F472145

General Info

Members Datasets Scaffolds Average Seq Length
645 191 645 132

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_1299699|Ga0395901_1299699_174_602
Length 142
Sequence LGSLSQGVQALTTRTASCRCGQLAVTVSGDPVRVSVCHCLACQKRTGSIFSAQARWPAECVTIEGRSNSWTRTADSGQTTTYHFCPDCGSTVHYSGGNFPDVIAVPLGAFDDPYIASPDYSVWERRRHDWIEILGDDVQHSD

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.2
Rhizosphere 93.49
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1004450 3300001976 Bacteria 1838
2 Ga0070658_10158939 3300005327 Bacteria 1895
3 Ga0070658_10408021 3300005327 Bacteria 1167
4 Ga0070658_10505161 3300005327 Bacteria 1044
5 Ga0070658_10509695 3300005327 Bacteria 1040
6 Ga0070658_10593048 3300005327 Unclassified 960
7 Ga0070658_10980099 3300005327 Bacteria 735
8 Ga0070676_10038579 3300005328 Bacteria 2759
9 Ga0070676_10112069 3300005328 Bacteria 1700
10 Ga0070676_10139686 3300005328 Bacteria 1541
11 Ga0070676_10227229 3300005328 Bacteria 1235
12 Ga0070676_10704290 3300005328 Bacteria 738
13 Ga0070683_100758703 3300005329 Bacteria 929
14 Ga0070683_101835939 3300005329 Bacteria 583
15 Ga0070690_100053796 3300005330 Bacteria 2576
16 Ga0070690_100524191 3300005330 Bacteria 890
17 Ga0070690_101153317 3300005330 Unclassified 616
18 Ga0070670_100005424 3300005331 Bacteria 10761
19 Ga0070670_100008941 3300005331 Bacteria 8555
20 Ga0070670_100043864 3300005331 Bacteria 3845
21 Ga0070670_101379691 3300005331 Bacteria 646
22 Ga0070677_10053294 3300005333 Bacteria 1644
23 Ga0068869_100202591 3300005334 Bacteria 1565
24 Ga0070666_10051732 3300005335 Bacteria 2767
25 Ga0070666_10072580 3300005335 Bacteria 2343
26 Ga0070666_10101684 3300005335 Bacteria 1981
27 Ga0070666_10158072 3300005335 Bacteria 1583
28 Ga0070666_10637048 3300005335 Bacteria 779
29 Ga0070680_100247940 3300005336 Bacteria 1506
30 Ga0070682_100306371 3300005337 Bacteria 1168
31 Ga0068868_100000540 3300005338 Bacteria 25382
32 Ga0068868_100072054 3300005338 Bacteria 2756
33 Ga0068868_100092462 3300005338 Bacteria 2438
34 Ga0068868_100104094 3300005338 Bacteria 2300
35 Ga0068868_100160360 3300005338 Bacteria 1857
36 Ga0068868_101185848 3300005338 Bacteria 705
37 Ga0070660_100061065 3300005339 Bacteria 2926
38 Ga0070660_100171735 3300005339 Bacteria 1751
39 Ga0070660_100250894 3300005339 Bacteria 1443
40 Ga0070660_100337498 3300005339 Bacteria 1240
41 Ga0070691_10464412 3300005341 Bacteria 725
42 Ga0070661_100001787 3300005344 Bacteria 14912
43 Ga0070661_100132888 3300005344 Bacteria 1870
44 Ga0070661_100170200 3300005344 Bacteria 1654
45 Ga0070661_100225175 3300005344 Bacteria 1440
46 Ga0070661_100229785 3300005344 Bacteria 1425
47 Ga0070661_100482783 3300005344 Bacteria 990
48 Ga0070661_100567258 3300005344 Bacteria 915
49 Ga0070668_100065229 3300005347 Bacteria 2824
50 Ga0070668_100488648 3300005347 Bacteria 1064
51 Ga0070668_100699248 3300005347 Bacteria 894
52 Ga0070668_101556798 3300005347 Bacteria 605
53 Ga0070669_101349363 3300005353 Unclassified 618
54 Ga0070675_100128723 3300005354 Bacteria 2156
55 Ga0070675_100528418 3300005354 Bacteria 1065
56 Ga0070675_101247776 3300005354 Bacteria 684
57 Ga0070671_100004155 3300005355 Bacteria 11437
58 Ga0070671_100010022 3300005355 Bacteria 7610
59 Ga0070671_100013985 3300005355 Bacteria 6479
60 Ga0070671_100040667 3300005355 Bacteria 3862
61 Ga0070671_100120942 3300005355 Bacteria 2203
62 Ga0070671_100143244 3300005355 Bacteria 2017
63 Ga0070671_100209701 3300005355 Bacteria 1652
64 Ga0070671_100451106 3300005355 Bacteria 1103
65 Ga0070671_100910496 3300005355 Bacteria 768
66 Ga0070671_101148186 3300005355 Bacteria 683
67 Ga0070674_100128411 3300005356 Bacteria 1886
68 Ga0070674_100182251 3300005356 Bacteria 1609
69 Ga0070674_100372069 3300005356 Bacteria 1160
70 Ga0070674_100481754 3300005356 Bacteria 1030
71 Ga0070674_101146326 3300005356 Unclassified 688
72 Ga0070674_101385008 3300005356 Bacteria 629
73 Ga0070673_100018567 3300005364 Bacteria 4972
74 Ga0070673_100025353 3300005364 Bacteria 4363
75 Ga0070673_100028572 3300005364 Bacteria 4149
76 Ga0070673_100260650 3300005364 Bacteria 1514
77 Ga0070673_100370795 3300005364 Bacteria 1275
78 Ga0070673_100563574 3300005364 Bacteria 1036
79 Ga0070673_100961889 3300005364 Bacteria 794
80 Ga0070673_100974861 3300005364 Bacteria 788
81 Ga0070673_101273476 3300005364 Bacteria 690
82 Ga0070688_100583001 3300005365 Bacteria 854
83 Ga0070659_100046830 3300005366 Bacteria 3390
84 Ga0070659_100059277 3300005366 Bacteria 3022
85 Ga0070659_100155664 3300005366 Bacteria 1866
86 Ga0070659_100269345 3300005366 Bacteria 1415
87 Ga0070659_100370805 3300005366 Bacteria 1204
88 Ga0070659_100387064 3300005366 Bacteria 1179
89 Ga0070659_100394480 3300005366 Bacteria 1167
90 Ga0070659_100418808 3300005366 Bacteria 1133
91 Ga0070659_101146618 3300005366 Bacteria 686
92 Ga0070659_101328501 3300005366 Unclassified 638
93 Ga0070659_101416061 3300005366 Bacteria 618
94 Ga0070667_100001880 3300005367 Bacteria 18647
95 Ga0070667_100020050 3300005367 Bacteria 5551
96 Ga0070667_100141414 3300005367 Bacteria 2108
97 Ga0070667_100234708 3300005367 Bacteria 1636
98 Ga0070667_100868521 3300005367 Bacteria 839
99 Ga0070709_10003770 3300005434 Bacteria 8148
100 Ga0070714_100048977 3300005435 Bacteria 3596
101 Ga0070714_100062778 3300005435 Bacteria 3193
102 Ga0070714_100152133 3300005435 Bacteria 2086
103 Ga0070714_100196179 3300005435 Bacteria 1845
104 Ga0070713_100047052 3300005436 Bacteria 3543
105 Ga0070713_100385239 3300005436 Bacteria 1307
106 Ga0070713_100569164 3300005436 Bacteria 1074
107 Ga0070663_100044752 3300005455 Bacteria 3123
108 Ga0070663_100184951 3300005455 Bacteria 1619
109 Ga0070663_100653755 3300005455 Bacteria 889
110 Ga0070663_101049410 3300005455 Bacteria 710
111 Ga0070678_100010304 3300005456 Bacteria 5702
112 Ga0070678_100036424 3300005456 Bacteria 3444
113 Ga0070678_100040711 3300005456 Bacteria 3289
114 Ga0070678_100213112 3300005456 Bacteria 1601
115 Ga0070678_100570838 3300005456 Bacteria 1006
116 Ga0070662_100019488 3300005457 Bacteria 4605
117 Ga0070662_100069793 3300005457 Bacteria 2588
118 Ga0070662_100145706 3300005457 Bacteria 1839
119 Ga0070662_100204462 3300005457 Bacteria 1568
120 Ga0070662_100266010 3300005457 Bacteria 1383
121 Ga0070662_101115523 3300005457 Bacteria 677
122 Ga0070662_101502810 3300005457 Bacteria 581
123 Ga0070681_10010289 3300005458 Bacteria 9233
124 Ga0070681_10177119 3300005458 Bacteria 2054
125 Ga0068867_100188650 3300005459 Bacteria 1644
126 Ga0068867_100203682 3300005459 Bacteria 1585
127 Ga0068867_100948852 3300005459 Unclassified 777
128 Ga0068867_102102630 3300005459 Bacteria 535
129 Ga0070685_10082358 3300005466 Bacteria 1931
130 Ga0070679_101268783 3300005530 Bacteria 682
131 Ga0068853_100064967 3300005539 Bacteria 3166
132 Ga0068853_100397631 3300005539 Bacteria 1289
133 Ga0068853_100645894 3300005539 Bacteria 1007
134 Ga0068853_100737957 3300005539 Bacteria 941
135 Ga0068853_101051084 3300005539 Bacteria 785
136 Ga0068853_101534087 3300005539 Unclassified 645
137 Ga0070672_100007583 3300005543 Bacteria 7375
138 Ga0070672_100173189 3300005543 Bacteria 1796
139 Ga0070672_100240337 3300005543 Bacteria 1523
140 Ga0070672_100591832 3300005543 Bacteria 965
141 Ga0070672_100602163 3300005543 Bacteria 957
142 Ga0070672_100796245 3300005543 Bacteria 831
143 Ga0070672_100831396 3300005543 Bacteria 814
144 Ga0070686_100022420 3300005544 Bacteria 3761
145 Ga0070686_100197270 3300005544 Bacteria 1440
146 Ga0070686_100450563 3300005544 Bacteria 989
147 Ga0070696_100377654 3300005546 Bacteria 1104
148 Ga0070693_100018738 3300005547 Bacteria 3620
149 Ga0070693_100744407 3300005547 Bacteria 722
150 Ga0070665_100378184 3300005548 Bacteria 1423
151 Ga0070665_100683022 3300005548 Bacteria 1040
152 Ga0070665_100839882 3300005548 Unclassified 932
153 Ga0068855_100534714 3300005563 Bacteria 1270
154 Ga0068855_100788904 3300005563 Unclassified 1010
155 Ga0068855_100941403 3300005563 Bacteria 910
156 Ga0068855_102089893 3300005563 Bacteria 570
157 Ga0070664_100007255 3300005564 Bacteria 8935
158 Ga0070664_100015505 3300005564 Bacteria 6235
159 Ga0070664_100284958 3300005564 Bacteria 1490
160 Ga0070664_100425667 3300005564 Bacteria 1216
161 Ga0070664_100650032 3300005564 Bacteria 980
162 Ga0070664_100801285 3300005564 Bacteria 881
163 Ga0070664_100891242 3300005564 Bacteria 834
164 Ga0070664_100919151 3300005564 Bacteria 821
165 Ga0070664_101685349 3300005564 Bacteria 601
166 Ga0068857_100063269 3300005577 Bacteria 3289
167 Ga0068854_100013020 3300005578 Bacteria 5451
168 Ga0068854_100202678 3300005578 Bacteria 1560
169 Ga0068854_100396082 3300005578 Bacteria 1141
170 Ga0068854_100653950 3300005578 Bacteria 903
171 Ga0068854_100796394 3300005578 Bacteria 823
172 Ga0068854_101078855 3300005578 Bacteria 714
173 Ga0068856_100282835 3300005614 Bacteria 1675
174 Ga0068856_100536898 3300005614 Bacteria 1191
175 Ga0068856_102551716 3300005614 Unclassified 517
176 Ga0068852_100013389 3300005616 Bacteria 6278
177 Ga0068852_100056428 3300005616 Bacteria 3394
178 Ga0068852_100084393 3300005616 Bacteria 2827
179 Ga0068852_100137216 3300005616 Bacteria 2259
180 Ga0068852_100751407 3300005616 Bacteria 987
181 Ga0068852_101091303 3300005616 Bacteria 818
182 Ga0068859_100114674 3300005617 Bacteria 2759
183 Ga0068859_100140847 3300005617 Bacteria 2485
184 Ga0068859_100224941 3300005617 Bacteria 1964
185 Ga0068859_101566274 3300005617 Unclassified 728
186 Ga0068864_100071466 3300005618 Bacteria 3022
187 Ga0068864_100491847 3300005618 Bacteria 1179
188 Ga0068864_100860862 3300005618 Bacteria 893
189 Ga0068864_101611672 3300005618 Bacteria 653
190 Ga0068866_10740771 3300005718 Bacteria 678
191 Ga0068851_10193500 3300005834 Bacteria 1132
192 Ga0068851_10559476 3300005834 Bacteria 692
193 Ga0068851_10688108 3300005834 Bacteria 629
194 Ga0068863_100061135 3300005841 Bacteria 3561
195 Ga0068863_100448267 3300005841 Bacteria 1266
196 Ga0068863_100828140 3300005841 Bacteria 924
197 Ga0068858_100014273 3300005842 Bacteria 7490
198 Ga0068858_100014925 3300005842 Bacteria 7309
199 Ga0068858_100079403 3300005842 Bacteria 3049
200 Ga0068858_100440726 3300005842 Bacteria 1254
201 Ga0068858_101292395 3300005842 Bacteria 718
202 Ga0068858_101959175 3300005842 Bacteria 579
203 Ga0068858_102393672 3300005842 Bacteria 522
204 Ga0068860_100110137 3300005843 Bacteria 2632
205 Ga0068862_100007719 3300005844 Bacteria 8898
206 Ga0068862_101381899 3300005844 Bacteria 707
207 Ga0070717_10005953 3300006028 Bacteria 8929
208 Ga0070717_10300641 3300006028 Bacteria 1427
209 Ga0070717_10482695 3300006028 Bacteria 1119
210 Ga0070716_100060089 3300006173 Bacteria 2194
211 Ga0070712_100035780 3300006175 Bacteria 3373
212 Ga0097621_100507081 3300006237 Bacteria 1093
213 Ga0097621_100607773 3300006237 Bacteria 1000
214 Ga0097621_102266349 3300006237 Unclassified 520
215 Ga0068871_100028454 3300006358 Bacteria 4381
216 Ga0068871_100128772 3300006358 Bacteria 2144
217 Ga0068871_100388942 3300006358 Bacteria 1240
218 Ga0097620_100114673 3300006931 Bacteria 2759
219 Ga0097620_100140845 3300006931 Bacteria 2485
220 Ga0097620_100224935 3300006931 Bacteria 1964
221 Ga0097620_101566326 3300006931 Unclassified 728
222 Ga0105245_10105004 3300009098 Bacteria 2620
223 Ga0105245_10469794 3300009098 Bacteria 1269
224 Ga0105247_11194476 3300009101 Bacteria 605
225 Ga0105241_11096558 3300009174 Bacteria 749
226 Ga0105241_11247336 3300009174 Bacteria 706
227 Ga0105248_10002275 3300009177 Bacteria 21260
228 Ga0105248_10054556 3300009177 Bacteria 4482
229 Ga0105248_10178932 3300009177 Bacteria 2390
230 Ga0105248_10434885 3300009177 Bacteria 1478
231 Ga0105248_10438163 3300009177 Bacteria 1472
232 Ga0105248_10481895 3300009177 Bacteria 1398
233 Ga0105248_11171501 3300009177 Bacteria 869
234 Ga0105237_12342428 3300009545 Unclassified 544
235 Ga0105238_10249509 3300009551 Bacteria 1753
236 Ga0105249_10171397 3300009553 Bacteria 2105
237 Ga0105246_10985726 3300011119 Unclassified 762
238 Ga0105246_11049524 3300011119 Bacteria 741
239 Ga0157373_10007653 3300013100 Bacteria 8027
240 Ga0157373_10144492 3300013100 Bacteria 1673
241 Ga0157373_10165418 3300013100 Unclassified 1557
242 Ga0157373_10192740 3300013100 Bacteria 1436
243 Ga0157373_10916228 3300013100 Bacteria 651
244 Ga0157371_10367166 3300013102 Bacteria 1049
245 Ga0157371_10506977 3300013102 Bacteria 891
246 Ga0157371_11178765 3300013102 Bacteria 590
247 Ga0157371_11593654 3300013102 Bacteria 511
248 Ga0157370_10267251 3300013104 Bacteria 1580
249 Ga0157370_10444054 3300013104 Bacteria 1193
250 Ga0157369_10233366 3300013105 Bacteria 1923
251 Ga0157374_10006812 3300013296 Bacteria 9720
252 Ga0157374_10060461 3300013296 Bacteria 3545
253 Ga0157374_10622018 3300013296 Bacteria 1090
254 Ga0157374_11922130 3300013296 Bacteria 618
255 Ga0157378_10142862 3300013297 Bacteria 2224
256 Ga0157378_10763158 3300013297 Bacteria 991
257 Ga0163162_10060277 3300013306 Bacteria 3830
258 Ga0163162_10297777 3300013306 Bacteria 1745
259 Ga0163162_11291182 3300013306 Bacteria 829
260 Ga0157372_10897301 3300013307 Bacteria 1028
261 Ga0157372_12451678 3300013307 Bacteria 599
262 Ga0157372_13166674 3300013307 Bacteria 525
263 Ga0157375_10002069 3300013308 Bacteria 17350
264 Ga0157375_10970534 3300013308 Bacteria 991
265 Ga0157375_11191729 3300013308 Bacteria 893
266 Ga0157375_13747907 3300013308 Bacteria 505
267 Ga0157375_13747909 3300013308 Unclassified 505
268 Ga0163163_10132101 3300014325 Bacteria 2537
269 Ga0182008_10218369 3300014497 Bacteria 975
270 Ga0157379_10185574 3300014968 Bacteria 1879
271 Ga0157379_10330052 3300014968 Bacteria 1394
272 Ga0157379_10957066 3300014968 Bacteria 814
273 Ga0163161_10754500 3300017792 Unclassified 814
274 Ga0207697_10226495 3300025315 Bacteria 825
275 Ga0207697_10331490 3300025315 Unclassified 676
276 Ga0207656_10439753 3300025321 Bacteria 658
277 Ga0207682_10103223 3300025893 Bacteria 1248
278 Ga0207682_10376467 3300025893 Bacteria 670
279 Ga0207710_10324980 3300025900 Bacteria 780
280 Ga0207688_10181146 3300025901 Bacteria 1256
281 Ga0207688_10221714 3300025901 Bacteria 1139
282 Ga0207688_10331347 3300025901 Bacteria 935
283 Ga0207680_10001045 3300025903 Bacteria 13070
284 Ga0207680_10074839 3300025903 Bacteria 2110
285 Ga0207680_10098215 3300025903 Bacteria 1876
286 Ga0207680_10166118 3300025903 Bacteria 1483
287 Ga0207680_10280832 3300025903 Bacteria 1157
288 Ga0207680_10289930 3300025903 Bacteria 1139
289 Ga0207680_10375760 3300025903 Bacteria 1001
290 Ga0207647_10151397 3300025904 Bacteria 1356
291 Ga0207699_10084968 3300025906 Bacteria 1972
292 Ga0207645_10071914 3300025907 Bacteria 2214
293 Ga0207645_10102506 3300025907 Bacteria 1847
294 Ga0207645_10325531 3300025907 Bacteria 1026
295 Ga0207645_10644589 3300025907 Bacteria 720
296 Ga0207645_10874531 3300025907 Unclassified 611
297 Ga0207705_10038128 3300025909 Bacteria 3440
298 Ga0207705_10110496 3300025909 Bacteria 2031
299 Ga0207705_10133292 3300025909 Bacteria 1850
300 Ga0207705_10197698 3300025909 Bacteria 1523
301 Ga0207705_10651975 3300025909 Bacteria 819
302 Ga0207705_10902217 3300025909 Bacteria 685
303 Ga0207705_11209844 3300025909 Bacteria 579
304 Ga0207654_11387068 3300025911 Bacteria 512
305 Ga0207707_10716013 3300025912 Bacteria 839
306 Ga0207695_11348552 3300025913 Bacteria 594
307 Ga0207693_10006527 3300025915 Bacteria 9654
308 Ga0207657_10015919 3300025919 Bacteria 7265
309 Ga0207657_10030402 3300025919 Bacteria 4902
310 Ga0207657_10077058 3300025919 Bacteria 2811
311 Ga0207657_10208809 3300025919 Bacteria 1568
312 Ga0207657_10287448 3300025919 Bacteria 1304
313 Ga0207657_10355658 3300025919 Bacteria 1155
314 Ga0207657_10542512 3300025919 Bacteria 909
315 Ga0207657_10645177 3300025919 Bacteria 824
316 Ga0207657_11179770 3300025919 Bacteria 583
317 Ga0207649_10033848 3300025920 Bacteria 3057
318 Ga0207649_10043747 3300025920 Bacteria 2740
319 Ga0207649_10062674 3300025920 Bacteria 2345
320 Ga0207649_10248986 3300025920 Bacteria 1279
321 Ga0207649_10265702 3300025920 Unclassified 1241
322 Ga0207649_10364158 3300025920 Bacteria 1074
323 Ga0207649_10396457 3300025920 Unclassified 1032
324 Ga0207652_10336882 3300025921 Bacteria 1362
325 Ga0207652_10631382 3300025921 Bacteria 959
326 Ga0207681_10200143 3300025923 Bacteria 1533
327 Ga0207694_10192731 3300025924 Bacteria 1656
328 Ga0207694_10272791 3300025924 Bacteria 1388
329 Ga0207650_10128250 3300025925 Bacteria 1982
330 Ga0207650_10135623 3300025925 Bacteria 1930
331 Ga0207650_10225311 3300025925 Bacteria 1510
332 Ga0207650_10657602 3300025925 Bacteria 884
333 Ga0207650_11018551 3300025925 Bacteria 704
334 Ga0207659_10394184 3300025926 Bacteria 1157
335 Ga0207659_10650981 3300025926 Bacteria 900
336 Ga0207687_10874780 3300025927 Bacteria 768
337 Ga0207700_10135095 3300025928 Bacteria 2019
338 Ga0207700_10352237 3300025928 Bacteria 1282
339 Ga0207700_10772137 3300025928 Bacteria 859
340 Ga0207700_10985797 3300025928 Bacteria 754
341 Ga0207700_11785957 3300025928 Bacteria 541
342 Ga0207664_10043273 3300025929 Bacteria 3520
343 Ga0207664_10281559 3300025929 Bacteria 1459
344 Ga0207664_10730771 3300025929 Bacteria 890
345 Ga0207644_10000773 3300025931 Bacteria 20259
346 Ga0207644_10000847 3300025931 Bacteria 19396
347 Ga0207644_10011794 3300025931 Bacteria 5788
348 Ga0207644_10023868 3300025931 Bacteria 4194
349 Ga0207644_10034654 3300025931 Bacteria 3533
350 Ga0207644_10069347 3300025931 Bacteria 2574
351 Ga0207644_10238171 3300025931 Bacteria 1448
352 Ga0207644_10682077 3300025931 Bacteria 856
353 Ga0207644_11037995 3300025931 Bacteria 688
354 Ga0207644_11188349 3300025931 Unclassified 641
355 Ga0207690_10228167 3300025932 Bacteria 1428
356 Ga0207690_10277051 3300025932 Bacteria 1305
357 Ga0207690_10298268 3300025932 Bacteria 1260
358 Ga0207690_10367097 3300025932 Bacteria 1141
359 Ga0207690_10376653 3300025932 Bacteria 1127
360 Ga0207690_10471279 3300025932 Bacteria 1012
361 Ga0207690_11115537 3300025932 Bacteria 658
362 Ga0207690_11239821 3300025932 Unclassified 623
363 Ga0207706_10000253 3300025933 Bacteria 58135
364 Ga0207706_10003262 3300025933 Bacteria 15536
365 Ga0207706_10004173 3300025933 Bacteria 13606
366 Ga0207706_10005402 3300025933 Bacteria 11912
367 Ga0207706_10055811 3300025933 Bacteria 3483
368 Ga0207706_10060026 3300025933 Bacteria 3349
369 Ga0207706_10282862 3300025933 Bacteria 1446
370 Ga0207706_10354629 3300025933 Bacteria 1275
371 Ga0207706_10679275 3300025933 Bacteria 881
372 Ga0207706_10777166 3300025933 Bacteria 815
373 Ga0207706_10936011 3300025933 Bacteria 731
374 Ga0207669_10035217 3300025937 Bacteria 2846
375 Ga0207669_10070448 3300025937 Bacteria 2192
376 Ga0207669_10396507 3300025937 Bacteria 1080
377 Ga0207669_10528940 3300025937 Bacteria 948
378 Ga0207669_11244531 3300025937 Bacteria 631
379 Ga0207669_11478669 3300025937 Bacteria 579
380 Ga0207665_10150585 3300025939 Bacteria 1666
381 Ga0207691_10004350 3300025940 Bacteria 13742
382 Ga0207691_10027663 3300025940 Bacteria 5316
383 Ga0207691_10096941 3300025940 Bacteria 2636
384 Ga0207691_10137747 3300025940 Bacteria 2152
385 Ga0207691_10221124 3300025940 Bacteria 1642
386 Ga0207691_10228433 3300025940 Bacteria 1612
387 Ga0207691_10369005 3300025940 Bacteria 1226
388 Ga0207711_10000309 3300025941 Bacteria 52342
389 Ga0207711_10002790 3300025941 Bacteria 15368
390 Ga0207711_10024125 3300025941 Bacteria 5090
391 Ga0207711_10113799 3300025941 Bacteria 2409
392 Ga0207711_10145943 3300025941 Bacteria 2132
393 Ga0207711_10473852 3300025941 Bacteria 1166
394 Ga0207689_10156323 3300025942 Bacteria 1880
395 Ga0207679_10038485 3300025945 Bacteria 3407
396 Ga0207679_10059628 3300025945 Bacteria 2832
397 Ga0207679_10178336 3300025945 Bacteria 1755
398 Ga0207679_10230107 3300025945 Bacteria 1564
399 Ga0207679_10519864 3300025945 Bacteria 1064
400 Ga0207679_11036325 3300025945 Bacteria 752
401 Ga0207679_11201249 3300025945 Bacteria 696
402 Ga0207679_11222780 3300025945 Bacteria 689
403 Ga0207679_11261496 3300025945 Bacteria 678
404 Ga0207679_11414551 3300025945 Bacteria 638
405 Ga0207667_10097958 3300025949 Bacteria 3026
406 Ga0207667_10317951 3300025949 Bacteria 1590
407 Ga0207667_10421941 3300025949 Bacteria 1357
408 Ga0207667_11157918 3300025949 Unclassified 754
409 Ga0207651_10014293 3300025960 Bacteria 4577
410 Ga0207651_10024871 3300025960 Bacteria 3712
411 Ga0207651_10047390 3300025960 Bacteria 2897
412 Ga0207651_10056300 3300025960 Bacteria 2705
413 Ga0207651_10112290 3300025960 Bacteria 2048
414 Ga0207651_10296759 3300025960 Bacteria 1342
415 Ga0207651_10958373 3300025960 Bacteria 763
416 Ga0207712_10139451 3300025961 Bacteria 1859
417 Ga0207668_10135900 3300025972 Bacteria 1884
418 Ga0207668_10505476 3300025972 Bacteria 1040
419 Ga0207640_10016718 3300025981 Bacteria 4275
420 Ga0207640_10133642 3300025981 Unclassified 1797
421 Ga0207640_10252858 3300025981 Bacteria 1369
422 Ga0207640_10255497 3300025981 Bacteria 1362
423 Ga0207640_10282198 3300025981 Bacteria 1305
424 Ga0207640_10791873 3300025981 Bacteria 820
425 Ga0207658_10080839 3300025986 Bacteria 2490
426 Ga0207658_10130613 3300025986 Bacteria 2017
427 Ga0207658_10167084 3300025986 Bacteria 1808
428 Ga0207658_10204778 3300025986 Bacteria 1650
429 Ga0207658_10996567 3300025986 Bacteria 764
430 Ga0207658_11240859 3300025986 Bacteria 681
431 Ga0207677_10019204 3300026023 Bacteria 4122
432 Ga0207677_10248012 3300026023 Bacteria 1444
433 Ga0207703_10001905 3300026035 Bacteria 18500
434 Ga0207703_10031527 3300026035 Bacteria 4192
435 Ga0207703_10047014 3300026035 Bacteria 3478
436 Ga0207703_10079230 3300026035 Bacteria 2732
437 Ga0207639_10049224 3300026041 Bacteria 3194
438 Ga0207639_10326827 3300026041 Bacteria 1363
439 Ga0207639_10659652 3300026041 Bacteria 968
440 Ga0207639_10705611 3300026041 Bacteria 936
441 Ga0207639_11056184 3300026041 Bacteria 761
442 Ga0207639_11489900 3300026041 Bacteria 635
443 Ga0207678_10016793 3300026067 Bacteria 6429
444 Ga0207678_10081603 3300026067 Bacteria 2768
445 Ga0207678_10114121 3300026067 Bacteria 2305
446 Ga0207678_10172330 3300026067 Bacteria 1848
447 Ga0207678_10222422 3300026067 Bacteria 1616
448 Ga0207678_10276911 3300026067 Bacteria 1439
449 Ga0207678_10699177 3300026067 Bacteria 892
450 Ga0207678_11378426 3300026067 Bacteria 623
451 Ga0207702_10444675 3300026078 Bacteria 1257
452 Ga0207641_10120626 3300026088 Bacteria 2339
453 Ga0207641_10319703 3300026088 Bacteria 1471
454 Ga0207641_10711446 3300026088 Bacteria 990
455 Ga0207648_10017417 3300026089 Bacteria 6539
456 Ga0207648_10049684 3300026089 Bacteria 3669
457 Ga0207648_10622079 3300026089 Bacteria 996
458 Ga0207676_10016579 3300026095 Bacteria 5335
459 Ga0207676_10027536 3300026095 Bacteria 4234
460 Ga0207676_10270319 3300026095 Bacteria 1539
461 Ga0207676_11552566 3300026095 Bacteria 659
462 Ga0207676_12076361 3300026095 Bacteria 567
463 Ga0207674_10083533 3300026116 Bacteria 3193
464 Ga0207674_10135320 3300026116 Bacteria 2426
465 Ga0207683_10001185 3300026121 Bacteria 23609
466 Ga0207683_10002289 3300026121 Bacteria 16796
467 Ga0207683_10031898 3300026121 Bacteria 4575
468 Ga0207683_10095107 3300026121 Bacteria 2656
469 Ga0207683_10173531 3300026121 Bacteria 1953
470 Ga0207683_10207231 3300026121 Bacteria 1783
471 Ga0207698_10025991 3300026142 Bacteria 4135
472 Ga0207698_10060036 3300026142 Bacteria 2955
473 Ga0207698_10177393 3300026142 Bacteria 1883
474 Ga0207698_10180433 3300026142 Bacteria 1870
475 Ga0207698_10317904 3300026142 Bacteria 1457
476 Ga0207698_10319124 3300026142 Bacteria 1454
477 Ga0207698_11112101 3300026142 Unclassified 803
478 Ga0268266_10032604 3300028379 Bacteria 4426
479 Ga0268266_10096853 3300028379 Bacteria 2594
480 Ga0268266_11443414 3300028379 Bacteria 664
481 Ga0268265_10001273 3300028380 Bacteria 21747
482 Ga0268265_10440599 3300028380 Bacteria 1214
483 Ga0268264_10060221 3300028381 Bacteria 3181
484 Ga0268264_10531798 3300028381 Unclassified 1151
485 Ga0268264_10965940 3300028381 Bacteria 857
486 Ga0307413_10278240 3300031824 Bacteria 1257
487 Ga0307406_11696465 3300031901 Bacteria 560
488 Ga0307414_10747327 3300032004 Bacteria 889
489 Ga0307414_11245357 3300032004 Bacteria 689
490 Ga0307411_10787297 3300032005 Bacteria 836
491 Ga0307415_100705931 3300032126 Bacteria 911
492 Ga0373938_0206042 3300034957 Unclassified 547
493 Ga0373931_0062393 3300035691 Bacteria 2012
494 Ga0373935_0015144 3300035692 Bacteria 4659
495 Ga0395899_0023813 3300037312 Bacteria 4633
496 Ga0395899_0031040 3300037312 Bacteria 4017
497 Ga0395899_0045871 3300037312 Bacteria 3256
498 Ga0395899_0079694 3300037312 Bacteria 2385
499 Ga0395899_0115826 3300037312 Bacteria 1923
500 Ga0395899_0952512 3300037312 Bacteria 520
501 Ga0395900_0001256 3300037418 Bacteria 31067
502 Ga0395900_0029387 3300037418 Bacteria 5638
503 Ga0395900_0033179 3300037418 Bacteria 5313
504 Ga0395900_0061036 3300037418 Bacteria 3877
505 Ga0395900_0107691 3300037418 Bacteria 2863
506 Ga0395900_0251170 3300037418 Bacteria 1770
507 Ga0395900_0329722 3300037418 Bacteria 1504
508 Ga0395900_0643361 3300037418 Bacteria 997
509 Ga0395900_0653959 3300037418 Bacteria 987
510 Ga0395900_0688342 3300037418 Bacteria 957
511 Ga0395900_0965935 3300037418 Bacteria 773
512 Ga0395900_1228379 3300037418 Unclassified 664
513 Ga0395900_1576971 3300037418 Bacteria 568
514 Ga0395900_1729246 3300037418 Bacteria 536
515 Ga0395898_0062486 3300037466 Bacteria 3616
516 Ga0395898_0086667 3300037466 Bacteria 3017
517 Ga0395898_0086709 3300037466 Bacteria 3016
518 Ga0395898_0178805 3300037466 Bacteria 2027
519 Ga0395898_0245417 3300037466 Bacteria 1708
520 Ga0395898_0647658 3300037466 Bacteria 999
521 Ga0395898_1905888 3300037466 Bacteria 514
522 Ga0395905_0000610 3300037471 Bacteria 47892
523 Ga0395905_0002249 3300037471 Bacteria 21706
524 Ga0395905_0045122 3300037471 Bacteria 4134
525 Ga0395905_0046707 3300037471 Bacteria 4060
526 Ga0395905_0057011 3300037471 Bacteria 3653
527 Ga0395905_0080959 3300037471 Bacteria 3043
528 Ga0395905_0126559 3300037471 Bacteria 2402
529 Ga0395905_0163659 3300037471 Bacteria 2090
530 Ga0395905_0452711 3300037471 Unclassified 1181
531 Ga0395905_1043269 3300037471 Bacteria 721
532 Ga0395905_1064443 3300037471 Bacteria 712
533 Ga0395905_1212166 3300037471 Bacteria 658
534 Ga0395905_1226898 3300037471 Bacteria 653
535 Ga0395905_1437356 3300037471 Bacteria 594
536 Ga0395905_1601567 3300037471 Bacteria 556
537 Ga0395901_0054927 3300038443 Bacteria 4140
538 Ga0395901_0128016 3300038443 Bacteria 2669
539 Ga0395901_0181515 3300038443 Bacteria 2207
540 Ga0395901_0213374 3300038443 Bacteria 2019
541 Ga0395901_0339569 3300038443 Bacteria 1552
542 Ga0395901_0445157 3300038443 Bacteria 1325
543 Ga0395901_0922573 3300038443 Bacteria 854
544 Ga0395901_1299699 3300038443 Unclassified 689
545 Ga0395901_1437070 3300038443 Bacteria 647
546 Ga0436365_0269996 3300039437 Bacteria 5409
547 Ga0436365_0782999 3300039437 Bacteria 1137
548 Ga0466972_0129046 3300044658 Bacteria 1191
549 Ga0466972_0376665 3300044658 Bacteria 664
550 Ga0466965_0147870 3300044683 Bacteria 1227
551 Ga0466966_0268627 3300044684 Unclassified 1026
552 Ga0466966_0317002 3300044684 Bacteria 937
553 Ga0466961_0188940 3300044693 Bacteria 1277
554 Ga0466961_0265098 3300044693 Bacteria 1053
555 Ga0466961_0268318 3300044693 Bacteria 1046
556 Ga0466963_0313274 3300044694 Bacteria 1104
557 Ga0466963_0479496 3300044694 Bacteria 878
558 Ga0466963_1028968 3300044694 Unclassified 580
559 Ga0466963_1244373 3300044694 Unclassified 523
560 Ga0466971_0105234 3300044719 Bacteria 1299
561 Ga0466971_0183579 3300044719 Bacteria 984
562 Ga0466970_0605626 3300044765 Bacteria 636
563 Ga0466957_0127727 3300044842 Bacteria 1626
564 Ga0466957_0177706 3300044842 Bacteria 1389
565 Ga0466957_0366253 3300044842 Bacteria 980
566 Ga0466960_0021572 3300044901 Bacteria 2870
567 Ga0466960_0079229 3300044901 Bacteria 1651
568 Ga0466960_0252111 3300044901 Bacteria 981
569 Ga0466959_0317838 3300045049 Bacteria 1065
570 Ga0466958_0140952 3300045836 Bacteria 1518
571 Ga0466958_0648102 3300045836 Bacteria 687
572 Ga0466967_0030324 3300045976 Bacteria 4537
573 Ga0466967_0082454 3300045976 Bacteria 2906
574 Ga0466967_0293601 3300045976 Bacteria 1562
575 Ga0466967_0371592 3300045976 Bacteria 1387
576 Ga0466967_0402856 3300045976 Bacteria 1331
577 Ga0466967_0607222 3300045976 Bacteria 1080
578 Ga0466967_0712629 3300045976 Bacteria 994
579 Ga0466967_1021962 3300045976 Unclassified 823
580 Ga0466967_1869347 3300045976 Bacteria 597
581 Ga0495629_0370635 3300046459 Bacteria 975
582 Ga0495580_0320871 3300046472 Bacteria 1053
583 Ga0495584_0448815 3300046491 Bacteria 656
584 Ga0495606_0269934 3300046507 Bacteria 935
585 Ga0495610_0171907 3300046512 Bacteria 908
586 Ga0495620_0117537 3300046515 Bacteria 1050
587 Ga0495598_0000202 3300046537 Bacteria 10497
588 Ga0495621_0000141 3300046539 Bacteria 15332
589 Ga0495621_0056609 3300046539 Bacteria 1414
590 Ga0495668_0008461 3300046616 Bacteria 6420
591 Ga0495668_0049292 3300046616 Bacteria 2335
592 Ga0495625_0635732 3300046660 Bacteria 637
593 Ga0495588_0757495 3300046674 Bacteria 508
594 Ga0495669_0000276 3300046684 Bacteria 29327
595 Ga0495669_0001818 3300046684 Bacteria 8721
596 Ga0495669_0065845 3300046684 Bacteria 1645
597 Ga0495669_0421777 3300046684 Bacteria 647
598 Ga0495670_0001165 3300046691 Bacteria 12770
599 Ga0495677_0013866 3300047445 Bacteria 2935
600 Ga0495685_047320 3300047447 Bacteria 1463
601 Ga0496100_0011341 3300048903 Bacteria 5072
602 Ga0496100_0140604 3300048903 Bacteria 1711
603 Ga0496100_0968005 3300048903 Bacteria 669
604 Ga0496101_0032035 3300048904 Bacteria 3698
605 Ga0496101_0216175 3300048904 Bacteria 1486
606 Ga0496101_0256111 3300048904 Bacteria 1364
607 Ga0496101_0451972 3300048904 Bacteria 1014
608 Ga0496102_0143135 3300048905 Bacteria 2243
609 Ga0496102_0282770 3300048905 Bacteria 1564
610 Ga0496102_1636754 3300048905 Bacteria 562
611 Ga0496103_0106258 3300048906 Bacteria 1780
612 Ga0496106_0033208 3300048909 Bacteria 3850
613 Ga0496106_0510768 3300048909 Bacteria 965
614 Ga0496106_0707986 3300048909 Bacteria 802
615 Ga0496107_0064258 3300048910 Bacteria 2661
616 Ga0496107_0203367 3300048910 Bacteria 1472
617 Ga0496107_0230727 3300048910 Bacteria 1377
618 Ga0496107_0391093 3300048910 Bacteria 1034
619 Ga0496107_0564972 3300048910 Bacteria 842
620 Ga0496107_0714613 3300048910 Unclassified 736
621 Ga0496107_0814818 3300048910 Bacteria 683
622 Ga0496109_0181195 3300048912 Bacteria 1978
623 Ga0496109_0862113 3300048912 Bacteria 843
624 Ga0496111_0030983 3300048914 Bacteria 3806
625 Ga0496111_0160221 3300048914 Bacteria 1670
626 Ga0496111_0188287 3300048914 Bacteria 1534
627 Ga0496111_0193908 3300048914 Bacteria 1510
628 Ga0496112_0021051 3300048915 Bacteria 6194
629 Ga0496112_0190186 3300048915 Unclassified 2015
630 Ga0496112_0327784 3300048915 Bacteria 1475
631 Ga0496112_1067784 3300048915 Bacteria 726
632 Ga0496112_1521216 3300048915 Bacteria 583
633 Ga0496113_0190825 3300048916 Unclassified 1626
634 Ga0496113_0315550 3300048916 Bacteria 1253
635 Ga0496114_0000016 3300048917 Bacteria 274656
636 Ga0496114_0068560 3300048917 Bacteria 2978
637 Ga0496114_0116789 3300048917 Bacteria 2291
638 Ga0496115_0095950 3300048918 Bacteria 2427
639 Ga0496115_0293425 3300048918 Bacteria 1333
640 Ga0496115_1410236 3300048918 Bacteria 514
641 Ga0501068_0050997 3300049584 Bacteria 2503
642 Ga0501069_0091036 3300049585 Bacteria 1725
643 Ga0501069_0663635 3300049585 Bacteria 628
644 Ga0495655_0110520 3300053083 Bacteria 825
645 Ga0466962_0248369 3300061719 Bacteria 874

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_1064443 Ga0395905_1064443_49_399 116
2 3300038443 Ga0395901_0922573 Ga0395901_0922573_31_381 116
3 3300046674 Ga0495588_0757495 Ga0495588_0757495_24_374 116
4 3300048903 Ga0496100_0011341 Ga0496100_0011341_1148_1498 116
5 3300048904 Ga0496101_0032035 Ga0496101_0032035_2189_2539 116
6 3300048909 Ga0496106_0033208 Ga0496106_0033208_104_454 116
7 3300048910 Ga0496107_0714613 Ga0496107_0714613_256_606 116
8 3300048917 Ga0496114_0116789 Ga0496114_0116789_829_1179 116
9 3300048918 Ga0496115_0293425 Ga0496115_0293425_736_1086 116
10 3300005327 Ga0070658_10593048 Ga0070658_105930481 117
11 3300005354 Ga0070675_100528418 Ga0070675_1005284182 117
12 3300005355 Ga0070671_100004155 Ga0070671_1000041556 117
13 3300005364 Ga0070673_100370795 Ga0070673_1003707952 117
14 3300005456 Ga0070678_100010304 Ga0070678_1000103044 117
15 3300005457 Ga0070662_100019488 Ga0070662_1000194887 117
16 3300005459 Ga0068867_100948852 Ga0068867_1009488522 117
17 3300005616 Ga0068852_101091303 Ga0068852_1010913032 117
18 3300009177 Ga0105248_10054556 Ga0105248_100545564 117
19 3300009177 Ga0105248_10178932 Ga0105248_101789322 117
20 3300011119 Ga0105246_10985726 Ga0105246_109857262 117
21 3300013102 Ga0157371_11178765 Ga0157371_111787652 117
22 3300013296 Ga0157374_10006812 Ga0157374_100068122 117
23 3300013306 Ga0163162_10060277 Ga0163162_100602774 117
24 3300013308 Ga0157375_10002069 Ga0157375_100020692 117
25 3300014325 Ga0163163_10132101 Ga0163163_101321012 117
26 3300025315 Ga0207697_10331490 Ga0207697_103314902 117
27 3300025926 Ga0207659_10650981 Ga0207659_106509812 117
28 3300025931 Ga0207644_10000773 Ga0207644_100007737 117
29 3300025933 Ga0207706_10005402 Ga0207706_100054027 117
30 3300026121 Ga0207683_10002289 Ga0207683_100022895 117
31 3300028381 Ga0268264_10531798 Ga0268264_105317982 117
32 3300048903 Ga0496100_0140604 Ga0496100_0140604_760_1113 117
33 3300048904 Ga0496101_0216175 Ga0496101_0216175_1107_1460 117
34 3300048904 Ga0496101_0451972 Ga0496101_0451972_287_640 117
35 3300048909 Ga0496106_0510768 Ga0496106_0510768_428_781 117
36 3300048910 Ga0496107_0391093 Ga0496107_0391093_629_982 117
37 3300048910 Ga0496107_0814818 Ga0496107_0814818_65_418 117
38 3300048912 Ga0496109_0181195 Ga0496109_0181195_936_1289 117
39 3300048914 Ga0496111_0030983 Ga0496111_0030983_3269_3622 117
40 3300048915 Ga0496112_0021051 Ga0496112_0021051_550_903 117
41 3300048916 Ga0496113_0190825 Ga0496113_0190825_779_1132 117
42 3300048918 Ga0496115_1410236 Ga0496115_1410236_64_417 117
43 3300037471 Ga0395905_0452711 Ga0395905_0452711_11_367 118
44 3300037471 Ga0395905_1226898 Ga0395905_1226898_27_383 118
45 3300025933 Ga0207706_10003262 Ga0207706_1000326219 125
46 3300005347 Ga0070668_100699248 Ga0070668_1006992482 130
47 3300005356 Ga0070674_101385008 Ga0070674_1013850082 131
48 3300005435 Ga0070714_100152133 Ga0070714_1001521333 131
49 3300006028 Ga0070717_10005953 Ga0070717_100059536 131
50 3300025923 Ga0207681_10200143 Ga0207681_102001432 131
51 3300025928 Ga0207700_10985797 Ga0207700_109857972 131
52 3300031824 Ga0307413_10278240 Ga0307413_102782401 131
53 3300032005 Ga0307411_10787297 Ga0307411_107872972 131
54 3300032126 Ga0307415_100705931 Ga0307415_1007059312 131
55 3300044684 Ga0466966_0268627 Ga0466966_0268627_224_619 131
56 3300044719 Ga0466971_0183579 Ga0466971_0183579_67_462 131
57 3300044842 Ga0466957_0127727 Ga0466957_0127727_987_1382 131
58 3300045049 Ga0466959_0317838 Ga0466959_0317838_616_1011 131
59 3300001976 JGI24752J21851_1004450 JGI24752J21851_10044503 132
60 3300005327 Ga0070658_10158939 Ga0070658_101589392 132
61 3300005327 Ga0070658_10408021 Ga0070658_104080212 132
62 3300005327 Ga0070658_10505161 Ga0070658_105051611 132
63 3300005327 Ga0070658_10509695 Ga0070658_105096952 132
64 3300005327 Ga0070658_10980099 Ga0070658_109800991 132
65 3300005328 Ga0070676_10038579 Ga0070676_100385792 132
66 3300005328 Ga0070676_10112069 Ga0070676_101120692 132
67 3300005328 Ga0070676_10139686 Ga0070676_101396862 132
68 3300005328 Ga0070676_10227229 Ga0070676_102272293 132
69 3300005328 Ga0070676_10704290 Ga0070676_107042902 132
70 3300005329 Ga0070683_100758703 Ga0070683_1007587031 132
71 3300005329 Ga0070683_101835939 Ga0070683_1018359391 132
72 3300005330 Ga0070690_100053796 Ga0070690_1000537961 132
73 3300005330 Ga0070690_100524191 Ga0070690_1005241912 132
74 3300005330 Ga0070690_101153317 Ga0070690_1011533171 132
75 3300005331 Ga0070670_100005424 Ga0070670_1000054249 132
76 3300005331 Ga0070670_100008941 Ga0070670_1000089417 132
77 3300005331 Ga0070670_100043864 Ga0070670_1000438642 132
78 3300005331 Ga0070670_101379691 Ga0070670_1013796912 132
79 3300005333 Ga0070677_10053294 Ga0070677_100532943 132
80 3300005334 Ga0068869_100202591 Ga0068869_1002025911 132
81 3300005335 Ga0070666_10051732 Ga0070666_100517323 132
82 3300005335 Ga0070666_10072580 Ga0070666_100725802 132
83 3300005335 Ga0070666_10101684 Ga0070666_101016843 132
84 3300005335 Ga0070666_10158072 Ga0070666_101580722 132
85 3300005335 Ga0070666_10637048 Ga0070666_106370482 132
86 3300005336 Ga0070680_100247940 Ga0070680_1002479402 132
87 3300005337 Ga0070682_100306371 Ga0070682_1003063712 132
88 3300005338 Ga0068868_100000540 Ga0068868_10000054018 132
89 3300005338 Ga0068868_100072054 Ga0068868_1000720544 132
90 3300005338 Ga0068868_100092462 Ga0068868_1000924624 132
91 3300005338 Ga0068868_100104094 Ga0068868_1001040942 132
92 3300005338 Ga0068868_100160360 Ga0068868_1001603603 132
93 3300005338 Ga0068868_101185848 Ga0068868_1011858482 132
94 3300005339 Ga0070660_100061065 Ga0070660_1000610652 132
95 3300005339 Ga0070660_100171735 Ga0070660_1001717353 132
96 3300005339 Ga0070660_100250894 Ga0070660_1002508942 132
97 3300005339 Ga0070660_100337498 Ga0070660_1003374982 132
98 3300005341 Ga0070691_10464412 Ga0070691_104644121 132
99 3300005344 Ga0070661_100001787 Ga0070661_10000178717 132
100 3300005344 Ga0070661_100132888 Ga0070661_1001328883 132
101 3300005344 Ga0070661_100170200 Ga0070661_1001702002 132
102 3300005344 Ga0070661_100225175 Ga0070661_1002251752 132
103 3300005344 Ga0070661_100229785 Ga0070661_1002297852 132
104 3300005344 Ga0070661_100482783 Ga0070661_1004827832 132
105 3300005344 Ga0070661_100567258 Ga0070661_1005672582 132
106 3300005347 Ga0070668_100065229 Ga0070668_1000652292 132
107 3300005347 Ga0070668_100488648 Ga0070668_1004886482 132
108 3300005347 Ga0070668_101556798 Ga0070668_1015567982 132
109 3300005353 Ga0070669_101349363 Ga0070669_1013493632 132
110 3300005354 Ga0070675_100128723 Ga0070675_1001287233 132
111 3300005354 Ga0070675_101247776 Ga0070675_1012477762 132
112 3300005355 Ga0070671_100010022 Ga0070671_1000100223 132
113 3300005355 Ga0070671_100013985 Ga0070671_1000139852 132
114 3300005355 Ga0070671_100040667 Ga0070671_1000406675 132
115 3300005355 Ga0070671_100120942 Ga0070671_1001209422 132
116 3300005355 Ga0070671_100143244 Ga0070671_1001432441 132
117 3300005355 Ga0070671_100209701 Ga0070671_1002097011 132
118 3300005355 Ga0070671_100451106 Ga0070671_1004511062 132
119 3300005355 Ga0070671_100910496 Ga0070671_1009104962 132
120 3300005355 Ga0070671_101148186 Ga0070671_1011481861 132
121 3300005356 Ga0070674_100128411 Ga0070674_1001284113 132
122 3300005356 Ga0070674_100182251 Ga0070674_1001822514 132
123 3300005356 Ga0070674_100372069 Ga0070674_1003720692 132
124 3300005356 Ga0070674_100481754 Ga0070674_1004817542 132
125 3300005356 Ga0070674_101146326 Ga0070674_1011463262 132
126 3300005364 Ga0070673_100018567 Ga0070673_1000185674 132
127 3300005364 Ga0070673_100025353 Ga0070673_1000253533 132
128 3300005364 Ga0070673_100028572 Ga0070673_1000285722 132
129 3300005364 Ga0070673_100260650 Ga0070673_1002606503 132
130 3300005364 Ga0070673_100563574 Ga0070673_1005635742 132
131 3300005364 Ga0070673_100961889 Ga0070673_1009618892 132
132 3300005364 Ga0070673_100974861 Ga0070673_1009748612 132
133 3300005364 Ga0070673_101273476 Ga0070673_1012734761 132
134 3300005365 Ga0070688_100583001 Ga0070688_1005830012 132
135 3300005366 Ga0070659_100046830 Ga0070659_1000468305 132
136 3300005366 Ga0070659_100059277 Ga0070659_1000592772 132
137 3300005366 Ga0070659_100155664 Ga0070659_1001556642 132
138 3300005366 Ga0070659_100269345 Ga0070659_1002693452 132
139 3300005366 Ga0070659_100370805 Ga0070659_1003708052 132
140 3300005366 Ga0070659_100387064 Ga0070659_1003870642 132
141 3300005366 Ga0070659_100394480 Ga0070659_1003944801 132
142 3300005366 Ga0070659_100418808 Ga0070659_1004188082 132
143 3300005366 Ga0070659_101146618 Ga0070659_1011466182 132
144 3300005366 Ga0070659_101328501 Ga0070659_1013285012 132
145 3300005366 Ga0070659_101416061 Ga0070659_1014160611 132
146 3300005367 Ga0070667_100001880 Ga0070667_10000188013 132
147 3300005367 Ga0070667_100020050 Ga0070667_1000200507 132
148 3300005367 Ga0070667_100141414 Ga0070667_1001414142 132
149 3300005367 Ga0070667_100234708 Ga0070667_1002347082 132
150 3300005367 Ga0070667_100868521 Ga0070667_1008685212 132
151 3300005434 Ga0070709_10003770 Ga0070709_100037702 132
152 3300005435 Ga0070714_100048977 Ga0070714_1000489771 132
153 3300005435 Ga0070714_100062778 Ga0070714_1000627782 132
154 3300005435 Ga0070714_100196179 Ga0070714_1001961792 132
155 3300005436 Ga0070713_100047052 Ga0070713_1000470523 132
156 3300005436 Ga0070713_100385239 Ga0070713_1003852392 132
157 3300005436 Ga0070713_100569164 Ga0070713_1005691642 132
158 3300005455 Ga0070663_100044752 Ga0070663_1000447523 132
159 3300005455 Ga0070663_100184951 Ga0070663_1001849512 132
160 3300005455 Ga0070663_100653755 Ga0070663_1006537552 132
161 3300005455 Ga0070663_101049410 Ga0070663_1010494102 132
162 3300005456 Ga0070678_100036424 Ga0070678_1000364243 132
163 3300005456 Ga0070678_100040711 Ga0070678_1000407114 132
164 3300005456 Ga0070678_100213112 Ga0070678_1002131122 132
165 3300005456 Ga0070678_100570838 Ga0070678_1005708382 132
166 3300005457 Ga0070662_100069793 Ga0070662_1000697932 132
167 3300005457 Ga0070662_100145706 Ga0070662_1001457062 132
168 3300005457 Ga0070662_100204462 Ga0070662_1002044623 132
169 3300005457 Ga0070662_100266010 Ga0070662_1002660102 132
170 3300005457 Ga0070662_101115523 Ga0070662_1011155231 132
171 3300005457 Ga0070662_101502810 Ga0070662_1015028101 132
172 3300005458 Ga0070681_10010289 Ga0070681_100102892 132
173 3300005458 Ga0070681_10177119 Ga0070681_101771192 132
174 3300005459 Ga0068867_100188650 Ga0068867_1001886502 132
175 3300005459 Ga0068867_100203682 Ga0068867_1002036822 132
176 3300005459 Ga0068867_102102630 Ga0068867_1021026301 132
177 3300005466 Ga0070685_10082358 Ga0070685_100823582 132
178 3300005530 Ga0070679_101268783 Ga0070679_1012687831 132
179 3300005539 Ga0068853_100064967 Ga0068853_1000649671 132
180 3300005539 Ga0068853_100397631 Ga0068853_1003976312 132
181 3300005539 Ga0068853_100645894 Ga0068853_1006458942 132
182 3300005539 Ga0068853_100737957 Ga0068853_1007379571 132
183 3300005539 Ga0068853_101051084 Ga0068853_1010510841 132
184 3300005539 Ga0068853_101534087 Ga0068853_1015340872 132
185 3300005543 Ga0070672_100007583 Ga0070672_1000075839 132
186 3300005543 Ga0070672_100173189 Ga0070672_1001731892 132
187 3300005543 Ga0070672_100240337 Ga0070672_1002403372 132
188 3300005543 Ga0070672_100591832 Ga0070672_1005918322 132
189 3300005543 Ga0070672_100602163 Ga0070672_1006021632 132
190 3300005543 Ga0070672_100796245 Ga0070672_1007962452 132
191 3300005543 Ga0070672_100831396 Ga0070672_1008313962 132
192 3300005544 Ga0070686_100022420 Ga0070686_1000224202 132
193 3300005544 Ga0070686_100197270 Ga0070686_1001972702 132
194 3300005544 Ga0070686_100450563 Ga0070686_1004505632 132
195 3300005546 Ga0070696_100377654 Ga0070696_1003776542 132
196 3300005547 Ga0070693_100018738 Ga0070693_1000187384 132
197 3300005547 Ga0070693_100744407 Ga0070693_1007444071 132
198 3300005548 Ga0070665_100378184 Ga0070665_1003781842 132
199 3300005548 Ga0070665_100683022 Ga0070665_1006830222 132
200 3300005548 Ga0070665_100839882 Ga0070665_1008398822 132
201 3300005563 Ga0068855_100534714 Ga0068855_1005347142 132
202 3300005563 Ga0068855_100788904 Ga0068855_1007889041 132
203 3300005563 Ga0068855_100941403 Ga0068855_1009414032 132
204 3300005563 Ga0068855_102089893 Ga0068855_1020898931 132
205 3300005564 Ga0070664_100007255 Ga0070664_1000072552 132
206 3300005564 Ga0070664_100015505 Ga0070664_1000155055 132
207 3300005564 Ga0070664_100284958 Ga0070664_1002849582 132
208 3300005564 Ga0070664_100425667 Ga0070664_1004256672 132
209 3300005564 Ga0070664_100650032 Ga0070664_1006500322 132
210 3300005564 Ga0070664_100801285 Ga0070664_1008012852 132
211 3300005564 Ga0070664_100891242 Ga0070664_1008912422 132
212 3300005564 Ga0070664_100919151 Ga0070664_1009191512 132
213 3300005564 Ga0070664_101685349 Ga0070664_1016853492 132
214 3300005577 Ga0068857_100063269 Ga0068857_1000632693 132
215 3300005578 Ga0068854_100013020 Ga0068854_1000130204 132
216 3300005578 Ga0068854_100202678 Ga0068854_1002026782 132
217 3300005578 Ga0068854_100396082 Ga0068854_1003960822 132
218 3300005578 Ga0068854_100653950 Ga0068854_1006539502 132
219 3300005578 Ga0068854_100796394 Ga0068854_1007963942 132
220 3300005578 Ga0068854_101078855 Ga0068854_1010788552 132
221 3300005614 Ga0068856_100282835 Ga0068856_1002828353 132
222 3300005614 Ga0068856_100536898 Ga0068856_1005368982 132
223 3300005614 Ga0068856_102551716 Ga0068856_1025517162 132
224 3300005616 Ga0068852_100013389 Ga0068852_1000133896 132
225 3300005616 Ga0068852_100056428 Ga0068852_1000564284 132
226 3300005616 Ga0068852_100084393 Ga0068852_1000843933 132
227 3300005616 Ga0068852_100137216 Ga0068852_1001372163 132
228 3300005616 Ga0068852_100751407 Ga0068852_1007514072 132
229 3300005617 Ga0068859_100114674 Ga0068859_1001146743 132
230 3300005617 Ga0068859_100140847 Ga0068859_1001408472 132
231 3300005617 Ga0068859_100224941 Ga0068859_1002249413 132
232 3300005617 Ga0068859_101566274 Ga0068859_1015662742 132
233 3300005618 Ga0068864_100071466 Ga0068864_1000714663 132
234 3300005618 Ga0068864_100491847 Ga0068864_1004918471 132
235 3300005618 Ga0068864_100860862 Ga0068864_1008608622 132
236 3300005618 Ga0068864_101611672 Ga0068864_1016116722 132
237 3300005718 Ga0068866_10740771 Ga0068866_107407712 132
238 3300005834 Ga0068851_10193500 Ga0068851_101935002 132
239 3300005834 Ga0068851_10559476 Ga0068851_105594761 132
240 3300005834 Ga0068851_10688108 Ga0068851_106881081 132
241 3300005841 Ga0068863_100061135 Ga0068863_1000611353 132
242 3300005841 Ga0068863_100448267 Ga0068863_1004482672 132
243 3300005841 Ga0068863_100828140 Ga0068863_1008281402 132
244 3300005842 Ga0068858_100014273 Ga0068858_1000142737 132
245 3300005842 Ga0068858_100014925 Ga0068858_1000149258 132
246 3300005842 Ga0068858_100079403 Ga0068858_1000794033 132
247 3300005842 Ga0068858_100440726 Ga0068858_1004407262 132
248 3300005842 Ga0068858_101292395 Ga0068858_1012923951 132
249 3300005842 Ga0068858_101959175 Ga0068858_1019591751 132
250 3300005842 Ga0068858_102393672 Ga0068858_1023936721 132
251 3300005843 Ga0068860_100110137 Ga0068860_1001101372 132
252 3300005844 Ga0068862_100007719 Ga0068862_10000771910 132
253 3300005844 Ga0068862_101381899 Ga0068862_1013818992 132
254 3300006028 Ga0070717_10300641 Ga0070717_103006412 132
255 3300006028 Ga0070717_10482695 Ga0070717_104826952 132
256 3300006173 Ga0070716_100060089 Ga0070716_1000600892 132
257 3300006175 Ga0070712_100035780 Ga0070712_1000357803 132
258 3300006237 Ga0097621_100507081 Ga0097621_1005070812 132
259 3300006237 Ga0097621_100607773 Ga0097621_1006077732 132
260 3300006237 Ga0097621_102266349 Ga0097621_1022663491 132
261 3300006358 Ga0068871_100028454 Ga0068871_1000284543 132
262 3300006358 Ga0068871_100128772 Ga0068871_1001287722 132
263 3300006358 Ga0068871_100388942 Ga0068871_1003889421 132
264 3300006931 Ga0097620_100114673 Ga0097620_1001146733 132
265 3300006931 Ga0097620_100140845 Ga0097620_1001408453 132
266 3300006931 Ga0097620_100224935 Ga0097620_1002249351 132
267 3300006931 Ga0097620_101566326 Ga0097620_1015663262 132
268 3300009098 Ga0105245_10105004 Ga0105245_101050043 132
269 3300009098 Ga0105245_10469794 Ga0105245_104697943 132
270 3300009101 Ga0105247_11194476 Ga0105247_111944761 132
271 3300009174 Ga0105241_11096558 Ga0105241_110965582 132
272 3300009174 Ga0105241_11247336 Ga0105241_112473362 132
273 3300009177 Ga0105248_10002275 Ga0105248_1000227515 132
274 3300009177 Ga0105248_10434885 Ga0105248_104348852 132
275 3300009177 Ga0105248_10438163 Ga0105248_104381632 132
276 3300009177 Ga0105248_10481895 Ga0105248_104818952 132
277 3300009177 Ga0105248_11171501 Ga0105248_111715012 132
278 3300009545 Ga0105237_12342428 Ga0105237_123424282 132
279 3300009551 Ga0105238_10249509 Ga0105238_102495094 132
280 3300009553 Ga0105249_10171397 Ga0105249_101713972 132
281 3300011119 Ga0105246_11049524 Ga0105246_110495242 132
282 3300013100 Ga0157373_10007653 Ga0157373_100076532 132
283 3300013100 Ga0157373_10144492 Ga0157373_101444924 132
284 3300013100 Ga0157373_10165418 Ga0157373_101654182 132
285 3300013100 Ga0157373_10192740 Ga0157373_101927402 132
286 3300013100 Ga0157373_10916228 Ga0157373_109162282 132
287 3300013102 Ga0157371_10367166 Ga0157371_103671662 132
288 3300013102 Ga0157371_10506977 Ga0157371_105069772 132
289 3300013102 Ga0157371_11593654 Ga0157371_115936542 132
290 3300013104 Ga0157370_10267251 Ga0157370_102672511 132
291 3300013104 Ga0157370_10444054 Ga0157370_104440542 132
292 3300013105 Ga0157369_10233366 Ga0157369_102333661 132
293 3300013296 Ga0157374_10060461 Ga0157374_100604617 132
294 3300013296 Ga0157374_10622018 Ga0157374_106220182 132
295 3300013296 Ga0157374_11922130 Ga0157374_119221301 132
296 3300013297 Ga0157378_10142862 Ga0157378_101428623 132
297 3300013297 Ga0157378_10763158 Ga0157378_107631582 132
298 3300013306 Ga0163162_10297777 Ga0163162_102977772 132
299 3300013306 Ga0163162_11291182 Ga0163162_112911821 132
300 3300013307 Ga0157372_10897301 Ga0157372_108973012 132
301 3300013307 Ga0157372_12451678 Ga0157372_124516781 132
302 3300013307 Ga0157372_13166674 Ga0157372_131666742 132
303 3300013308 Ga0157375_10970534 Ga0157375_109705342 132
304 3300013308 Ga0157375_11191729 Ga0157375_111917293 132
305 3300013308 Ga0157375_13747907 Ga0157375_137479072 132
306 3300013308 Ga0157375_13747909 Ga0157375_137479092 132
307 3300014497 Ga0182008_10218369 Ga0182008_102183692 132
308 3300014968 Ga0157379_10185574 Ga0157379_101855742 132
309 3300014968 Ga0157379_10330052 Ga0157379_103300522 132
310 3300014968 Ga0157379_10957066 Ga0157379_109570661 132
311 3300017792 Ga0163161_10754500 Ga0163161_107545002 132
312 3300025315 Ga0207697_10226495 Ga0207697_102264951 132
313 3300025321 Ga0207656_10439753 Ga0207656_104397532 132
314 3300025893 Ga0207682_10103223 Ga0207682_101032232 132
315 3300025893 Ga0207682_10376467 Ga0207682_103764672 132
316 3300025900 Ga0207710_10324980 Ga0207710_103249801 132
317 3300025901 Ga0207688_10181146 Ga0207688_101811462 132
318 3300025901 Ga0207688_10221714 Ga0207688_102217142 132
319 3300025901 Ga0207688_10331347 Ga0207688_103313472 132
320 3300025903 Ga0207680_10001045 Ga0207680_1000104515 132
321 3300025903 Ga0207680_10074839 Ga0207680_100748392 132
322 3300025903 Ga0207680_10098215 Ga0207680_100982152 132
323 3300025903 Ga0207680_10166118 Ga0207680_101661182 132
324 3300025903 Ga0207680_10280832 Ga0207680_102808322 132
325 3300025903 Ga0207680_10289930 Ga0207680_102899302 132
326 3300025903 Ga0207680_10375760 Ga0207680_103757602 132
327 3300025904 Ga0207647_10151397 Ga0207647_101513973 132
328 3300025906 Ga0207699_10084968 Ga0207699_100849682 132
329 3300025907 Ga0207645_10071914 Ga0207645_100719143 132
330 3300025907 Ga0207645_10102506 Ga0207645_101025063 132
331 3300025907 Ga0207645_10325531 Ga0207645_103255312 132
332 3300025907 Ga0207645_10644589 Ga0207645_106445892 132
333 3300025907 Ga0207645_10874531 Ga0207645_108745312 132
334 3300025909 Ga0207705_10038128 Ga0207705_100381283 132
335 3300025909 Ga0207705_10110496 Ga0207705_101104964 132
336 3300025909 Ga0207705_10133292 Ga0207705_101332922 132
337 3300025909 Ga0207705_10197698 Ga0207705_101976982 132
338 3300025909 Ga0207705_10651975 Ga0207705_106519751 132
339 3300025909 Ga0207705_10902217 Ga0207705_109022172 132
340 3300025909 Ga0207705_11209844 Ga0207705_112098441 132
341 3300025911 Ga0207654_11387068 Ga0207654_113870681 132
342 3300025912 Ga0207707_10716013 Ga0207707_107160131 132
343 3300025913 Ga0207695_11348552 Ga0207695_113485522 132
344 3300025915 Ga0207693_10006527 Ga0207693_100065276 132
345 3300025919 Ga0207657_10015919 Ga0207657_1001591910 132
346 3300025919 Ga0207657_10030402 Ga0207657_100304026 132
347 3300025919 Ga0207657_10077058 Ga0207657_100770582 132
348 3300025919 Ga0207657_10208809 Ga0207657_102088092 132
349 3300025919 Ga0207657_10287448 Ga0207657_102874482 132
350 3300025919 Ga0207657_10355658 Ga0207657_103556583 132
351 3300025919 Ga0207657_10542512 Ga0207657_105425121 132
352 3300025919 Ga0207657_10645177 Ga0207657_106451772 132
353 3300025919 Ga0207657_11179770 Ga0207657_111797702 132
354 3300025920 Ga0207649_10033848 Ga0207649_100338482 132
355 3300025920 Ga0207649_10043747 Ga0207649_100437473 132
356 3300025920 Ga0207649_10062674 Ga0207649_100626742 132
357 3300025920 Ga0207649_10248986 Ga0207649_102489862 132
358 3300025920 Ga0207649_10265702 Ga0207649_102657022 132
359 3300025920 Ga0207649_10364158 Ga0207649_103641582 132
360 3300025920 Ga0207649_10396457 Ga0207649_103964571 132
361 3300025921 Ga0207652_10336882 Ga0207652_103368821 132
362 3300025921 Ga0207652_10631382 Ga0207652_106313822 132
363 3300025924 Ga0207694_10192731 Ga0207694_101927312 132
364 3300025924 Ga0207694_10272791 Ga0207694_102727912 132
365 3300025925 Ga0207650_10128250 Ga0207650_101282502 132
366 3300025925 Ga0207650_10135623 Ga0207650_101356233 132
367 3300025925 Ga0207650_10225311 Ga0207650_102253113 132
368 3300025925 Ga0207650_10657602 Ga0207650_106576022 132
369 3300025925 Ga0207650_11018551 Ga0207650_110185512 132
370 3300025926 Ga0207659_10394184 Ga0207659_103941842 132
371 3300025927 Ga0207687_10874780 Ga0207687_108747802 132
372 3300025928 Ga0207700_10135095 Ga0207700_101350953 132
373 3300025928 Ga0207700_10352237 Ga0207700_103522372 132
374 3300025928 Ga0207700_10772137 Ga0207700_107721372 132
375 3300025928 Ga0207700_11785957 Ga0207700_117859572 132
376 3300025929 Ga0207664_10043273 Ga0207664_100432735 132
377 3300025929 Ga0207664_10281559 Ga0207664_102815592 132
378 3300025929 Ga0207664_10730771 Ga0207664_107307712 132
379 3300025931 Ga0207644_10000847 Ga0207644_1000084722 132
380 3300025931 Ga0207644_10011794 Ga0207644_100117942 132
381 3300025931 Ga0207644_10023868 Ga0207644_100238682 132
382 3300025931 Ga0207644_10034654 Ga0207644_100346544 132
383 3300025931 Ga0207644_10069347 Ga0207644_100693474 132
384 3300025931 Ga0207644_10238171 Ga0207644_102381713 132
385 3300025931 Ga0207644_10682077 Ga0207644_106820772 132
386 3300025931 Ga0207644_11037995 Ga0207644_110379952 132
387 3300025931 Ga0207644_11188349 Ga0207644_111883492 132
388 3300025932 Ga0207690_10228167 Ga0207690_102281672 132
389 3300025932 Ga0207690_10277051 Ga0207690_102770512 132
390 3300025932 Ga0207690_10298268 Ga0207690_102982682 132
391 3300025932 Ga0207690_10367097 Ga0207690_103670972 132
392 3300025932 Ga0207690_10376653 Ga0207690_103766532 132
393 3300025932 Ga0207690_10471279 Ga0207690_104712792 132
394 3300025932 Ga0207690_11115537 Ga0207690_111155372 132
395 3300025932 Ga0207690_11239821 Ga0207690_112398211 132
396 3300025933 Ga0207706_10000253 Ga0207706_1000025332 132
397 3300025933 Ga0207706_10004173 Ga0207706_100041734 132
398 3300025933 Ga0207706_10055811 Ga0207706_100558113 132
399 3300025933 Ga0207706_10060026 Ga0207706_100600266 132
400 3300025933 Ga0207706_10282862 Ga0207706_102828622 132
401 3300025933 Ga0207706_10354629 Ga0207706_103546292 132
402 3300025933 Ga0207706_10679275 Ga0207706_106792752 132
403 3300025933 Ga0207706_10777166 Ga0207706_107771662 132
404 3300025933 Ga0207706_10936011 Ga0207706_109360111 132
405 3300025937 Ga0207669_10035217 Ga0207669_100352171 132
406 3300025937 Ga0207669_10070448 Ga0207669_100704482 132
407 3300025937 Ga0207669_10396507 Ga0207669_103965072 132
408 3300025937 Ga0207669_10528940 Ga0207669_105289401 132
409 3300025937 Ga0207669_11244531 Ga0207669_112445312 132
410 3300025937 Ga0207669_11478669 Ga0207669_114786692 132
411 3300025939 Ga0207665_10150585 Ga0207665_101505852 132
412 3300025940 Ga0207691_10004350 Ga0207691_100043509 132
413 3300025940 Ga0207691_10027663 Ga0207691_100276635 132
414 3300025940 Ga0207691_10096941 Ga0207691_100969413 132
415 3300025940 Ga0207691_10137747 Ga0207691_101377473 132
416 3300025940 Ga0207691_10221124 Ga0207691_102211242 132
417 3300025940 Ga0207691_10228433 Ga0207691_102284332 132
418 3300025940 Ga0207691_10369005 Ga0207691_103690052 132
419 3300025941 Ga0207711_10000309 Ga0207711_1000030935 132
420 3300025941 Ga0207711_10002790 Ga0207711_1000279020 132
421 3300025941 Ga0207711_10024125 Ga0207711_100241252 132
422 3300025941 Ga0207711_10113799 Ga0207711_101137992 132
423 3300025941 Ga0207711_10145943 Ga0207711_101459432 132
424 3300025941 Ga0207711_10473852 Ga0207711_104738522 132
425 3300025942 Ga0207689_10156323 Ga0207689_101563232 132
426 3300025945 Ga0207679_10038485 Ga0207679_100384855 132
427 3300025945 Ga0207679_10059628 Ga0207679_100596283 132
428 3300025945 Ga0207679_10178336 Ga0207679_101783362 132
429 3300025945 Ga0207679_10230107 Ga0207679_102301073 132
430 3300025945 Ga0207679_10519864 Ga0207679_105198643 132
431 3300025945 Ga0207679_11036325 Ga0207679_110363252 132
432 3300025945 Ga0207679_11201249 Ga0207679_112012491 132
433 3300025945 Ga0207679_11222780 Ga0207679_112227802 132
434 3300025945 Ga0207679_11261496 Ga0207679_112614961 132
435 3300025945 Ga0207679_11414551 Ga0207679_114145512 132
436 3300025949 Ga0207667_10097958 Ga0207667_100979582 132
437 3300025949 Ga0207667_10317951 Ga0207667_103179512 132
438 3300025949 Ga0207667_10421941 Ga0207667_104219411 132
439 3300025949 Ga0207667_11157918 Ga0207667_111579181 132
440 3300025960 Ga0207651_10014293 Ga0207651_100142937 132
441 3300025960 Ga0207651_10024871 Ga0207651_100248713 132
442 3300025960 Ga0207651_10047390 Ga0207651_100473904 132
443 3300025960 Ga0207651_10056300 Ga0207651_100563001 132
444 3300025960 Ga0207651_10112290 Ga0207651_101122902 132
445 3300025960 Ga0207651_10296759 Ga0207651_102967592 132
446 3300025960 Ga0207651_10958373 Ga0207651_109583732 132
447 3300025961 Ga0207712_10139451 Ga0207712_101394512 132
448 3300025972 Ga0207668_10135900 Ga0207668_101359002 132
449 3300025972 Ga0207668_10505476 Ga0207668_105054762 132
450 3300025981 Ga0207640_10016718 Ga0207640_100167184 132
451 3300025981 Ga0207640_10133642 Ga0207640_101336422 132
452 3300025981 Ga0207640_10252858 Ga0207640_102528582 132
453 3300025981 Ga0207640_10255497 Ga0207640_102554973 132
454 3300025981 Ga0207640_10282198 Ga0207640_102821982 132
455 3300025981 Ga0207640_10791873 Ga0207640_107918732 132
456 3300025986 Ga0207658_10080839 Ga0207658_100808392 132
457 3300025986 Ga0207658_10130613 Ga0207658_101306132 132
458 3300025986 Ga0207658_10167084 Ga0207658_101670842 132
459 3300025986 Ga0207658_10204778 Ga0207658_102047781 132
460 3300025986 Ga0207658_10996567 Ga0207658_109965672 132
461 3300025986 Ga0207658_11240859 Ga0207658_112408592 132
462 3300026023 Ga0207677_10019204 Ga0207677_100192045 132
463 3300026023 Ga0207677_10248012 Ga0207677_102480122 132
464 3300026035 Ga0207703_10001905 Ga0207703_1000190513 132
465 3300026035 Ga0207703_10031527 Ga0207703_100315277 132
466 3300026035 Ga0207703_10047014 Ga0207703_100470143 132
467 3300026035 Ga0207703_10079230 Ga0207703_100792303 132
468 3300026041 Ga0207639_10049224 Ga0207639_100492244 132
469 3300026041 Ga0207639_10326827 Ga0207639_103268271 132
470 3300026041 Ga0207639_10659652 Ga0207639_106596522 132
471 3300026041 Ga0207639_10705611 Ga0207639_107056112 132
472 3300026041 Ga0207639_11056184 Ga0207639_110561841 132
473 3300026041 Ga0207639_11489900 Ga0207639_114899002 132
474 3300026067 Ga0207678_10016793 Ga0207678_100167936 132
475 3300026067 Ga0207678_10081603 Ga0207678_100816034 132
476 3300026067 Ga0207678_10114121 Ga0207678_101141212 132
477 3300026067 Ga0207678_10172330 Ga0207678_101723302 132
478 3300026067 Ga0207678_10222422 Ga0207678_102224222 132
479 3300026067 Ga0207678_10276911 Ga0207678_102769112 132
480 3300026067 Ga0207678_10699177 Ga0207678_106991772 132
481 3300026067 Ga0207678_11378426 Ga0207678_113784261 132
482 3300026078 Ga0207702_10444675 Ga0207702_104446752 132
483 3300026088 Ga0207641_10120626 Ga0207641_101206262 132
484 3300026088 Ga0207641_10319703 Ga0207641_103197032 132
485 3300026088 Ga0207641_10711446 Ga0207641_107114462 132
486 3300026089 Ga0207648_10017417 Ga0207648_1001741710 132
487 3300026089 Ga0207648_10049684 Ga0207648_100496846 132
488 3300026089 Ga0207648_10622079 Ga0207648_106220792 132
489 3300026095 Ga0207676_10016579 Ga0207676_100165793 132
490 3300026095 Ga0207676_10027536 Ga0207676_100275362 132
491 3300026095 Ga0207676_10270319 Ga0207676_102703192 132
492 3300026095 Ga0207676_11552566 Ga0207676_115525662 132
493 3300026095 Ga0207676_12076361 Ga0207676_120763611 132
494 3300026116 Ga0207674_10083533 Ga0207674_100835333 132
495 3300026116 Ga0207674_10135320 Ga0207674_101353203 132
496 3300026121 Ga0207683_10001185 Ga0207683_1000118528 132
497 3300026121 Ga0207683_10031898 Ga0207683_100318983 132
498 3300026121 Ga0207683_10095107 Ga0207683_100951073 132
499 3300026121 Ga0207683_10173531 Ga0207683_101735313 132
500 3300026121 Ga0207683_10207231 Ga0207683_102072313 132
501 3300026142 Ga0207698_10025991 Ga0207698_100259912 132
502 3300026142 Ga0207698_10060036 Ga0207698_100600363 132
503 3300026142 Ga0207698_10177393 Ga0207698_101773934 132
504 3300026142 Ga0207698_10180433 Ga0207698_101804334 132
505 3300026142 Ga0207698_10317904 Ga0207698_103179043 132
506 3300026142 Ga0207698_10319124 Ga0207698_103191242 132
507 3300026142 Ga0207698_11112101 Ga0207698_111121012 132
508 3300028379 Ga0268266_10032604 Ga0268266_100326045 132
509 3300028379 Ga0268266_10096853 Ga0268266_100968534 132
510 3300028379 Ga0268266_11443414 Ga0268266_114434142 132
511 3300028380 Ga0268265_10001273 Ga0268265_1000127312 132
512 3300028380 Ga0268265_10440599 Ga0268265_104405992 132
513 3300028381 Ga0268264_10060221 Ga0268264_100602213 132
514 3300028381 Ga0268264_10965940 Ga0268264_109659402 132
515 3300031901 Ga0307406_11696465 Ga0307406_116964651 132
516 3300032004 Ga0307414_10747327 Ga0307414_107473271 132
517 3300032004 Ga0307414_11245357 Ga0307414_112453572 132
518 3300034957 Ga0373938_0206042 Ga0373938_0206042_14_415 132
519 3300035691 Ga0373931_0062393 Ga0373931_0062393_1305_1706 132
520 3300035692 Ga0373935_0015144 Ga0373935_0015144_3328_3729 132
521 3300037312 Ga0395899_0023813 Ga0395899_0023813_2898_3305 132
522 3300037312 Ga0395899_0031040 Ga0395899_0031040_2266_2664 132
523 3300037312 Ga0395899_0045871 Ga0395899_0045871_1771_2169 132
524 3300037312 Ga0395899_0079694 Ga0395899_0079694_1697_2098 132
525 3300037312 Ga0395899_0115826 Ga0395899_0115826_575_973 132
526 3300037312 Ga0395899_0952512 Ga0395899_0952512_83_481 132
527 3300037418 Ga0395900_0001256 Ga0395900_0001256_17807_18214 132
528 3300037418 Ga0395900_0029387 Ga0395900_0029387_1382_1780 132
529 3300037418 Ga0395900_0033179 Ga0395900_0033179_1053_1454 132
530 3300037418 Ga0395900_0061036 Ga0395900_0061036_3335_3733 132
531 3300037418 Ga0395900_0107691 Ga0395900_0107691_1982_2383 132
532 3300037418 Ga0395900_0251170 Ga0395900_0251170_669_1067 132
533 3300037418 Ga0395900_0329722 Ga0395900_0329722_962_1360 132
534 3300037418 Ga0395900_0643361 Ga0395900_0643361_535_933 132
535 3300037418 Ga0395900_0653959 Ga0395900_0653959_125_523 132
536 3300037418 Ga0395900_0688342 Ga0395900_0688342_320_721 132
537 3300037418 Ga0395900_0965935 Ga0395900_0965935_85_486 132
538 3300037418 Ga0395900_1228379 Ga0395900_1228379_201_599 132
539 3300037418 Ga0395900_1576971 Ga0395900_1576971_72_482 132
540 3300037418 Ga0395900_1729246 Ga0395900_1729246_97_498 132
541 3300037466 Ga0395898_0062486 Ga0395898_0062486_1865_2263 132
542 3300037466 Ga0395898_0086667 Ga0395898_0086667_2391_2789 132
543 3300037466 Ga0395898_0086709 Ga0395898_0086709_1676_2074 132
544 3300037466 Ga0395898_0178805 Ga0395898_0178805_692_1090 132
545 3300037466 Ga0395898_0245417 Ga0395898_0245417_749_1159 132
546 3300037466 Ga0395898_0647658 Ga0395898_0647658_442_843 132
547 3300037466 Ga0395898_1905888 Ga0395898_1905888_26_424 132
548 3300037471 Ga0395905_0000610 Ga0395905_0000610_22190_22597 132
549 3300037471 Ga0395905_0002249 Ga0395905_0002249_7899_8300 132
550 3300037471 Ga0395905_0045122 Ga0395905_0045122_1679_2080 132
551 3300037471 Ga0395905_0046707 Ga0395905_0046707_3320_3730 132
552 3300037471 Ga0395905_0057011 Ga0395905_0057011_1382_1780 132
553 3300037471 Ga0395905_0080959 Ga0395905_0080959_530_928 132
554 3300037471 Ga0395905_0126559 Ga0395905_0126559_1819_2217 132
555 3300037471 Ga0395905_0163659 Ga0395905_0163659_1681_2079 132
556 3300037471 Ga0395905_1043269 Ga0395905_1043269_55_456 132
557 3300037471 Ga0395905_1212166 Ga0395905_1212166_181_579 132
558 3300037471 Ga0395905_1437356 Ga0395905_1437356_31_432 132
559 3300037471 Ga0395905_1601567 Ga0395905_1601567_122_523 132
560 3300038443 Ga0395901_0054927 Ga0395901_0054927_1090_1488 132
561 3300038443 Ga0395901_0128016 Ga0395901_0128016_893_1294 132
562 3300038443 Ga0395901_0181515 Ga0395901_0181515_1709_2107 132
563 3300038443 Ga0395901_0213374 Ga0395901_0213374_893_1291 132
564 3300038443 Ga0395901_0339569 Ga0395901_0339569_829_1227 132
565 3300038443 Ga0395901_0445157 Ga0395901_0445157_316_714 132
566 3300038443 Ga0395901_1299699 Ga0395901_1299699_174_602 132
567 3300038443 Ga0395901_1437070 Ga0395901_1437070_68_478 132
568 3300039437 Ga0436365_0269996 Ga0436365_0269996_1001_1402 132
569 3300039437 Ga0436365_0782999 Ga0436365_0782999_634_1035 132
570 3300044658 Ga0466972_0129046 Ga0466972_0129046_715_1116 132
571 3300044658 Ga0466972_0376665 Ga0466972_0376665_24_425 132
572 3300044683 Ga0466965_0147870 Ga0466965_0147870_382_783 132
573 3300044684 Ga0466966_0317002 Ga0466966_0317002_174_575 132
574 3300044693 Ga0466961_0188940 Ga0466961_0188940_486_887 132
575 3300044693 Ga0466961_0265098 Ga0466961_0265098_576_974 132
576 3300044693 Ga0466961_0268318 Ga0466961_0268318_331_729 132
577 3300044694 Ga0466963_0313274 Ga0466963_0313274_404_802 132
578 3300044694 Ga0466963_0479496 Ga0466963_0479496_307_708 132
579 3300044694 Ga0466963_1028968 Ga0466963_1028968_112_513 132
580 3300044694 Ga0466963_1244373 Ga0466963_1244373_100_501 132
581 3300044719 Ga0466971_0105234 Ga0466971_0105234_391_792 132
582 3300044765 Ga0466970_0605626 Ga0466970_0605626_98_499 132
583 3300044842 Ga0466957_0177706 Ga0466957_0177706_535_936 132
584 3300044842 Ga0466957_0366253 Ga0466957_0366253_249_650 132
585 3300044901 Ga0466960_0021572 Ga0466960_0021572_993_1394 132
586 3300044901 Ga0466960_0079229 Ga0466960_0079229_681_1082 132
587 3300044901 Ga0466960_0252111 Ga0466960_0252111_558_959 132
588 3300045836 Ga0466958_0140952 Ga0466958_0140952_686_1087 132
589 3300045836 Ga0466958_0648102 Ga0466958_0648102_151_552 132
590 3300045976 Ga0466967_0030324 Ga0466967_0030324_2452_2850 132
591 3300045976 Ga0466967_0082454 Ga0466967_0082454_2067_2468 132
592 3300045976 Ga0466967_0293601 Ga0466967_0293601_183_584 132
593 3300045976 Ga0466967_0371592 Ga0466967_0371592_793_1191 132
594 3300045976 Ga0466967_0402856 Ga0466967_0402856_23_424 132
595 3300045976 Ga0466967_0607222 Ga0466967_0607222_178_579 132
596 3300045976 Ga0466967_0712629 Ga0466967_0712629_355_756 132
597 3300045976 Ga0466967_1021962 Ga0466967_1021962_259_660 132
598 3300045976 Ga0466967_1869347 Ga0466967_1869347_16_414 132
599 3300046459 Ga0495629_0370635 Ga0495629_0370635_549_947 132
600 3300046472 Ga0495580_0320871 Ga0495580_0320871_117_515 132
601 3300046491 Ga0495584_0448815 Ga0495584_0448815_204_605 132
602 3300046507 Ga0495606_0269934 Ga0495606_0269934_319_720 132
603 3300046512 Ga0495610_0171907 Ga0495610_0171907_291_692 132
604 3300046515 Ga0495620_0117537 Ga0495620_0117537_421_822 132
605 3300046537 Ga0495598_0000202 Ga0495598_0000202_327_728 132
606 3300046539 Ga0495621_0000141 Ga0495621_0000141_10883_11284 132
607 3300046539 Ga0495621_0056609 Ga0495621_0056609_880_1281 132
608 3300046616 Ga0495668_0008461 Ga0495668_0008461_4774_5175 132
609 3300046616 Ga0495668_0049292 Ga0495668_0049292_1808_2209 132
610 3300046660 Ga0495625_0635732 Ga0495625_0635732_132_533 132
611 3300046684 Ga0495669_0000276 Ga0495669_0000276_6318_6719 132
612 3300046684 Ga0495669_0001818 Ga0495669_0001818_6409_6810 132
613 3300046684 Ga0495669_0065845 Ga0495669_0065845_1097_1498 132
614 3300046684 Ga0495669_0421777 Ga0495669_0421777_236_634 132
615 3300046691 Ga0495670_0001165 Ga0495670_0001165_412_813 132
616 3300047445 Ga0495677_0013866 Ga0495677_0013866_1746_2147 132
617 3300047447 Ga0495685_047320 Ga0495685_047320_445_846 132
618 3300048903 Ga0496100_0968005 Ga0496100_0968005_86_484 132
619 3300048904 Ga0496101_0256111 Ga0496101_0256111_614_1012 132
620 3300048905 Ga0496102_0143135 Ga0496102_0143135_1052_1453 132
621 3300048905 Ga0496102_0282770 Ga0496102_0282770_469_870 132
622 3300048905 Ga0496102_1636754 Ga0496102_1636754_60_461 132
623 3300048906 Ga0496103_0106258 Ga0496103_0106258_146_547 132
624 3300048909 Ga0496106_0707986 Ga0496106_0707986_253_654 132
625 3300048910 Ga0496107_0064258 Ga0496107_0064258_694_1092 132
626 3300048910 Ga0496107_0203367 Ga0496107_0203367_534_935 132
627 3300048910 Ga0496107_0230727 Ga0496107_0230727_428_829 132
628 3300048910 Ga0496107_0564972 Ga0496107_0564972_59_460 132
629 3300048912 Ga0496109_0862113 Ga0496109_0862113_140_541 132
630 3300048914 Ga0496111_0160221 Ga0496111_0160221_357_758 132
631 3300048914 Ga0496111_0188287 Ga0496111_0188287_1066_1467 132
632 3300048914 Ga0496111_0193908 Ga0496111_0193908_609_1010 132
633 3300048915 Ga0496112_0190186 Ga0496112_0190186_1199_1597 132
634 3300048915 Ga0496112_0327784 Ga0496112_0327784_958_1359 132
635 3300048915 Ga0496112_1067784 Ga0496112_1067784_37_438 132
636 3300048915 Ga0496112_1521216 Ga0496112_1521216_78_503 132
637 3300048916 Ga0496113_0315550 Ga0496113_0315550_172_573 132
638 3300048917 Ga0496114_0000016 Ga0496114_0000016_264607_265008 132
639 3300048917 Ga0496114_0068560 Ga0496114_0068560_2393_2791 132
640 3300048918 Ga0496115_0095950 Ga0496115_0095950_1944_2342 132
641 3300049584 Ga0501068_0050997 Ga0501068_0050997_882_1283 132
642 3300049585 Ga0501069_0091036 Ga0501069_0091036_957_1358 132
643 3300049585 Ga0501069_0663635 Ga0501069_0663635_173_574 132
644 3300053083 Ga0495655_0110520 Ga0495655_0110520_156_557 132
645 3300061719 Ga0466962_0248369 Ga0466962_0248369_98_499 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

35

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1giu-assembly1.cif.gz_A a trichosanthin(tcs) mutant(e85r) complex structure with adenine 0.9225 57 87
2jjr-assembly1.cif.gz_A v232k, n236d-trichosanthin 0.9222 57 87
2oqa-assembly1.cif.gz_A x-ray sequence and crystal structure of luffaculin 1, a novel type 1 ribosome-inactivating protein 0.916 57 84
1bry-assembly2.cif.gz_Z bryodin type i rip 0.9035 55 84
1j4g-assembly1.cif.gz_A crystal structure analysis of the trichosanthin delta c7 0.9002 57 86
ID Description Score Start End Superfamily
1j1qA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.9317 57 86 3.40.420.10
1ahbA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.9296 57 84 3.40.420.10
af_A0A1D6EGE5_12_199_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.9106 56 85 3.40.420.10
af_A0A1D6EN25_32_208_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.901 56 87 3.40.420.10
af_A0A0P0X332_29_163_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8723 57 85 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A653ZA60-F1-model_v4 GFA family protein 0.9693 2 100 GO:0016846
GO:0046872
AF-A0A848Q840-F1-model_v4 deleted 0.969 1 85
AF-Q7MF78-F1-model_v4 Uncharacterized conserved protein 0.9657 2 102 GO:0016846
GO:0046872
AF-A0A227J8M4-F1-model_v4 Aldehyde-activating protein 0.9615 2 82 GO:0016846
GO:0046872
AF-A0A526S5J8-F1-model_v4 Aldehyde-activating protein 0.9585 1 86 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
85.64 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map