0045122 | 3300037471 | Bacteria | 4134 |
| 525 | Ga0395905_0046707 | 3300037471 | Bacteria | 4060 |
| 526 | Ga0395905_0057011 | 3300037471 | Bacteria | 3653 |
| 527 | Ga0395905_0080959 | 3300037471 | Bacteria | 3043 |
| 528 | Ga0395905_0126559 | 3300037471 | Bacteria | 2402 |
| 529 | Ga0395905_0163659 | 3300037471 | Bacteria | 2090 |
| 530 | Ga0395905_0452711 | 3300037471 | Unclassified | 1181 |
| 531 | Ga0395905_1043269 | 3300037471 | Bacteria | 721 |
| 532 | Ga0395905_1064443 | 3300037471 | Bacteria | 712 |
| 533 | Ga0395905_1212166 | 3300037471 | Bacteria | 658 |
| 534 | Ga0395905_1226898 | 3300037471 | Bacteria | 653 |
| 535 | Ga0395905_1437356 | 3300037471 | Bacteria | 594 |
| 536 | Ga0395905_1601567 | 3300037471 | Bacteria | 556 |
| 537 | Ga0395901_0054927 | 3300038443 | Bacteria | 4140 |
| 538 | Ga0395901_0128016 | 3300038443 | Bacteria | 2669 |
| 539 | Ga0395901_0181515 | 3300038443 | Bacteria | 2207 |
| 540 | Ga0395901_0213374 | 3300038443 | Bacteria | 2019 |
| 541 | Ga0395901_0339569 | 3300038443 | Bacteria | 1552 |
| 542 | Ga0395901_0445157 | 3300038443 | Bacteria | 1325 |
| 543 | Ga0395901_0922573 | 3300038443 | Bacteria | 854 |
| 544 | Ga0395901_1299699 | 3300038443 | Unclassified | 689 |
| 545 | Ga0395901_1437070 | 3300038443 | Bacteria | 647 |
| 546 | Ga0436365_0269996 | 3300039437 | Bacteria | 5409 |
| 547 | Ga0436365_0782999 | 3300039437 | Bacteria | 1137 |
| 548 | Ga0466972_0129046 | 3300044658 | Bacteria | 1191 |
| 549 | Ga0466972_0376665 | 3300044658 | Bacteria | 664 |
| 550 | Ga0466965_0147870 | 3300044683 | Bacteria | 1227 |
| 551 | Ga0466966_0268627 | 3300044684 | Unclassified | 1026 |
| 552 | Ga0466966_0317002 | 3300044684 | Bacteria | 937 |
| 553 | Ga0466961_0188940 | 3300044693 | Bacteria | 1277 |
| 554 | Ga0466961_0265098 | 3300044693 | Bacteria | 1053 |
| 555 | Ga0466961_0268318 | 3300044693 | Bacteria | 1046 |
| 556 | Ga0466963_0313274 | 3300044694 | Bacteria | 1104 |
| 557 | Ga0466963_0479496 | 3300044694 | Bacteria | 878 |
| 558 | Ga0466963_1028968 | 3300044694 | Unclassified | 580 |
| 559 | Ga0466963_1244373 | 3300044694 | Unclassified | 523 |
| 560 | Ga0466971_0105234 | 3300044719 | Bacteria | 1299 |
| 561 | Ga0466971_0183579 | 3300044719 | Bacteria | 984 |
| 562 | Ga0466970_0605626 | 3300044765 | Bacteria | 636 |
| 563 | Ga0466957_0127727 | 3300044842 | Bacteria | 1626 |
| 564 | Ga0466957_0177706 | 3300044842 | Bacteria | 1389 |
| 565 | Ga0466957_0366253 | 3300044842 | Bacteria | 980 |
| 566 | Ga0466960_0021572 | 3300044901 | Bacteria | 2870 |
| 567 | Ga0466960_0079229 | 3300044901 | Bacteria | 1651 |
| 568 | Ga0466960_0252111 | 3300044901 | Bacteria | 981 |
| 569 | Ga0466959_0317838 | 3300045049 | Bacteria | 1065 |
| 570 | Ga0466958_0140952 | 3300045836 | Bacteria | 1518 |
| 571 | Ga0466958_0648102 | 3300045836 | Bacteria | 687 |
| 572 | Ga0466967_0030324 | 3300045976 | Bacteria | 4537 |
| 573 | Ga0466967_0082454 | 3300045976 | Bacteria | 2906 |
| 574 | Ga0466967_0293601 | 3300045976 | Bacteria | 1562 |
| 575 | Ga0466967_0371592 | 3300045976 | Bacteria | 1387 |
| 576 | Ga0466967_0402856 | 3300045976 | Bacteria | 1331 |
| 577 | Ga0466967_0607222 | 3300045976 | Bacteria | 1080 |
| 578 | Ga0466967_0712629 | 3300045976 | Bacteria | 994 |
| 579 | Ga0466967_1021962 | 3300045976 | Unclassified | 823 |
| 580 | Ga0466967_1869347 | 3300045976 | Bacteria | 597 |
| 581 | Ga0495629_0370635 | 3300046459 | Bacteria | 975 |
| 582 | Ga0495580_0320871 | 3300046472 | Bacteria | 1053 |
| 583 | Ga0495584_0448815 | 3300046491 | Bacteria | 656 |
| 584 | Ga0495606_0269934 | 3300046507 | Bacteria | 935 |
| 585 | Ga0495610_0171907 | 3300046512 | Bacteria | 908 |
| 586 | Ga0495620_0117537 | 3300046515 | Bacteria | 1050 |
| 587 | Ga0495598_0000202 | 3300046537 | Bacteria | 10497 |
| 588 | Ga0495621_0000141 | 3300046539 | Bacteria | 15332 |
| 589 | Ga0495621_0056609 | 3300046539 | Bacteria | 1414 |
| 590 | Ga0495668_0008461 | 3300046616 | Bacteria | 6420 |
| 591 | Ga0495668_0049292 | 3300046616 | Bacteria | 2335 |
| 592 | Ga0495625_0635732 | 3300046660 | Bacteria | 637 |
| 593 | Ga0495588_0757495 | 3300046674 | Bacteria | 508 |
| 594 | Ga0495669_0000276 | 3300046684 | Bacteria | 29327 |
| 595 | Ga0495669_0001818 | 3300046684 | Bacteria | 8721 |
| 596 | Ga0495669_0065845 | 3300046684 | Bacteria | 1645 |
| 597 | Ga0495669_0421777 | 3300046684 | Bacteria | 647 |
| 598 | Ga0495670_0001165 | 3300046691 | Bacteria | 12770 |
| 599 | Ga0495677_0013866 | 3300047445 | Bacteria | 2935 |
| 600 | Ga0495685_047320 | 3300047447 | Bacteria | 1463 |
| 601 | Ga0496100_0011341 | 3300048903 | Bacteria | 5072 |
| 602 | Ga0496100_0140604 | 3300048903 | Bacteria | 1711 |
| 603 | Ga0496100_0968005 | 3300048903 | Bacteria | 669 |
| 604 | Ga0496101_0032035 | 3300048904 | Bacteria | 3698 |
| 605 | Ga0496101_0216175 | 3300048904 | Bacteria | 1486 |
| 606 | Ga0496101_0256111 | 3300048904 | Bacteria | 1364 |
| 607 | Ga0496101_0451972 | 3300048904 | Bacteria | 1014 |
| 608 | Ga0496102_0143135 | 3300048905 | Bacteria | 2243 |
| 609 | Ga0496102_0282770 | 3300048905 | Bacteria | 1564 |
| 610 | Ga0496102_1636754 | 3300048905 | Bacteria | 562 |
| 611 | Ga0496103_0106258 | 3300048906 | Bacteria | 1780 |
| 612 | Ga0496106_0033208 | 3300048909 | Bacteria | 3850 |
| 613 | Ga0496106_0510768 | 3300048909 | Bacteria | 965 |
| 614 | Ga0496106_0707986 | 3300048909 | Bacteria | 802 |
| 615 | Ga0496107_0064258 | 3300048910 | Bacteria | 2661 |
| 616 | Ga0496107_0203367 | 3300048910 | Bacteria | 1472 |
| 617 | Ga0496107_0230727 | 3300048910 | Bacteria | 1377 |
| 618 | Ga0496107_0391093 | 3300048910 | Bacteria | 1034 |
| 619 | Ga0496107_0564972 | 3300048910 | Bacteria | 842 |
| 620 | Ga0496107_0714613 | 3300048910 | Unclassified | 736 |
| 621 | Ga0496107_0814818 | 3300048910 | Bacteria | 683 |
| 622 | Ga0496109_0181195 | 3300048912 | Bacteria | 1978 |
| 623 | Ga0496109_0862113 | 3300048912 | Bacteria | 843 |
| 624 | Ga0496111_0030983 | 3300048914 | Bacteria | 3806 |
| 625 | Ga0496111_0160221 | 3300048914 | Bacteria | 1670 |
| 626 | Ga0496111_0188287 | 3300048914 | Bacteria | 1534 |
| 627 | Ga0496111_0193908 | 3300048914 | Bacteria | 1510 |
| 628 | Ga0496112_0021051 | 3300048915 | Bacteria | 6194 |
| 629 | Ga0496112_0190186 | 3300048915 | Unclassified | 2015 |
| 630 | Ga0496112_0327784 | 3300048915 | Bacteria | 1475 |
| 631 | Ga0496112_1067784 | 3300048915 | Bacteria | 726 |
| 632 | Ga0496112_1521216 | 3300048915 | Bacteria | 583 |
| 633 | Ga0496113_0190825 | 3300048916 | Unclassified | 1626 |
| 634 | Ga0496113_0315550 | 3300048916 | Bacteria | 1253 |
| 635 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 636 | Ga0496114_0068560 | 3300048917 | Bacteria | 2978 |
| 637 | Ga0496114_0116789 | 3300048917 | Bacteria | 2291 |
| 638 | Ga0496115_0095950 | 3300048918 | Bacteria | 2427 |
| 639 | Ga0496115_0293425 | 3300048918 | Bacteria | 1333 |
| 640 | Ga0496115_1410236 | 3300048918 | Bacteria | 514 |
| 641 | Ga0501068_0050997 | 3300049584 | Bacteria | 2503 |
| 642 | Ga0501069_0091036 | 3300049585 | Bacteria | 1725 |
| 643 | Ga0501069_0663635 | 3300049585 | Bacteria | 628 |
| 644 | Ga0495655_0110520 | 3300053083 | Bacteria | 825 |
| 645 | Ga0466962_0248369 | 3300061719 | Bacteria | 874 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_1064443 | Ga0395905_1064443_49_399 | 116 |
| 2 | 3300038443 | Ga0395901_0922573 | Ga0395901_0922573_31_381 | 116 |
| 3 | 3300046674 | Ga0495588_0757495 | Ga0495588_0757495_24_374 | 116 |
| 4 | 3300048903 | Ga0496100_0011341 | Ga0496100_0011341_1148_1498 | 116 |
| 5 | 3300048904 | Ga0496101_0032035 | Ga0496101_0032035_2189_2539 | 116 |
| 6 | 3300048909 | Ga0496106_0033208 | Ga0496106_0033208_104_454 | 116 |
| 7 | 3300048910 | Ga0496107_0714613 | Ga0496107_0714613_256_606 | 116 |
| 8 | 3300048917 | Ga0496114_0116789 | Ga0496114_0116789_829_1179 | 116 |
| 9 | 3300048918 | Ga0496115_0293425 | Ga0496115_0293425_736_1086 | 116 |
| 10 | 3300005327 | Ga0070658_10593048 | Ga0070658_105930481 | 117 |
| 11 | 3300005354 | Ga0070675_100528418 | Ga0070675_1005284182 | 117 |
| 12 | 3300005355 | Ga0070671_100004155 | Ga0070671_1000041556 | 117 |
| 13 | 3300005364 | Ga0070673_100370795 | Ga0070673_1003707952 | 117 |
| 14 | 3300005456 | Ga0070678_100010304 | Ga0070678_1000103044 | 117 |
| 15 | 3300005457 | Ga0070662_100019488 | Ga0070662_1000194887 | 117 |
| 16 | 3300005459 | Ga0068867_100948852 | Ga0068867_1009488522 | 117 |
| 17 | 3300005616 | Ga0068852_101091303 | Ga0068852_1010913032 | 117 |
| 18 | 3300009177 | Ga0105248_10054556 | Ga0105248_100545564 | 117 |
| 19 | 3300009177 | Ga0105248_10178932 | Ga0105248_101789322 | 117 |
| 20 | 3300011119 | Ga0105246_10985726 | Ga0105246_109857262 | 117 |
| 21 | 3300013102 | Ga0157371_11178765 | Ga0157371_111787652 | 117 |
| 22 | 3300013296 | Ga0157374_10006812 | Ga0157374_100068122 | 117 |
| 23 | 3300013306 | Ga0163162_10060277 | Ga0163162_100602774 | 117 |
| 24 | 3300013308 | Ga0157375_10002069 | Ga0157375_100020692 | 117 |
| 25 | 3300014325 | Ga0163163_10132101 | Ga0163163_101321012 | 117 |
| 26 | 3300025315 | Ga0207697_10331490 | Ga0207697_103314902 | 117 |
| 27 | 3300025926 | Ga0207659_10650981 | Ga0207659_106509812 | 117 |
| 28 | 3300025931 | Ga0207644_10000773 | Ga0207644_100007737 | 117 |
| 29 | 3300025933 | Ga0207706_10005402 | Ga0207706_100054027 | 117 |
| 30 | 3300026121 | Ga0207683_10002289 | Ga0207683_100022895 | 117 |
| 31 | 3300028381 | Ga0268264_10531798 | Ga0268264_105317982 | 117 |
| 32 | 3300048903 | Ga0496100_0140604 | Ga0496100_0140604_760_1113 | 117 |
| 33 | 3300048904 | Ga0496101_0216175 | Ga0496101_0216175_1107_1460 | 117 |
| 34 | 3300048904 | Ga0496101_0451972 | Ga0496101_0451972_287_640 | 117 |
| 35 | 3300048909 | Ga0496106_0510768 | Ga0496106_0510768_428_781 | 117 |
| 36 | 3300048910 | Ga0496107_0391093 | Ga0496107_0391093_629_982 | 117 |
| 37 | 3300048910 | Ga0496107_0814818 | Ga0496107_0814818_65_418 | 117 |
| 38 | 3300048912 | Ga0496109_0181195 | Ga0496109_0181195_936_1289 | 117 |
| 39 | 3300048914 | Ga0496111_0030983 | Ga0496111_0030983_3269_3622 | 117 |
| 40 | 3300048915 | Ga0496112_0021051 | Ga0496112_0021051_550_903 | 117 |
| 41 | 3300048916 | Ga0496113_0190825 | Ga0496113_0190825_779_1132 | 117 |
| 42 | 3300048918 | Ga0496115_1410236 | Ga0496115_1410236_64_417 | 117 |
| 43 | 3300037471 | Ga0395905_0452711 | Ga0395905_0452711_11_367 | 118 |
| 44 | 3300037471 | Ga0395905_1226898 | Ga0395905_1226898_27_383 | 118 |
| 45 | 3300025933 | Ga0207706_10003262 | Ga0207706_1000326219 | 125 |
| 46 | 3300005347 | Ga0070668_100699248 | Ga0070668_1006992482 | 130 |
| 47 | 3300005356 | Ga0070674_101385008 | Ga0070674_1013850082 | 131 |
| 48 | 3300005435 | Ga0070714_100152133 | Ga0070714_1001521333 | 131 |
| 49 | 3300006028 | Ga0070717_10005953 | Ga0070717_100059536 | 131 |
| 50 | 3300025923 | Ga0207681_10200143 | Ga0207681_102001432 | 131 |
| 51 | 3300025928 | Ga0207700_10985797 | Ga0207700_109857972 | 131 |
| 52 | 3300031824 | Ga0307413_10278240 | Ga0307413_102782401 | 131 |
| 53 | 3300032005 | Ga0307411_10787297 | Ga0307411_107872972 | 131 |
| 54 | 3300032126 | Ga0307415_100705931 | Ga0307415_1007059312 | 131 |
| 55 | 3300044684 | Ga0466966_0268627 | Ga0466966_0268627_224_619 | 131 |
| 56 | 3300044719 | Ga0466971_0183579 | Ga0466971_0183579_67_462 | 131 |
| 57 | 3300044842 | Ga0466957_0127727 | Ga0466957_0127727_987_1382 | 131 |
| 58 | 3300045049 | Ga0466959_0317838 | Ga0466959_0317838_616_1011 | 131 |
| 59 | 3300001976 | JGI24752J21851_1004450 | JGI24752J21851_10044503 | 132 |
| 60 | 3300005327 | Ga0070658_10158939 | Ga0070658_101589392 | 132 |
| 61 | 3300005327 | Ga0070658_10408021 | Ga0070658_104080212 | 132 |
| 62 | 3300005327 | Ga0070658_10505161 | Ga0070658_105051611 | 132 |
| 63 | 3300005327 | Ga0070658_10509695 | Ga0070658_105096952 | 132 |
| 64 | 3300005327 | Ga0070658_10980099 | Ga0070658_109800991 | 132 |
| 65 | 3300005328 | Ga0070676_10038579 | Ga0070676_100385792 | 132 |
| 66 | 3300005328 | Ga0070676_10112069 | Ga0070676_101120692 | 132 |
| 67 | 3300005328 | Ga0070676_10139686 | Ga0070676_101396862 | 132 |
| 68 | 3300005328 | Ga0070676_10227229 | Ga0070676_102272293 | 132 |
| 69 | 3300005328 | Ga0070676_10704290 | Ga0070676_107042902 | 132 |
| 70 | 3300005329 | Ga0070683_100758703 | Ga0070683_1007587031 | 132 |
| 71 | 3300005329 | Ga0070683_101835939 | Ga0070683_1018359391 | 132 |
| 72 | 3300005330 | Ga0070690_100053796 | Ga0070690_1000537961 | 132 |
| 73 | 3300005330 | Ga0070690_100524191 | Ga0070690_1005241912 | 132 |
| 74 | 3300005330 | Ga0070690_101153317 | Ga0070690_1011533171 | 132 |
| 75 | 3300005331 | Ga0070670_100005424 | Ga0070670_1000054249 | 132 |
| 76 | 3300005331 | Ga0070670_100008941 | Ga0070670_1000089417 | 132 |
| 77 | 3300005331 | Ga0070670_100043864 | Ga0070670_1000438642 | 132 |
| 78 | 3300005331 | Ga0070670_101379691 | Ga0070670_1013796912 | 132 |
| 79 | 3300005333 | Ga0070677_10053294 | Ga0070677_100532943 | 132 |
| 80 | 3300005334 | Ga0068869_100202591 | Ga0068869_1002025911 | 132 |
| 81 | 3300005335 | Ga0070666_10051732 | Ga0070666_100517323 | 132 |
| 82 | 3300005335 | Ga0070666_10072580 | Ga0070666_100725802 | 132 |
| 83 | 3300005335 | Ga0070666_10101684 | Ga0070666_101016843 | 132 |
| 84 | 3300005335 | Ga0070666_10158072 | Ga0070666_101580722 | 132 |
| 85 | 3300005335 | Ga0070666_10637048 | Ga0070666_106370482 | 132 |
| 86 | 3300005336 | Ga0070680_100247940 | Ga0070680_1002479402 | 132 |
| 87 | 3300005337 | Ga0070682_100306371 | Ga0070682_1003063712 | 132 |
| 88 | 3300005338 | Ga0068868_100000540 | Ga0068868_10000054018 | 132 |
| 89 | 3300005338 | Ga0068868_100072054 | Ga0068868_1000720544 | 132 |
| 90 | 3300005338 | Ga0068868_100092462 | Ga0068868_1000924624 | 132 |
| 91 | 3300005338 | Ga0068868_100104094 | Ga0068868_1001040942 | 132 |
| 92 | 3300005338 | Ga0068868_100160360 | Ga0068868_1001603603 | 132 |
| 93 | 3300005338 | Ga0068868_101185848 | Ga0068868_1011858482 | 132 |
| 94 | 3300005339 | Ga0070660_100061065 | Ga0070660_1000610652 | 132 |
| 95 | 3300005339 | Ga0070660_100171735 | Ga0070660_1001717353 | 132 |
| 96 | 3300005339 | Ga0070660_100250894 | Ga0070660_1002508942 | 132 |
| 97 | 3300005339 | Ga0070660_100337498 | Ga0070660_1003374982 | 132 |
| 98 | 3300005341 | Ga0070691_10464412 | Ga0070691_104644121 | 132 |
| 99 | 3300005344 | Ga0070661_100001787 | Ga0070661_10000178717 | 132 |
| 100 | 3300005344 | Ga0070661_100132888 | Ga0070661_1001328883 | 132 |
| 101 | 3300005344 | Ga0070661_100170200 | Ga0070661_1001702002 | 132 |
| 102 | 3300005344 | Ga0070661_100225175 | Ga0070661_1002251752 | 132 |
| 103 | 3300005344 | Ga0070661_100229785 | Ga0070661_1002297852 | 132 |
| 104 | 3300005344 | Ga0070661_100482783 | Ga0070661_1004827832 | 132 |
| 105 | 3300005344 | Ga0070661_100567258 | Ga0070661_1005672582 | 132 |
| 106 | 3300005347 | Ga0070668_100065229 | Ga0070668_1000652292 | 132 |
| 107 | 3300005347 | Ga0070668_100488648 | Ga0070668_1004886482 | 132 |
| 108 | 3300005347 | Ga0070668_101556798 | Ga0070668_1015567982 | 132 |
| 109 | 3300005353 | Ga0070669_101349363 | Ga0070669_1013493632 | 132 |
| 110 | 3300005354 | Ga0070675_100128723 | Ga0070675_1001287233 | 132 |
| 111 | 3300005354 | Ga0070675_101247776 | Ga0070675_1012477762 | 132 |
| 112 | 3300005355 | Ga0070671_100010022 | Ga0070671_1000100223 | 132 |
| 113 | 3300005355 | Ga0070671_100013985 | Ga0070671_1000139852 | 132 |
| 114 | 3300005355 | Ga0070671_100040667 | Ga0070671_1000406675 | 132 |
| 115 | 3300005355 | Ga0070671_100120942 | Ga0070671_1001209422 | 132 |
| 116 | 3300005355 | Ga0070671_100143244 | Ga0070671_1001432441 | 132 |
| 117 | 3300005355 | Ga0070671_100209701 | Ga0070671_1002097011 | 132 |
| 118 | 3300005355 | Ga0070671_100451106 | Ga0070671_1004511062 | 132 |
| 119 | 3300005355 | Ga0070671_100910496 | Ga0070671_1009104962 | 132 |
| 120 | 3300005355 | Ga0070671_101148186 | Ga0070671_1011481861 | 132 |
| 121 | 3300005356 | Ga0070674_100128411 | Ga0070674_1001284113 | 132 |
| 122 | 3300005356 | Ga0070674_100182251 | Ga0070674_1001822514 | 132 |
| 123 | 3300005356 | Ga0070674_100372069 | Ga0070674_1003720692 | 132 |
| 124 | 3300005356 | Ga0070674_100481754 | Ga0070674_1004817542 | 132 |
| 125 | 3300005356 | Ga0070674_101146326 | Ga0070674_1011463262 | 132 |
| 126 | 3300005364 | Ga0070673_100018567 | Ga0070673_1000185674 | 132 |
| 127 | 3300005364 | Ga0070673_100025353 | Ga0070673_1000253533 | 132 |
| 128 | 3300005364 | Ga0070673_100028572 | Ga0070673_1000285722 | 132 |
| 129 | 3300005364 | Ga0070673_100260650 | Ga0070673_1002606503 | 132 |
| 130 | 3300005364 | Ga0070673_100563574 | Ga0070673_1005635742 | 132 |
| 131 | 3300005364 | Ga0070673_100961889 | Ga0070673_1009618892 | 132 |
| 132 | 3300005364 | Ga0070673_100974861 | Ga0070673_1009748612 | 132 |
| 133 | 3300005364 | Ga0070673_101273476 | Ga0070673_1012734761 | 132 |
| 134 | 3300005365 | Ga0070688_100583001 | Ga0070688_1005830012 | 132 |
| 135 | 3300005366 | Ga0070659_100046830 | Ga0070659_1000468305 | 132 |
| 136 | 3300005366 | Ga0070659_100059277 | Ga0070659_1000592772 | 132 |
| 137 | 3300005366 | Ga0070659_100155664 | Ga0070659_1001556642 | 132 |
| 138 | 3300005366 | Ga0070659_100269345 | Ga0070659_1002693452 | 132 |
| 139 | 3300005366 | Ga0070659_100370805 | Ga0070659_1003708052 | 132 |
| 140 | 3300005366 | Ga0070659_100387064 | Ga0070659_1003870642 | 132 |
| 141 | 3300005366 | Ga0070659_100394480 | Ga0070659_1003944801 | 132 |
| 142 | 3300005366 | Ga0070659_100418808 | Ga0070659_1004188082 | 132 |
| 143 | 3300005366 | Ga0070659_101146618 | Ga0070659_1011466182 | 132 |
| 144 | 3300005366 | Ga0070659_101328501 | Ga0070659_1013285012 | 132 |
| 145 | 3300005366 | Ga0070659_101416061 | Ga0070659_1014160611 | 132 |
| 146 | 3300005367 | Ga0070667_100001880 | Ga0070667_10000188013 | 132 |
| 147 | 3300005367 | Ga0070667_100020050 | Ga0070667_1000200507 | 132 |
| 148 | 3300005367 | Ga0070667_100141414 | Ga0070667_1001414142 | 132 |
| 149 | 3300005367 | Ga0070667_100234708 | Ga0070667_1002347082 | 132 |
| 150 | 3300005367 | Ga0070667_100868521 | Ga0070667_1008685212 | 132 |
| 151 | 3300005434 | Ga0070709_10003770 | Ga0070709_100037702 | 132 |
| 152 | 3300005435 | Ga0070714_100048977 | Ga0070714_1000489771 | 132 |
| 153 | 3300005435 | Ga0070714_100062778 | Ga0070714_1000627782 | 132 |
| 154 | 3300005435 | Ga0070714_100196179 | Ga0070714_1001961792 | 132 |
| 155 | 3300005436 | Ga0070713_100047052 | Ga0070713_1000470523 | 132 |
| 156 | 3300005436 | Ga0070713_100385239 | Ga0070713_1003852392 | 132 |
| 157 | 3300005436 | Ga0070713_100569164 | Ga0070713_1005691642 | 132 |
| 158 | 3300005455 | Ga0070663_100044752 | Ga0070663_1000447523 | 132 |
| 159 | 3300005455 | Ga0070663_100184951 | Ga0070663_1001849512 | 132 |
| 160 | 3300005455 | Ga0070663_100653755 | Ga0070663_1006537552 | 132 |
| 161 | 3300005455 | Ga0070663_101049410 | Ga0070663_1010494102 | 132 |
| 162 | 3300005456 | Ga0070678_100036424 | Ga0070678_1000364243 | 132 |
| 163 | 3300005456 | Ga0070678_100040711 | Ga0070678_1000407114 | 132 |
| 164 | 3300005456 | Ga0070678_100213112 | Ga0070678_1002131122 | 132 |
| 165 | 3300005456 | Ga0070678_100570838 | Ga0070678_1005708382 | 132 |
| 166 | 3300005457 | Ga0070662_100069793 | Ga0070662_1000697932 | 132 |
| 167 | 3300005457 | Ga0070662_100145706 | Ga0070662_1001457062 | 132 |
| 168 | 3300005457 | Ga0070662_100204462 | Ga0070662_1002044623 | 132 |
| 169 | 3300005457 | Ga0070662_100266010 | Ga0070662_1002660102 | 132 |
| 170 | 3300005457 | Ga0070662_101115523 | Ga0070662_1011155231 | 132 |
| 171 | 3300005457 | Ga0070662_101502810 | Ga0070662_1015028101 | 132 |
| 172 | 3300005458 | Ga0070681_10010289 | Ga0070681_100102892 | 132 |
| 173 | 3300005458 | Ga0070681_10177119 | Ga0070681_101771192 | 132 |
| 174 | 3300005459 | Ga0068867_100188650 | Ga0068867_1001886502 | 132 |
| 175 | 3300005459 | Ga0068867_100203682 | Ga0068867_1002036822 | 132 |
| 176 | 3300005459 | Ga0068867_102102630 | Ga0068867_1021026301 | 132 |
| 177 | 3300005466 | Ga0070685_10082358 | Ga0070685_100823582 | 132 |
| 178 | 3300005530 | Ga0070679_101268783 | Ga0070679_1012687831 | 132 |
| 179 | 3300005539 | Ga0068853_100064967 | Ga0068853_1000649671 | 132 |
| 180 | 3300005539 | Ga0068853_100397631 | Ga0068853_1003976312 | 132 |
| 181 | 3300005539 | Ga0068853_100645894 | Ga0068853_1006458942 | 132 |
| 182 | 3300005539 | Ga0068853_100737957 | Ga0068853_1007379571 | 132 |
| 183 | 3300005539 | Ga0068853_101051084 | Ga0068853_1010510841 | 132 |
| 184 | 3300005539 | Ga0068853_101534087 | Ga0068853_1015340872 | 132 |
| 185 | 3300005543 | Ga0070672_100007583 | Ga0070672_1000075839 | 132 |
| 186 | 3300005543 | Ga0070672_100173189 | Ga0070672_1001731892 | 132 |
| 187 | 3300005543 | Ga0070672_100240337 | Ga0070672_1002403372 | 132 |
| 188 | 3300005543 | Ga0070672_100591832 | Ga0070672_1005918322 | 132 |
| 189 | 3300005543 | Ga0070672_100602163 | Ga0070672_1006021632 | 132 |
| 190 | 3300005543 | Ga0070672_100796245 | Ga0070672_1007962452 | 132 |
| 191 | 3300005543 | Ga0070672_100831396 | Ga0070672_1008313962 | 132 |
| 192 | 3300005544 | Ga0070686_100022420 | Ga0070686_1000224202 | 132 |
| 193 | 3300005544 | Ga0070686_100197270 | Ga0070686_1001972702 | 132 |
| 194 | 3300005544 | Ga0070686_100450563 | Ga0070686_1004505632 | 132 |
| 195 | 3300005546 | Ga0070696_100377654 | Ga0070696_1003776542 | 132 |
| 196 | 3300005547 | Ga0070693_100018738 | Ga0070693_1000187384 | 132 |
| 197 | 3300005547 | Ga0070693_100744407 | Ga0070693_1007444071 | 132 |
| 198 | 3300005548 | Ga0070665_100378184 | Ga0070665_1003781842 | 132 |
| 199 | 3300005548 | Ga0070665_100683022 | Ga0070665_1006830222 | 132 |
| 200 | 3300005548 | Ga0070665_100839882 | Ga0070665_1008398822 | 132 |
| 201 | 3300005563 | Ga0068855_100534714 | Ga0068855_1005347142 | 132 |
| 202 | 3300005563 | Ga0068855_100788904 | Ga0068855_1007889041 | 132 |
| 203 | 3300005563 | Ga0068855_100941403 | Ga0068855_1009414032 | 132 |
| 204 | 3300005563 | Ga0068855_102089893 | Ga0068855_1020898931 | 132 |
| 205 | 3300005564 | Ga0070664_100007255 | Ga0070664_1000072552 | 132 |
| 206 | 3300005564 | Ga0070664_100015505 | Ga0070664_1000155055 | 132 |
| 207 | 3300005564 | Ga0070664_100284958 | Ga0070664_1002849582 | 132 |
| 208 | 3300005564 | Ga0070664_100425667 | Ga0070664_1004256672 | 132 |
| 209 | 3300005564 | Ga0070664_100650032 | Ga0070664_1006500322 | 132 |
| 210 | 3300005564 | Ga0070664_100801285 | Ga0070664_1008012852 | 132 |
| 211 | 3300005564 | Ga0070664_100891242 | Ga0070664_1008912422 | 132 |
| 212 | 3300005564 | Ga0070664_100919151 | Ga0070664_1009191512 | 132 |
| 213 | 3300005564 | Ga0070664_101685349 | Ga0070664_1016853492 | 132 |
| 214 | 3300005577 | Ga0068857_100063269 | Ga0068857_1000632693 | 132 |
| 215 | 3300005578 | Ga0068854_100013020 | Ga0068854_1000130204 | 132 |
| 216 | 3300005578 | Ga0068854_100202678 | Ga0068854_1002026782 | 132 |
| 217 | 3300005578 | Ga0068854_100396082 | Ga0068854_1003960822 | 132 |
| 218 | 3300005578 | Ga0068854_100653950 | Ga0068854_1006539502 | 132 |
| 219 | 3300005578 | Ga0068854_100796394 | Ga0068854_1007963942 | 132 |
| 220 | 3300005578 | Ga0068854_101078855 | Ga0068854_1010788552 | 132 |
| 221 | 3300005614 | Ga0068856_100282835 | Ga0068856_1002828353 | 132 |
| 222 | 3300005614 | Ga0068856_100536898 | Ga0068856_1005368982 | 132 |
| 223 | 3300005614 | Ga0068856_102551716 | Ga0068856_1025517162 | 132 |
| 224 | 3300005616 | Ga0068852_100013389 | Ga0068852_1000133896 | 132 |
| 225 | 3300005616 | Ga0068852_100056428 | Ga0068852_1000564284 | 132 |
| 226 | 3300005616 | Ga0068852_100084393 | Ga0068852_1000843933 | 132 |
| 227 | 3300005616 | Ga0068852_100137216 | Ga0068852_1001372163 | 132 |
| 228 | 3300005616 | Ga0068852_100751407 | Ga0068852_1007514072 | 132 |
| 229 | 3300005617 | Ga0068859_100114674 | Ga0068859_1001146743 | 132 |
| 230 | 3300005617 | Ga0068859_100140847 | Ga0068859_1001408472 | 132 |
| 231 | 3300005617 | Ga0068859_100224941 | Ga0068859_1002249413 | 132 |
| 232 | 3300005617 | Ga0068859_101566274 | Ga0068859_1015662742 | 132 |
| 233 | 3300005618 | Ga0068864_100071466 | Ga0068864_1000714663 | 132 |
| 234 | 3300005618 | Ga0068864_100491847 | Ga0068864_1004918471 | 132 |
| 235 | 3300005618 | Ga0068864_100860862 | Ga0068864_1008608622 | 132 |
| 236 | 3300005618 | Ga0068864_101611672 | Ga0068864_1016116722 | 132 |
| 237 | 3300005718 | Ga0068866_10740771 | Ga0068866_107407712 | 132 |
| 238 | 3300005834 | Ga0068851_10193500 | Ga0068851_101935002 | 132 |
| 239 | 3300005834 | Ga0068851_10559476 | Ga0068851_105594761 | 132 |
| 240 | 3300005834 | Ga0068851_10688108 | Ga0068851_106881081 | 132 |
| 241 | 3300005841 | Ga0068863_100061135 | Ga0068863_1000611353 | 132 |
| 242 | 3300005841 | Ga0068863_100448267 | Ga0068863_1004482672 | 132 |
| 243 | 3300005841 | Ga0068863_100828140 | Ga0068863_1008281402 | 132 |
| 244 | 3300005842 | Ga0068858_100014273 | Ga0068858_1000142737 | 132 |
| 245 | 3300005842 | Ga0068858_100014925 | Ga0068858_1000149258 | 132 |
| 246 | 3300005842 | Ga0068858_100079403 | Ga0068858_1000794033 | 132 |
| 247 | 3300005842 | Ga0068858_100440726 | Ga0068858_1004407262 | 132 |
| 248 | 3300005842 | Ga0068858_101292395 | Ga0068858_1012923951 | 132 |
| 249 | 3300005842 | Ga0068858_101959175 | Ga0068858_1019591751 | 132 |
| 250 | 3300005842 | Ga0068858_102393672 | Ga0068858_1023936721 | 132 |
| 251 | 3300005843 | Ga0068860_100110137 | Ga0068860_1001101372 | 132 |
| 252 | 3300005844 | Ga0068862_100007719 | Ga0068862_10000771910 | 132 |
| 253 | 3300005844 | Ga0068862_101381899 | Ga0068862_1013818992 | 132 |
| 254 | 3300006028 | Ga0070717_10300641 | Ga0070717_103006412 | 132 |
| 255 | 3300006028 | Ga0070717_10482695 | Ga0070717_104826952 | 132 |
| 256 | 3300006173 | Ga0070716_100060089 | Ga0070716_1000600892 | 132 |
| 257 | 3300006175 | Ga0070712_100035780 | Ga0070712_1000357803 | 132 |
| 258 | 3300006237 | Ga0097621_100507081 | Ga0097621_1005070812 | 132 |
| 259 | 3300006237 | Ga0097621_100607773 | Ga0097621_1006077732 | 132 |
| 260 | 3300006237 | Ga0097621_102266349 | Ga0097621_1022663491 | 132 |
| 261 | 3300006358 | Ga0068871_100028454 | Ga0068871_1000284543 | 132 |
| 262 | 3300006358 | Ga0068871_100128772 | Ga0068871_1001287722 | 132 |
| 263 | 3300006358 | Ga0068871_100388942 | Ga0068871_1003889421 | 132 |
| 264 | 3300006931 | Ga0097620_100114673 | Ga0097620_1001146733 | 132 |
| 265 | 3300006931 | Ga0097620_100140845 | Ga0097620_1001408453 | 132 |
| 266 | 3300006931 | Ga0097620_100224935 | Ga0097620_1002249351 | 132 |
| 267 | 3300006931 | Ga0097620_101566326 | Ga0097620_1015663262 | 132 |
| 268 | 3300009098 | Ga0105245_10105004 | Ga0105245_101050043 | 132 |
| 269 | 3300009098 | Ga0105245_10469794 | Ga0105245_104697943 | 132 |
| 270 | 3300009101 | Ga0105247_11194476 | Ga0105247_111944761 | 132 |
| 271 | 3300009174 | Ga0105241_11096558 | Ga0105241_110965582 | 132 |
| 272 | 3300009174 | Ga0105241_11247336 | Ga0105241_112473362 | 132 |
| 273 | 3300009177 | Ga0105248_10002275 | Ga0105248_1000227515 | 132 |
| 274 | 3300009177 | Ga0105248_10434885 | Ga0105248_104348852 | 132 |
| 275 | 3300009177 | Ga0105248_10438163 | Ga0105248_104381632 | 132 |
| 276 | 3300009177 | Ga0105248_10481895 | Ga0105248_104818952 | 132 |
| 277 | 3300009177 | Ga0105248_11171501 | Ga0105248_111715012 | 132 |
| 278 | 3300009545 | Ga0105237_12342428 | Ga0105237_123424282 | 132 |
| 279 | 3300009551 | Ga0105238_10249509 | Ga0105238_102495094 | 132 |
| 280 | 3300009553 | Ga0105249_10171397 | Ga0105249_101713972 | 132 |
| 281 | 3300011119 | Ga0105246_11049524 | Ga0105246_110495242 | 132 |
| 282 | 3300013100 | Ga0157373_10007653 | Ga0157373_100076532 | 132 |
| 283 | 3300013100 | Ga0157373_10144492 | Ga0157373_101444924 | 132 |
| 284 | 3300013100 | Ga0157373_10165418 | Ga0157373_101654182 | 132 |
| 285 | 3300013100 | Ga0157373_10192740 | Ga0157373_101927402 | 132 |
| 286 | 3300013100 | Ga0157373_10916228 | Ga0157373_109162282 | 132 |
| 287 | 3300013102 | Ga0157371_10367166 | Ga0157371_103671662 | 132 |
| 288 | 3300013102 | Ga0157371_10506977 | Ga0157371_105069772 | 132 |
| 289 | 3300013102 | Ga0157371_11593654 | Ga0157371_115936542 | 132 |
| 290 | 3300013104 | Ga0157370_10267251 | Ga0157370_102672511 | 132 |
| 291 | 3300013104 | Ga0157370_10444054 | Ga0157370_104440542 | 132 |
| 292 | 3300013105 | Ga0157369_10233366 | Ga0157369_102333661 | 132 |
| 293 | 3300013296 | Ga0157374_10060461 | Ga0157374_100604617 | 132 |
| 294 | 3300013296 | Ga0157374_10622018 | Ga0157374_106220182 | 132 |
| 295 | 3300013296 | Ga0157374_11922130 | Ga0157374_119221301 | 132 |
| 296 | 3300013297 | Ga0157378_10142862 | Ga0157378_101428623 | 132 |
| 297 | 3300013297 | Ga0157378_10763158 | Ga0157378_107631582 | 132 |
| 298 | 3300013306 | Ga0163162_10297777 | Ga0163162_102977772 | 132 |
| 299 | 3300013306 | Ga0163162_11291182 | Ga0163162_112911821 | 132 |
| 300 | 3300013307 | Ga0157372_10897301 | Ga0157372_108973012 | 132 |
| 301 | 3300013307 | Ga0157372_12451678 | Ga0157372_124516781 | 132 |
| 302 | 3300013307 | Ga0157372_13166674 | Ga0157372_131666742 | 132 |
| 303 | 3300013308 | Ga0157375_10970534 | Ga0157375_109705342 | 132 |
| 304 | 3300013308 | Ga0157375_11191729 | Ga0157375_111917293 | 132 |
| 305 | 3300013308 | Ga0157375_13747907 | Ga0157375_137479072 | 132 |
| 306 | 3300013308 | Ga0157375_13747909 | Ga0157375_137479092 | 132 |
| 307 | 3300014497 | Ga0182008_10218369 | Ga0182008_102183692 | 132 |
| 308 | 3300014968 | Ga0157379_10185574 | Ga0157379_101855742 | 132 |
| 309 | 3300014968 | Ga0157379_10330052 | Ga0157379_103300522 | 132 |
| 310 | 3300014968 | Ga0157379_10957066 | Ga0157379_109570661 | 132 |
| 311 | 3300017792 | Ga0163161_10754500 | Ga0163161_107545002 | 132 |
| 312 | 3300025315 | Ga0207697_10226495 | Ga0207697_102264951 | 132 |
| 313 | 3300025321 | Ga0207656_10439753 | Ga0207656_104397532 | 132 |
| 314 | 3300025893 | Ga0207682_10103223 | Ga0207682_101032232 | 132 |
| 315 | 3300025893 | Ga0207682_10376467 | Ga0207682_103764672 | 132 |
| 316 | 3300025900 | Ga0207710_10324980 | Ga0207710_103249801 | 132 |
| 317 | 3300025901 | Ga0207688_10181146 | Ga0207688_101811462 | 132 |
| 318 | 3300025901 | Ga0207688_10221714 | Ga0207688_102217142 | 132 |
| 319 | 3300025901 | Ga0207688_10331347 | Ga0207688_103313472 | 132 |
| 320 | 3300025903 | Ga0207680_10001045 | Ga0207680_1000104515 | 132 |
| 321 | 3300025903 | Ga0207680_10074839 | Ga0207680_100748392 | 132 |
| 322 | 3300025903 | Ga0207680_10098215 | Ga0207680_100982152 | 132 |
| 323 | 3300025903 | Ga0207680_10166118 | Ga0207680_101661182 | 132 |
| 324 | 3300025903 | Ga0207680_10280832 | Ga0207680_102808322 | 132 |
| 325 | 3300025903 | Ga0207680_10289930 | Ga0207680_102899302 | 132 |
| 326 | 3300025903 | Ga0207680_10375760 | Ga0207680_103757602 | 132 |
| 327 | 3300025904 | Ga0207647_10151397 | Ga0207647_101513973 | 132 |
| 328 | 3300025906 | Ga0207699_10084968 | Ga0207699_100849682 | 132 |
| 329 | 3300025907 | Ga0207645_10071914 | Ga0207645_100719143 | 132 |
| 330 | 3300025907 | Ga0207645_10102506 | Ga0207645_101025063 | 132 |
| 331 | 3300025907 | Ga0207645_10325531 | Ga0207645_103255312 | 132 |
| 332 | 3300025907 | Ga0207645_10644589 | Ga0207645_106445892 | 132 |
| 333 | 3300025907 | Ga0207645_10874531 | Ga0207645_108745312 | 132 |
| 334 | 3300025909 | Ga0207705_10038128 | Ga0207705_100381283 | 132 |
| 335 | 3300025909 | Ga0207705_10110496 | Ga0207705_101104964 | 132 |
| 336 | 3300025909 | Ga0207705_10133292 | Ga0207705_101332922 | 132 |
| 337 | 3300025909 | Ga0207705_10197698 | Ga0207705_101976982 | 132 |
| 338 | 3300025909 | Ga0207705_10651975 | Ga0207705_106519751 | 132 |
| 339 | 3300025909 | Ga0207705_10902217 | Ga0207705_109022172 | 132 |
| 340 | 3300025909 | Ga0207705_11209844 | Ga0207705_112098441 | 132 |
| 341 | 3300025911 | Ga0207654_11387068 | Ga0207654_113870681 | 132 |
| 342 | 3300025912 | Ga0207707_10716013 | Ga0207707_107160131 | 132 |
| 343 | 3300025913 | Ga0207695_11348552 | Ga0207695_113485522 | 132 |
| 344 | 3300025915 | Ga0207693_10006527 | Ga0207693_100065276 | 132 |
| 345 | 3300025919 | Ga0207657_10015919 | Ga0207657_1001591910 | 132 |
| 346 | 3300025919 | Ga0207657_10030402 | Ga0207657_100304026 | 132 |
| 347 | 3300025919 | Ga0207657_10077058 | Ga0207657_100770582 | 132 |
| 348 | 3300025919 | Ga0207657_10208809 | Ga0207657_102088092 | 132 |
| 349 | 3300025919 | Ga0207657_10287448 | Ga0207657_102874482 | 132 |
| 350 | 3300025919 | Ga0207657_10355658 | Ga0207657_103556583 | 132 |
| 351 | 3300025919 | Ga0207657_10542512 | Ga0207657_105425121 | 132 |
| 352 | 3300025919 | Ga0207657_10645177 | Ga0207657_106451772 | 132 |
| 353 | 3300025919 | Ga0207657_11179770 | Ga0207657_111797702 | 132 |
| 354 | 3300025920 | Ga0207649_10033848 | Ga0207649_100338482 | 132 |
| 355 | 3300025920 | Ga0207649_10043747 | Ga0207649_100437473 | 132 |
| 356 | 3300025920 | Ga0207649_10062674 | Ga0207649_100626742 | 132 |
| 357 | 3300025920 | Ga0207649_10248986 | Ga0207649_102489862 | 132 |
| 358 | 3300025920 | Ga0207649_10265702 | Ga0207649_102657022 | 132 |
| 359 | 3300025920 | Ga0207649_10364158 | Ga0207649_103641582 | 132 |
| 360 | 3300025920 | Ga0207649_10396457 | Ga0207649_103964571 | 132 |
| 361 | 3300025921 | Ga0207652_10336882 | Ga0207652_103368821 | 132 |
| 362 | 3300025921 | Ga0207652_10631382 | Ga0207652_106313822 | 132 |
| 363 | 3300025924 | Ga0207694_10192731 | Ga0207694_101927312 | 132 |
| 364 | 3300025924 | Ga0207694_10272791 | Ga0207694_102727912 | 132 |
| 365 | 3300025925 | Ga0207650_10128250 | Ga0207650_101282502 | 132 |
| 366 | 3300025925 | Ga0207650_10135623 | Ga0207650_101356233 | 132 |
| 367 | 3300025925 | Ga0207650_10225311 | Ga0207650_102253113 | 132 |
| 368 | 3300025925 | Ga0207650_10657602 | Ga0207650_106576022 | 132 |
| 369 | 3300025925 | Ga0207650_11018551 | Ga0207650_110185512 | 132 |
| 370 | 3300025926 | Ga0207659_10394184 | Ga0207659_103941842 | 132 |
| 371 | 3300025927 | Ga0207687_10874780 | Ga0207687_108747802 | 132 |
| 372 | 3300025928 | Ga0207700_10135095 | Ga0207700_101350953 | 132 |
| 373 | 3300025928 | Ga0207700_10352237 | Ga0207700_103522372 | 132 |
| 374 | 3300025928 | Ga0207700_10772137 | Ga0207700_107721372 | 132 |
| 375 | 3300025928 | Ga0207700_11785957 | Ga0207700_117859572 | 132 |
| 376 | 3300025929 | Ga0207664_10043273 | Ga0207664_100432735 | 132 |
| 377 | 3300025929 | Ga0207664_10281559 | Ga0207664_102815592 | 132 |
| 378 | 3300025929 | Ga0207664_10730771 | Ga0207664_107307712 | 132 |
| 379 | 3300025931 | Ga0207644_10000847 | Ga0207644_1000084722 | 132 |
| 380 | 3300025931 | Ga0207644_10011794 | Ga0207644_100117942 | 132 |
| 381 | 3300025931 | Ga0207644_10023868 | Ga0207644_100238682 | 132 |
| 382 | 3300025931 | Ga0207644_10034654 | Ga0207644_100346544 | 132 |
| 383 | 3300025931 | Ga0207644_10069347 | Ga0207644_100693474 | 132 |
| 384 | 3300025931 | Ga0207644_10238171 | Ga0207644_102381713 | 132 |
| 385 | 3300025931 | Ga0207644_10682077 | Ga0207644_106820772 | 132 |
| 386 | 3300025931 | Ga0207644_11037995 | Ga0207644_110379952 | 132 |
| 387 | 3300025931 | Ga0207644_11188349 | Ga0207644_111883492 | 132 |
| 388 | 3300025932 | Ga0207690_10228167 | Ga0207690_102281672 | 132 |
| 389 | 3300025932 | Ga0207690_10277051 | Ga0207690_102770512 | 132 |
| 390 | 3300025932 | Ga0207690_10298268 | Ga0207690_102982682 | 132 |
| 391 | 3300025932 | Ga0207690_10367097 | Ga0207690_103670972 | 132 |
| 392 | 3300025932 | Ga0207690_10376653 | Ga0207690_103766532 | 132 |
| 393 | 3300025932 | Ga0207690_10471279 | Ga0207690_104712792 | 132 |
| 394 | 3300025932 | Ga0207690_11115537 | Ga0207690_111155372 | 132 |
| 395 | 3300025932 | Ga0207690_11239821 | Ga0207690_112398211 | 132 |
| 396 | 3300025933 | Ga0207706_10000253 | Ga0207706_1000025332 | 132 |
| 397 | 3300025933 | Ga0207706_10004173 | Ga0207706_100041734 | 132 |
| 398 | 3300025933 | Ga0207706_10055811 | Ga0207706_100558113 | 132 |
| 399 | 3300025933 | Ga0207706_10060026 | Ga0207706_100600266 | 132 |
| 400 | 3300025933 | Ga0207706_10282862 | Ga0207706_102828622 | 132 |
| 401 | 3300025933 | Ga0207706_10354629 | Ga0207706_103546292 | 132 |
| 402 | 3300025933 | Ga0207706_10679275 | Ga0207706_106792752 | 132 |
| 403 | 3300025933 | Ga0207706_10777166 | Ga0207706_107771662 | 132 |
| 404 | 3300025933 | Ga0207706_10936011 | Ga0207706_109360111 | 132 |
| 405 | 3300025937 | Ga0207669_10035217 | Ga0207669_100352171 | 132 |
| 406 | 3300025937 | Ga0207669_10070448 | Ga0207669_100704482 | 132 |
| 407 | 3300025937 | Ga0207669_10396507 | Ga0207669_103965072 | 132 |
| 408 | 3300025937 | Ga0207669_10528940 | Ga0207669_105289401 | 132 |
| 409 | 3300025937 | Ga0207669_11244531 | Ga0207669_112445312 | 132 |
| 410 | 3300025937 | Ga0207669_11478669 | Ga0207669_114786692 | 132 |
| 411 | 3300025939 | Ga0207665_10150585 | Ga0207665_101505852 | 132 |
| 412 | 3300025940 | Ga0207691_10004350 | Ga0207691_100043509 | 132 |
| 413 | 3300025940 | Ga0207691_10027663 | Ga0207691_100276635 | 132 |
| 414 | 3300025940 | Ga0207691_10096941 | Ga0207691_100969413 | 132 |
| 415 | 3300025940 | Ga0207691_10137747 | Ga0207691_101377473 | 132 |
| 416 | 3300025940 | Ga0207691_10221124 | Ga0207691_102211242 | 132 |
| 417 | 3300025940 | Ga0207691_10228433 | Ga0207691_102284332 | 132 |
| 418 | 3300025940 | Ga0207691_10369005 | Ga0207691_103690052 | 132 |
| 419 | 3300025941 | Ga0207711_10000309 | Ga0207711_1000030935 | 132 |
| 420 | 3300025941 | Ga0207711_10002790 | Ga0207711_1000279020 | 132 |
| 421 | 3300025941 | Ga0207711_10024125 | Ga0207711_100241252 | 132 |
| 422 | 3300025941 | Ga0207711_10113799 | Ga0207711_101137992 | 132 |
| 423 | 3300025941 | Ga0207711_10145943 | Ga0207711_101459432 | 132 |
| 424 | 3300025941 | Ga0207711_10473852 | Ga0207711_104738522 | 132 |
| 425 | 3300025942 | Ga0207689_10156323 | Ga0207689_101563232 | 132 |
| 426 | 3300025945 | Ga0207679_10038485 | Ga0207679_100384855 | 132 |
| 427 | 3300025945 | Ga0207679_10059628 | Ga0207679_100596283 | 132 |
| 428 | 3300025945 | Ga0207679_10178336 | Ga0207679_101783362 | 132 |
| 429 | 3300025945 | Ga0207679_10230107 | Ga0207679_102301073 | 132 |
| 430 | 3300025945 | Ga0207679_10519864 | Ga0207679_105198643 | 132 |
| 431 | 3300025945 | Ga0207679_11036325 | Ga0207679_110363252 | 132 |
| 432 | 3300025945 | Ga0207679_11201249 | Ga0207679_112012491 | 132 |
| 433 | 3300025945 | Ga0207679_11222780 | Ga0207679_112227802 | 132 |
| 434 | 3300025945 | Ga0207679_11261496 | Ga0207679_112614961 | 132 |
| 435 | 3300025945 | Ga0207679_11414551 | Ga0207679_114145512 | 132 |
| 436 | 3300025949 | Ga0207667_10097958 | Ga0207667_100979582 | 132 |
| 437 | 3300025949 | Ga0207667_10317951 | Ga0207667_103179512 | 132 |
| 438 | 3300025949 | Ga0207667_10421941 | Ga0207667_104219411 | 132 |
| 439 | 3300025949 | Ga0207667_11157918 | Ga0207667_111579181 | 132 |
| 440 | 3300025960 | Ga0207651_10014293 | Ga0207651_100142937 | 132 |
| 441 | 3300025960 | Ga0207651_10024871 | Ga0207651_100248713 | 132 |
| 442 | 3300025960 | Ga0207651_10047390 | Ga0207651_100473904 | 132 |
| 443 | 3300025960 | Ga0207651_10056300 | Ga0207651_100563001 | 132 |
| 444 | 3300025960 | Ga0207651_10112290 | Ga0207651_101122902 | 132 |
| 445 | 3300025960 | Ga0207651_10296759 | Ga0207651_102967592 | 132 |
| 446 | 3300025960 | Ga0207651_10958373 | Ga0207651_109583732 | 132 |
| 447 | 3300025961 | Ga0207712_10139451 | Ga0207712_101394512 | 132 |
| 448 | 3300025972 | Ga0207668_10135900 | Ga0207668_101359002 | 132 |
| 449 | 3300025972 | Ga0207668_10505476 | Ga0207668_105054762 | 132 |
| 450 | 3300025981 | Ga0207640_10016718 | Ga0207640_100167184 | 132 |
| 451 | 3300025981 | Ga0207640_10133642 | Ga0207640_101336422 | 132 |
| 452 | 3300025981 | Ga0207640_10252858 | Ga0207640_102528582 | 132 |
| 453 | 3300025981 | Ga0207640_10255497 | Ga0207640_102554973 | 132 |
| 454 | 3300025981 | Ga0207640_10282198 | Ga0207640_102821982 | 132 |
| 455 | 3300025981 | Ga0207640_10791873 | Ga0207640_107918732 | 132 |
| 456 | 3300025986 | Ga0207658_10080839 | Ga0207658_100808392 | 132 |
| 457 | 3300025986 | Ga0207658_10130613 | Ga0207658_101306132 | 132 |
| 458 | 3300025986 | Ga0207658_10167084 | Ga0207658_101670842 | 132 |
| 459 | 3300025986 | Ga0207658_10204778 | Ga0207658_102047781 | 132 |
| 460 | 3300025986 | Ga0207658_10996567 | Ga0207658_109965672 | 132 |
| 461 | 3300025986 | Ga0207658_11240859 | Ga0207658_112408592 | 132 |
| 462 | 3300026023 | Ga0207677_10019204 | Ga0207677_100192045 | 132 |
| 463 | 3300026023 | Ga0207677_10248012 | Ga0207677_102480122 | 132 |
| 464 | 3300026035 | Ga0207703_10001905 | Ga0207703_1000190513 | 132 |
| 465 | 3300026035 | Ga0207703_10031527 | Ga0207703_100315277 | 132 |
| 466 | 3300026035 | Ga0207703_10047014 | Ga0207703_100470143 | 132 |
| 467 | 3300026035 | Ga0207703_10079230 | Ga0207703_100792303 | 132 |
| 468 | 3300026041 | Ga0207639_10049224 | Ga0207639_100492244 | 132 |
| 469 | 3300026041 | Ga0207639_10326827 | Ga0207639_103268271 | 132 |
| 470 | 3300026041 | Ga0207639_10659652 | Ga0207639_106596522 | 132 |
| 471 | 3300026041 | Ga0207639_10705611 | Ga0207639_107056112 | 132 |
| 472 | 3300026041 | Ga0207639_11056184 | Ga0207639_110561841 | 132 |
| 473 | 3300026041 | Ga0207639_11489900 | Ga0207639_114899002 | 132 |
| 474 | 3300026067 | Ga0207678_10016793 | Ga0207678_100167936 | 132 |
| 475 | 3300026067 | Ga0207678_10081603 | Ga0207678_100816034 | 132 |
| 476 | 3300026067 | Ga0207678_10114121 | Ga0207678_101141212 | 132 |
| 477 | 3300026067 | Ga0207678_10172330 | Ga0207678_101723302 | 132 |
| 478 | 3300026067 | Ga0207678_10222422 | Ga0207678_102224222 | 132 |
| 479 | 3300026067 | Ga0207678_10276911 | Ga0207678_102769112 | 132 |
| 480 | 3300026067 | Ga0207678_10699177 | Ga0207678_106991772 | 132 |
| 481 | 3300026067 | Ga0207678_11378426 | Ga0207678_113784261 | 132 |
| 482 | 3300026078 | Ga0207702_10444675 | Ga0207702_104446752 | 132 |
| 483 | 3300026088 | Ga0207641_10120626 | Ga0207641_101206262 | 132 |
| 484 | 3300026088 | Ga0207641_10319703 | Ga0207641_103197032 | 132 |
| 485 | 3300026088 | Ga0207641_10711446 | Ga0207641_107114462 | 132 |
| 486 | 3300026089 | Ga0207648_10017417 | Ga0207648_1001741710 | 132 |
| 487 | 3300026089 | Ga0207648_10049684 | Ga0207648_100496846 | 132 |
| 488 | 3300026089 | Ga0207648_10622079 | Ga0207648_106220792 | 132 |
| 489 | 3300026095 | Ga0207676_10016579 | Ga0207676_100165793 | 132 |
| 490 | 3300026095 | Ga0207676_10027536 | Ga0207676_100275362 | 132 |
| 491 | 3300026095 | Ga0207676_10270319 | Ga0207676_102703192 | 132 |
| 492 | 3300026095 | Ga0207676_11552566 | Ga0207676_115525662 | 132 |
| 493 | 3300026095 | Ga0207676_12076361 | Ga0207676_120763611 | 132 |
| 494 | 3300026116 | Ga0207674_10083533 | Ga0207674_100835333 | 132 |
| 495 | 3300026116 | Ga0207674_10135320 | Ga0207674_101353203 | 132 |
| 496 | 3300026121 | Ga0207683_10001185 | Ga0207683_1000118528 | 132 |
| 497 | 3300026121 | Ga0207683_10031898 | Ga0207683_100318983 | 132 |
| 498 | 3300026121 | Ga0207683_10095107 | Ga0207683_100951073 | 132 |
| 499 | 3300026121 | Ga0207683_10173531 | Ga0207683_101735313 | 132 |
| 500 | 3300026121 | Ga0207683_10207231 | Ga0207683_102072313 | 132 |
| 501 | 3300026142 | Ga0207698_10025991 | Ga0207698_100259912 | 132 |
| 502 | 3300026142 | Ga0207698_10060036 | Ga0207698_100600363 | 132 |
| 503 | 3300026142 | Ga0207698_10177393 | Ga0207698_101773934 | 132 |
| 504 | 3300026142 | Ga0207698_10180433 | Ga0207698_101804334 | 132 |
| 505 | 3300026142 | Ga0207698_10317904 | Ga0207698_103179043 | 132 |
| 506 | 3300026142 | Ga0207698_10319124 | Ga0207698_103191242 | 132 |
| 507 | 3300026142 | Ga0207698_11112101 | Ga0207698_111121012 | 132 |
| 508 | 3300028379 | Ga0268266_10032604 | Ga0268266_100326045 | 132 |
| 509 | 3300028379 | Ga0268266_10096853 | Ga0268266_100968534 | 132 |
| 510 | 3300028379 | Ga0268266_11443414 | Ga0268266_114434142 | 132 |
| 511 | 3300028380 | Ga0268265_10001273 | Ga0268265_1000127312 | 132 |
| 512 | 3300028380 | Ga0268265_10440599 | Ga0268265_104405992 | 132 |
| 513 | 3300028381 | Ga0268264_10060221 | Ga0268264_100602213 | 132 |
| 514 | 3300028381 | Ga0268264_10965940 | Ga0268264_109659402 | 132 |
| 515 | 3300031901 | Ga0307406_11696465 | Ga0307406_116964651 | 132 |
| 516 | 3300032004 | Ga0307414_10747327 | Ga0307414_107473271 | 132 |
| 517 | 3300032004 | Ga0307414_11245357 | Ga0307414_112453572 | 132 |
| 518 | 3300034957 | Ga0373938_0206042 | Ga0373938_0206042_14_415 | 132 |
| 519 | 3300035691 | Ga0373931_0062393 | Ga0373931_0062393_1305_1706 | 132 |
| 520 | 3300035692 | Ga0373935_0015144 | Ga0373935_0015144_3328_3729 | 132 |
| 521 | 3300037312 | Ga0395899_0023813 | Ga0395899_0023813_2898_3305 | 132 |
| 522 | 3300037312 | Ga0395899_0031040 | Ga0395899_0031040_2266_2664 | 132 |
| 523 | 3300037312 | Ga0395899_0045871 | Ga0395899_0045871_1771_2169 | 132 |
| 524 | 3300037312 | Ga0395899_0079694 | Ga0395899_0079694_1697_2098 | 132 |
| 525 | 3300037312 | Ga0395899_0115826 | Ga0395899_0115826_575_973 | 132 |
| 526 | 3300037312 | Ga0395899_0952512 | Ga0395899_0952512_83_481 | 132 |
| 527 | 3300037418 | Ga0395900_0001256 | Ga0395900_0001256_17807_18214 | 132 |
| 528 | 3300037418 | Ga0395900_0029387 | Ga0395900_0029387_1382_1780 | 132 |
| 529 | 3300037418 | Ga0395900_0033179 | Ga0395900_0033179_1053_1454 | 132 |
| 530 | 3300037418 | Ga0395900_0061036 | Ga0395900_0061036_3335_3733 | 132 |
| 531 | 3300037418 | Ga0395900_0107691 | Ga0395900_0107691_1982_2383 | 132 |
| 532 | 3300037418 | Ga0395900_0251170 | Ga0395900_0251170_669_1067 | 132 |
| 533 | 3300037418 | Ga0395900_0329722 | Ga0395900_0329722_962_1360 | 132 |
| 534 | 3300037418 | Ga0395900_0643361 | Ga0395900_0643361_535_933 | 132 |
| 535 | 3300037418 | Ga0395900_0653959 | Ga0395900_0653959_125_523 | 132 |
| 536 | 3300037418 | Ga0395900_0688342 | Ga0395900_0688342_320_721 | 132 |
| 537 | 3300037418 | Ga0395900_0965935 | Ga0395900_0965935_85_486 | 132 |
| 538 | 3300037418 | Ga0395900_1228379 | Ga0395900_1228379_201_599 | 132 |
| 539 | 3300037418 | Ga0395900_1576971 | Ga0395900_1576971_72_482 | 132 |
| 540 | 3300037418 | Ga0395900_1729246 | Ga0395900_1729246_97_498 | 132 |
| 541 | 3300037466 | Ga0395898_0062486 | Ga0395898_0062486_1865_2263 | 132 |
| 542 | 3300037466 | Ga0395898_0086667 | Ga0395898_0086667_2391_2789 | 132 |
| 543 | 3300037466 | Ga0395898_0086709 | Ga0395898_0086709_1676_2074 | 132 |
| 544 | 3300037466 | Ga0395898_0178805 | Ga0395898_0178805_692_1090 | 132 |
| 545 | 3300037466 | Ga0395898_0245417 | Ga0395898_0245417_749_1159 | 132 |
| 546 | 3300037466 | Ga0395898_0647658 | Ga0395898_0647658_442_843 | 132 |
| 547 | 3300037466 | Ga0395898_1905888 | Ga0395898_1905888_26_424 | 132 |
| 548 | 3300037471 | Ga0395905_0000610 | Ga0395905_0000610_22190_22597 | 132 |
| 549 | 3300037471 | Ga0395905_0002249 | Ga0395905_0002249_7899_8300 | 132 |
| 550 | 3300037471 | Ga0395905_0045122 | Ga0395905_0045122_1679_2080 | 132 |
| 551 | 3300037471 | Ga0395905_0046707 | Ga0395905_0046707_3320_3730 | 132 |
| 552 | 3300037471 | Ga0395905_0057011 | Ga0395905_0057011_1382_1780 | 132 |
| 553 | 3300037471 | Ga0395905_0080959 | Ga0395905_0080959_530_928 | 132 |
| 554 | 3300037471 | Ga0395905_0126559 | Ga0395905_0126559_1819_2217 | 132 |
| 555 | 3300037471 | Ga0395905_0163659 | Ga0395905_0163659_1681_2079 | 132 |
| 556 | 3300037471 | Ga0395905_1043269 | Ga0395905_1043269_55_456 | 132 |
| 557 | 3300037471 | Ga0395905_1212166 | Ga0395905_1212166_181_579 | 132 |
| 558 | 3300037471 | Ga0395905_1437356 | Ga0395905_1437356_31_432 | 132 |
| 559 | 3300037471 | Ga0395905_1601567 | Ga0395905_1601567_122_523 | 132 |
| 560 | 3300038443 | Ga0395901_0054927 | Ga0395901_0054927_1090_1488 | 132 |
| 561 | 3300038443 | Ga0395901_0128016 | Ga0395901_0128016_893_1294 | 132 |
| 562 | 3300038443 | Ga0395901_0181515 | Ga0395901_0181515_1709_2107 | 132 |
| 563 | 3300038443 | Ga0395901_0213374 | Ga0395901_0213374_893_1291 | 132 |
| 564 | 3300038443 | Ga0395901_0339569 | Ga0395901_0339569_829_1227 | 132 |
| 565 | 3300038443 | Ga0395901_0445157 | Ga0395901_0445157_316_714 | 132 |
| 566 | 3300038443 | Ga0395901_1299699 | Ga0395901_1299699_174_602 | 132 |
| 567 | 3300038443 | Ga0395901_1437070 | Ga0395901_1437070_68_478 | 132 |
| 568 | 3300039437 | Ga0436365_0269996 | Ga0436365_0269996_1001_1402 | 132 |
| 569 | 3300039437 | Ga0436365_0782999 | Ga0436365_0782999_634_1035 | 132 |
| 570 | 3300044658 | Ga0466972_0129046 | Ga0466972_0129046_715_1116 | 132 |
| 571 | 3300044658 | Ga0466972_0376665 | Ga0466972_0376665_24_425 | 132 |
| 572 | 3300044683 | Ga0466965_0147870 | Ga0466965_0147870_382_783 | 132 |
| 573 | 3300044684 | Ga0466966_0317002 | Ga0466966_0317002_174_575 | 132 |
| 574 | 3300044693 | Ga0466961_0188940 | Ga0466961_0188940_486_887 | 132 |
| 575 | 3300044693 | Ga0466961_0265098 | Ga0466961_0265098_576_974 | 132 |
| 576 | 3300044693 | Ga0466961_0268318 | Ga0466961_0268318_331_729 | 132 |
| 577 | 3300044694 | Ga0466963_0313274 | Ga0466963_0313274_404_802 | 132 |
| 578 | 3300044694 | Ga0466963_0479496 | Ga0466963_0479496_307_708 | 132 |
| 579 | 3300044694 | Ga0466963_1028968 | Ga0466963_1028968_112_513 | 132 |
| 580 | 3300044694 | Ga0466963_1244373 | Ga0466963_1244373_100_501 | 132 |
| 581 | 3300044719 | Ga0466971_0105234 | Ga0466971_0105234_391_792 | 132 |
| 582 | 3300044765 | Ga0466970_0605626 | Ga0466970_0605626_98_499 | 132 |
| 583 | 3300044842 | Ga0466957_0177706 | Ga0466957_0177706_535_936 | 132 |
| 584 | 3300044842 | Ga0466957_0366253 | Ga0466957_0366253_249_650 | 132 |
| 585 | 3300044901 | Ga0466960_0021572 | Ga0466960_0021572_993_1394 | 132 |
| 586 | 3300044901 | Ga0466960_0079229 | Ga0466960_0079229_681_1082 | 132 |
| 587 | 3300044901 | Ga0466960_0252111 | Ga0466960_0252111_558_959 | 132 |
| 588 | 3300045836 | Ga0466958_0140952 | Ga0466958_0140952_686_1087 | 132 |
| 589 | 3300045836 | Ga0466958_0648102 | Ga0466958_0648102_151_552 | 132 |
| 590 | 3300045976 | Ga0466967_0030324 | Ga0466967_0030324_2452_2850 | 132 |
| 591 | 3300045976 | Ga0466967_0082454 | Ga0466967_0082454_2067_2468 | 132 |
| 592 | 3300045976 | Ga0466967_0293601 | Ga0466967_0293601_183_584 | 132 |
| 593 | 3300045976 | Ga0466967_0371592 | Ga0466967_0371592_793_1191 | 132 |
| 594 | 3300045976 | Ga0466967_0402856 | Ga0466967_0402856_23_424 | 132 |
| 595 | 3300045976 | Ga0466967_0607222 | Ga0466967_0607222_178_579 | 132 |
| 596 | 3300045976 | Ga0466967_0712629 | Ga0466967_0712629_355_756 | 132 |
| 597 | 3300045976 | Ga0466967_1021962 | Ga0466967_1021962_259_660 | 132 |
| 598 | 3300045976 | Ga0466967_1869347 | Ga0466967_1869347_16_414 | 132 |
| 599 | 3300046459 | Ga0495629_0370635 | Ga0495629_0370635_549_947 | 132 |
| 600 | 3300046472 | Ga0495580_0320871 | Ga0495580_0320871_117_515 | 132 |
| 601 | 3300046491 | Ga0495584_0448815 | Ga0495584_0448815_204_605 | 132 |
| 602 | 3300046507 | Ga0495606_0269934 | Ga0495606_0269934_319_720 | 132 |
| 603 | 3300046512 | Ga0495610_0171907 | Ga0495610_0171907_291_692 | 132 |
| 604 | 3300046515 | Ga0495620_0117537 | Ga0495620_0117537_421_822 | 132 |
| 605 | 3300046537 | Ga0495598_0000202 | Ga0495598_0000202_327_728 | 132 |
| 606 | 3300046539 | Ga0495621_0000141 | Ga0495621_0000141_10883_11284 | 132 |
| 607 | 3300046539 | Ga0495621_0056609 | Ga0495621_0056609_880_1281 | 132 |
| 608 | 3300046616 | Ga0495668_0008461 | Ga0495668_0008461_4774_5175 | 132 |
| 609 | 3300046616 | Ga0495668_0049292 | Ga0495668_0049292_1808_2209 | 132 |
| 610 | 3300046660 | Ga0495625_0635732 | Ga0495625_0635732_132_533 | 132 |
| 611 | 3300046684 | Ga0495669_0000276 | Ga0495669_0000276_6318_6719 | 132 |
| 612 | 3300046684 | Ga0495669_0001818 | Ga0495669_0001818_6409_6810 | 132 |
| 613 | 3300046684 | Ga0495669_0065845 | Ga0495669_0065845_1097_1498 | 132 |
| 614 | 3300046684 | Ga0495669_0421777 | Ga0495669_0421777_236_634 | 132 |
| 615 | 3300046691 | Ga0495670_0001165 | Ga0495670_0001165_412_813 | 132 |
| 616 | 3300047445 | Ga0495677_0013866 | Ga0495677_0013866_1746_2147 | 132 |
| 617 | 3300047447 | Ga0495685_047320 | Ga0495685_047320_445_846 | 132 |
| 618 | 3300048903 | Ga0496100_0968005 | Ga0496100_0968005_86_484 | 132 |
| 619 | 3300048904 | Ga0496101_0256111 | Ga0496101_0256111_614_1012 | 132 |
| 620 | 3300048905 | Ga0496102_0143135 | Ga0496102_0143135_1052_1453 | 132 |
| 621 | 3300048905 | Ga0496102_0282770 | Ga0496102_0282770_469_870 | 132 |
| 622 | 3300048905 | Ga0496102_1636754 | Ga0496102_1636754_60_461 | 132 |
| 623 | 3300048906 | Ga0496103_0106258 | Ga0496103_0106258_146_547 | 132 |
| 624 | 3300048909 | Ga0496106_0707986 | Ga0496106_0707986_253_654 | 132 |
| 625 | 3300048910 | Ga0496107_0064258 | Ga0496107_0064258_694_1092 | 132 |
| 626 | 3300048910 | Ga0496107_0203367 | Ga0496107_0203367_534_935 | 132 |
| 627 | 3300048910 | Ga0496107_0230727 | Ga0496107_0230727_428_829 | 132 |
| 628 | 3300048910 | Ga0496107_0564972 | Ga0496107_0564972_59_460 | 132 |
| 629 | 3300048912 | Ga0496109_0862113 | Ga0496109_0862113_140_541 | 132 |
| 630 | 3300048914 | Ga0496111_0160221 | Ga0496111_0160221_357_758 | 132 |
| 631 | 3300048914 | Ga0496111_0188287 | Ga0496111_0188287_1066_1467 | 132 |
| 632 | 3300048914 | Ga0496111_0193908 | Ga0496111_0193908_609_1010 | 132 |
| 633 | 3300048915 | Ga0496112_0190186 | Ga0496112_0190186_1199_1597 | 132 |
| 634 | 3300048915 | Ga0496112_0327784 | Ga0496112_0327784_958_1359 | 132 |
| 635 | 3300048915 | Ga0496112_1067784 | Ga0496112_1067784_37_438 | 132 |
| 636 | 3300048915 | Ga0496112_1521216 | Ga0496112_1521216_78_503 | 132 |
| 637 | 3300048916 | Ga0496113_0315550 | Ga0496113_0315550_172_573 | 132 |
| 638 | 3300048917 | Ga0496114_0000016 | Ga0496114_0000016_264607_265008 | 132 |
| 639 | 3300048917 | Ga0496114_0068560 | Ga0496114_0068560_2393_2791 | 132 |
| 640 | 3300048918 | Ga0496115_0095950 | Ga0496115_0095950_1944_2342 | 132 |
| 641 | 3300049584 | Ga0501068_0050997 | Ga0501068_0050997_882_1283 | 132 |
| 642 | 3300049585 | Ga0501069_0091036 | Ga0501069_0091036_957_1358 | 132 |
| 643 | 3300049585 | Ga0501069_0663635 | Ga0501069_0663635_173_574 | 132 |
| 644 | 3300053083 | Ga0495655_0110520 | Ga0495655_0110520_156_557 | 132 |
| 645 | 3300061719 | Ga0466962_0248369 | Ga0466962_0248369_98_499 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1giu-assembly1.cif.gz_A | a trichosanthin(tcs) mutant(e85r) complex structure with adenine | 0.9225 | 57 | 87 |
| 2jjr-assembly1.cif.gz_A | v232k, n236d-trichosanthin | 0.9222 | 57 | 87 |
| 2oqa-assembly1.cif.gz_A | x-ray sequence and crystal structure of luffaculin 1, a novel type 1 ribosome-inactivating protein | 0.916 | 57 | 84 |
| 1bry-assembly2.cif.gz_Z | bryodin type i rip | 0.9035 | 55 | 84 |
| 1j4g-assembly1.cif.gz_A | crystal structure analysis of the trichosanthin delta c7 | 0.9002 | 57 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j1qA01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.9317 | 57 | 86 | 3.40.420.10 |
| 1ahbA01 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.9296 | 57 | 84 | 3.40.420.10 |
| af_A0A1D6EGE5_12_199_3.40.420.10 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.9106 | 56 | 85 | 3.40.420.10 |
| af_A0A1D6EN25_32_208_3.40.420.10 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.901 | 56 | 87 | 3.40.420.10 |
| af_A0A0P0X332_29_163_3.40.420.10 | Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 | 0.8723 | 57 | 85 | 3.40.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A653ZA60-F1-model_v4 | GFA family protein | 0.9693 | 2 | 100 |
GO:0016846
GO:0046872 |
| AF-A0A848Q840-F1-model_v4 | deleted | 0.969 | 1 | 85 |
|
| AF-Q7MF78-F1-model_v4 | Uncharacterized conserved protein | 0.9657 | 2 | 102 |
GO:0016846
GO:0046872 |
| AF-A0A227J8M4-F1-model_v4 | Aldehyde-activating protein | 0.9615 | 2 | 82 |
GO:0016846
GO:0046872 |
| AF-A0A526S5J8-F1-model_v4 | Aldehyde-activating protein | 0.9585 | 1 | 86 |
GO:0016846
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar