F472201

General Info

Members Datasets Scaffolds Average Seq Length
646 353 1292 345

Family's Representative Sequence

Representative Sequence 3300025254|Ga0209148_1001033|Ga0209148_100103321
Length 399
Sequence MCPAIHVYSWSIVPNINDRLSQKSNDTELNSRLFDRFRVLNSNEGDISVTILKRLLIGAASLGLATTIGLSAASAGDISGAGATFPFPVYSKWADAYKTQTGVGLNYQSIGSGGGIKQIKAKTVTFGASDMPLKPADLDAAGLVQWPMIMGGVVPSINLQGISAGQLTIDGPTLAKIYMGEVTKWNDESIQRLNPMVKLPDTAIAPVYRSDGSGTNFLFTNYLSSVSDDFKSKIGANTSVQWPAGIGAKGNEGVANMVKQTDGAIGYIEYAYVKQNKLTYLKLVNAAGKAVEPSAASFQAAASNADWKNAEGYYLVLTNQKGTESWPITGASFILMHKQVDDADAAKTALTFFDWAYKSGTDLAASLDYVPMPPEVVSMVEQTWAEKIADGSGNPVLKK

Samples

Sample ID Description Type Environment
1 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
238 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
325 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
326 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
334 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
335 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
336 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
337 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
338 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
339 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
340 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
341 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
342 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
343 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
344 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
345 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
346 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
347 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
348 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
349 2929520902 Variovorax beijingensis 502 Isolate Unclassified
350 2952252522 Salinicola sp. DM10 Isolate Unclassified
351 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
352 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
353 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 0
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.36
Nodule 1.08
Rhizoplane 3.72
Rhizosphere 79.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209148_1001033 3300025254 Bacteria 17411
2 JGI24739J22299_10001946 3300001989 Bacteria 7900
3 JGI24737J22298_10006052 3300001990 Bacteria 4149
4 JGI24737J22298_10019127 3300001990 Bacteria 2191
5 JGI24735J21928_10008194 3300002067 Bacteria 3390
6 JGI24735J21928_10012253 3300002067 Bacteria 2712
7 JGI24735J21928_10023634 3300002067 Bacteria 1863
8 JGI24738J21930_10001425 3300002075 Bacteria 6633
9 JGI24738J21930_10024014 3300002075 Bacteria 1255
10 JGI25157J39369_1007109 3300002741 Bacteria 1641
11 JGI25151J46595_10016465 3300003187 Bacteria 3232
12 JGI25165J46597_1000043 3300003214 Bacteria 264515
13 Ga0055525_1000011 3300003759 Bacteria 503124
14 Ga0055526_1002747 3300003771 Bacteria 11677
15 Ga0055526_1013470 3300003771 Bacteria 3455
16 Ga0055524_1010261 3300003775 Bacteria 3741
17 Ga0055524_1011094 3300003775 Bacteria 3542
18 Ga0055536_1000108 3300003781 Bacteria 73142
19 Ga0055534_1003353 3300003784 Bacteria 5068
20 Ga0055530_10000173 3300003791 Bacteria 58836
21 Ga0065165_1000238 3300005262 Bacteria 95406
22 Ga0070658_10004561 3300005327 Bacteria 11259
23 Ga0070658_10006478 3300005327 Bacteria 9486
24 Ga0070676_10001494 3300005328 Bacteria 11836
25 Ga0070683_100004025 3300005329 Bacteria 12031
26 Ga0070690_100305531 3300005330 Bacteria 1142
27 Ga0070670_100004276 3300005331 Bacteria 11950
28 Ga0070670_100128543 3300005331 Bacteria 2187
29 Ga0070670_100155600 3300005331 Bacteria 1979
30 Ga0070677_10058819 3300005333 Bacteria 1579
31 Ga0068869_100000027 3300005334 Bacteria 61660
32 Ga0068869_100370119 3300005334 Bacteria 1172
33 Ga0070666_10005332 3300005335 Bacteria 7882
34 Ga0068868_100001492 3300005338 Bacteria 16136
35 Ga0068868_100007661 3300005338 Bacteria 7702
36 Ga0068868_100013605 3300005338 Bacteria 5974
37 Ga0068868_100028612 3300005338 Bacteria 4263
38 Ga0068868_100151271 3300005338 Bacteria 1911
39 Ga0068868_100159805 3300005338 Bacteria 1860
40 Ga0070660_100001135 3300005339 Bacteria 17970
41 Ga0070660_100004021 3300005339 Bacteria 10150
42 Ga0070660_100054883 3300005339 Bacteria 3078
43 Ga0070689_100028921 3300005340 Bacteria 4191
44 Ga0070689_100044058 3300005340 Bacteria 3432
45 Ga0070661_100006628 3300005344 Bacteria 7988
46 Ga0070675_100003273 3300005354 Bacteria 12286
47 Ga0070675_100017311 3300005354 Bacteria 5725
48 Ga0070671_100002074 3300005355 Bacteria 15433
49 Ga0070671_100002161 3300005355 Bacteria 15167
50 Ga0070671_100002412 3300005355 Bacteria 14445
51 Ga0070671_100053201 3300005355 Bacteria 3366
52 Ga0070671_100243195 3300005355 Bacteria 1528
53 Ga0070671_100336295 3300005355 Bacteria 1287
54 Ga0070674_100018214 3300005356 Bacteria 4436
55 Ga0070674_100041085 3300005356 Bacteria 3132
56 Ga0070674_100044568 3300005356 Bacteria 3025
57 Ga0070673_100000006 3300005364 Bacteria 184299
58 Ga0070673_100006743 3300005364 Bacteria 7492
59 Ga0070659_100000916 3300005366 Bacteria 21579
60 Ga0070659_100012183 3300005366 Bacteria 6374
61 Ga0070667_100001034 3300005367 Bacteria 25405
62 Ga0070667_100190228 3300005367 Bacteria 1818
63 Ga0070709_10017438 3300005434 Bacteria 4119
64 Ga0070709_10037953 3300005434 Bacteria 2947
65 Ga0070714_100003291 3300005435 Bacteria 12042
66 Ga0070714_100270660 3300005435 Bacteria 1575
67 Ga0070713_100018594 3300005436 Bacteria 5282
68 Ga0070713_100028318 3300005436 Bacteria 4423
69 Ga0070710_10075922 3300005437 Bacteria 1949
70 Ga0070710_10163046 3300005437 Bacteria 1384
71 Ga0070711_100201384 3300005439 Bacteria 1536
72 Ga0070711_100279569 3300005439 Bacteria 1320
73 Ga0070700_100022676 3300005441 Bacteria 3666
74 Ga0070663_100002209 3300005455 Bacteria 10890
75 Ga0070678_100004129 3300005456 Bacteria 8183
76 Ga0070662_100034158 3300005457 Bacteria 3585
77 Ga0070681_10061085 3300005458 Bacteria 3745
78 Ga0068867_100000001 3300005459 Bacteria 427563
79 Ga0068867_100002638 3300005459 Bacteria 12648
80 Ga0068867_100013327 3300005459 Bacteria 5824
81 Ga0068867_100190308 3300005459 Bacteria 1637
82 Ga0070707_100022336 3300005468 Bacteria 5980
83 Ga0070707_100052277 3300005468 Bacteria 3917
84 Ga0070698_100007378 3300005471 Bacteria 11897
85 Ga0070699_100145502 3300005518 Bacteria 2094
86 Ga0070699_100217405 3300005518 Bacteria 1702
87 Ga0070679_100126232 3300005530 Bacteria 2541
88 Ga0070679_100396092 3300005530 Bacteria 1327
89 Ga0070684_100026663 3300005535 Bacteria 4870
90 Ga0070684_100338766 3300005535 Bacteria 1382
91 Ga0068853_100033653 3300005539 Bacteria 4348
92 Ga0068853_100087965 3300005539 Bacteria 2727
93 Ga0068853_100108606 3300005539 Bacteria 2462
94 Ga0070672_100002422 3300005543 Bacteria 11820
95 Ga0070672_100092636 3300005543 Bacteria 2440
96 Ga0070672_100285828 3300005543 Bacteria 1396
97 Ga0070695_100003973 3300005545 Bacteria 8637
98 Ga0070696_100109041 3300005546 Bacteria 1992
99 Ga0070665_100018843 3300005548 Bacteria 6919
100 Ga0070665_100030635 3300005548 Bacteria 5412
101 Ga0070665_100052411 3300005548 Bacteria 4092
102 Ga0070665_100175178 3300005548 Bacteria 2146
103 Ga0070704_100006609 3300005549 Bacteria 6844
104 Ga0070704_100058621 3300005549 Bacteria 2743
105 Ga0068855_100000024 3300005563 Bacteria 184241
106 Ga0068855_100000361 3300005563 Bacteria 56312
107 Ga0070664_100001995 3300005564 Bacteria 16367
108 Ga0070664_100002494 3300005564 Bacteria 14835
109 Ga0070664_100131079 3300005564 Bacteria 2202
110 Ga0068857_100279938 3300005577 Bacteria 1534
111 Ga0068857_100362824 3300005577 Bacteria 1343
112 Ga0068854_100000846 3300005578 Bacteria 18323
113 Ga0068854_100005028 3300005578 Bacteria 8335
114 Ga0068854_100019892 3300005578 Bacteria 4532
115 Ga0068854_100121490 3300005578 Bacteria 1983
116 Ga0068856_100062807 3300005614 Bacteria 3669
117 Ga0068856_100068067 3300005614 Bacteria 3519
118 Ga0068856_100097656 3300005614 Bacteria 2927
119 Ga0068852_100002615 3300005616 Bacteria 12439
120 Ga0068852_100002812 3300005616 Bacteria 12059
121 Ga0068852_100004961 3300005616 Bacteria 9457
122 Ga0068852_100035920 3300005616 Bacteria 4140
123 Ga0068852_100293714 3300005616 Bacteria 1571
124 Ga0068859_100000843 3300005617 Bacteria 31176
125 Ga0068859_100005465 3300005617 Bacteria 12929
126 Ga0068859_100030456 3300005617 Bacteria 5415
127 Ga0068859_100151797 3300005617 Bacteria 2392
128 Ga0068866_10006379 3300005718 Bacteria 4912
129 Ga0068851_10002171 3300005834 Bacteria 8625
130 Ga0068863_100001284 3300005841 Bacteria 25055
131 Ga0068863_100010255 3300005841 Bacteria 9107
132 Ga0068863_100142219 3300005841 Bacteria 2293
133 Ga0068858_100002531 3300005842 Bacteria 18418
134 Ga0068860_100000414 3300005843 Bacteria 55276
135 Ga0068860_100001786 3300005843 Bacteria 22899
136 Ga0068860_100004586 3300005843 Bacteria 14100
137 Ga0068860_100017414 3300005843 Bacteria 7000
138 Ga0068860_100031940 3300005843 Bacteria 5061
139 Ga0068862_100018264 3300005844 Bacteria 5839
140 Ga0068862_100148804 3300005844 Bacteria 2083
141 Ga0081540_1028407 3300005983 Bacteria 3142
142 Ga0070717_10000365 3300006028 Bacteria 29148
143 Ga0070717_10206516 3300006028 Bacteria 1722
144 Ga0070717_10219493 3300006028 Bacteria 1671
145 Ga0070712_100186090 3300006175 Bacteria 1622
146 Ga0097621_100002149 3300006237 Bacteria 13490
147 Ga0097621_100002536 3300006237 Bacteria 12512
148 Ga0075370_10004678 3300006353 Bacteria 6677
149 Ga0068871_100001773 3300006358 Bacteria 14526
150 Ga0068871_100003024 3300006358 Bacteria 11538
151 Ga0068871_100015672 3300006358 Bacteria 5683
152 Ga0068871_100247608 3300006358 Bacteria 1551
153 Ga0075428_100134111 3300006844 Bacteria 2693
154 Ga0075430_100027315 3300006846 Bacteria 4850
155 Ga0068865_100001619 3300006881 Bacteria 13199
156 Ga0068865_100022166 3300006881 Bacteria 4138
157 Ga0068865_100031838 3300006881 Bacteria 3519
158 Ga0097620_100000843 3300006931 Bacteria 31176
159 Ga0097620_100005465 3300006931 Bacteria 12929
160 Ga0097620_100030456 3300006931 Bacteria 5415
161 Ga0097620_100151801 3300006931 Bacteria 2392
162 Ga0099826_10000029 3300006948 Bacteria 128855
163 Ga0099795_10004771 3300007788 Bacteria 3534
164 Ga0099795_10021813 3300007788 Bacteria 2106
165 Ga0099795_10036961 3300007788 Bacteria 1716
166 Ga0105250_10112055 3300009092 Bacteria 1117
167 Ga0105240_10000132 3300009093 Bacteria 152512
168 Ga0105240_10034451 3300009093 Bacteria 6531
169 Ga0105245_10000933 3300009098 Bacteria 26566
170 Ga0105245_10039623 3300009098 Bacteria 4194
171 Ga0105245_10053839 3300009098 Bacteria 3613
172 Ga0105247_10000212 3300009101 Bacteria 56393
173 Ga0105247_10035344 3300009101 Bacteria 3046
174 Ga0114129_10002612 3300009147 Bacteria 25061
175 Ga0105243_10002887 3300009148 Bacteria 14241
176 Ga0105241_10020576 3300009174 Bacteria 4877
177 Ga0105242_10002003 3300009176 Bacteria 16046
178 Ga0105248_10012561 3300009177 Bacteria 9341
179 Ga0105248_10154407 3300009177 Bacteria 2590
180 Ga0105237_10039188 3300009545 Bacteria 4783
181 Ga0105238_10032211 3300009551 Bacteria 5334
182 Ga0105238_10035377 3300009551 Bacteria 5079
183 Ga0105238_10333196 3300009551 Bacteria 1505
184 Ga0105238_10349760 3300009551 Bacteria 1467
185 Ga0105238_10436970 3300009551 Bacteria 1305
186 Ga0105249_10143503 3300009553 Bacteria 2292
187 Ga0105249_10341709 3300009553 Bacteria 1514
188 Ga0105239_10002163 3300010375 Bacteria 25281
189 Ga0105239_10069223 3300010375 Bacteria 3878
190 Ga0105239_10211827 3300010375 Bacteria 2172
191 Ga0105239_10362018 3300010375 Bacteria 1638
192 Ga0105239_10379817 3300010375 Bacteria 1597
193 Ga0105246_10000769 3300011119 Bacteria 18257
194 Ga0105246_10012106 3300011119 Bacteria 5375
195 Ga0157373_10008357 3300013100 Bacteria 7691
196 Ga0157371_10078164 3300013102 Bacteria 2343
197 Ga0157370_10000181 3300013104 Bacteria 79297
198 Ga0157369_10037108 3300013105 Bacteria 5338
199 Ga0157369_10070632 3300013105 Bacteria 3751
200 Ga0157374_10002806 3300013296 Bacteria 14623
201 Ga0157374_10003474 3300013296 Bacteria 13241
202 Ga0157374_10010989 3300013296 Bacteria 7817
203 Ga0157374_10012920 3300013296 Bacteria 7275
204 Ga0157378_10035977 3300013297 Bacteria 4382
205 Ga0157378_10036237 3300013297 Bacteria 4366
206 Ga0157378_10048581 3300013297 Bacteria 3773
207 Ga0163162_10000654 3300013306 Bacteria 32058
208 Ga0163162_10021268 3300013306 Bacteria 6385
209 Ga0163162_10041835 3300013306 Bacteria 4585
210 Ga0157372_10041646 3300013307 Bacteria 5078
211 Ga0157372_10344701 3300013307 Bacteria 1736
212 Ga0157375_10000438 3300013308 Bacteria 37712
213 Ga0157375_10008146 3300013308 Bacteria 9169
214 Ga0157375_10013505 3300013308 Bacteria 7271
215 Ga0157375_10030878 3300013308 Bacteria 5057
216 Ga0157375_10103161 3300013308 Bacteria 2939
217 Ga0163163_10064401 3300014325 Bacteria 3637
218 Ga0163163_10122001 3300014325 Bacteria 2640
219 Ga0163163_10548108 3300014325 Bacteria 1219
220 Ga0182008_10000195 3300014497 Bacteria 47786
221 Ga0157379_10015624 3300014968 Bacteria 6667
222 Ga0157379_10017732 3300014968 Bacteria 6273
223 Ga0157376_10000144 3300014969 Bacteria 49033
224 Ga0157376_10085678 3300014969 Bacteria 2715
225 Ga0157376_10411235 3300014969 Bacteria 1310
226 Ga0213872_10000180 3300021361 Bacteria 56592
227 Ga0213872_10001658 3300021361 Bacteria 14030
228 Ga0213872_10004909 3300021361 Bacteria 6965
229 Ga0213876_10086681 3300021384 Bacteria 1657
230 Ga0213876_10180872 3300021384 Bacteria 1121
231 Ga0213875_10000091 3300021388 Bacteria 104903
232 Ga0213875_10006991 3300021388 Bacteria 5874
233 Ga0207427_102456 3300025231 Bacteria 4975
234 Ga0209026_1002178 3300025250 Bacteria 7601
235 Ga0209026_1003486 3300025250 Bacteria 5122
236 Ga0209148_1000117 3300025254 Bacteria 188938
237 Ga0209233_1000079 3300025261 Bacteria 346944
238 Ga0209565_1000252 3300025263 Bacteria 56727
239 Ga0209455_1000721 3300025272 Bacteria 19164
240 Ga0209673_1016627 3300025273 Bacteria 2741
241 Ga0209130_1018481 3300025284 Bacteria 1635
242 Ga0209675_1000229 3300025291 Bacteria 56831
243 Ga0209675_1000667 3300025291 Bacteria 24113
244 Ga0209675_1003353 3300025291 Bacteria 7668
245 Ga0209676_1000012 3300025292 Bacteria 841431
246 Ga0209025_1000214 3300025294 Bacteria 138780
247 Ga0209025_1000600 3300025294 Bacteria 64945
248 Ga0209025_1000963 3300025294 Bacteria 43359
249 Ga0209025_1001025 3300025294 Bacteria 41120
250 Ga0209025_1015461 3300025294 Bacteria 4600
251 Ga0209564_1002859 3300025295 Bacteria 12685
252 Ga0209564_1006430 3300025295 Bacteria 6338
253 Ga0209758_1000670 3300025297 Bacteria 51248
254 Ga0209758_1002660 3300025297 Bacteria 17682
255 Ga0209050_1000031 3300025298 Bacteria 458181
256 Ga0209256_1001006 3300025299 Bacteria 33408
257 Ga0209256_1002106 3300025299 Bacteria 17330
258 Ga0209051_1010096 3300025303 Bacteria 4803
259 Ga0209257_1000489 3300025304 Bacteria 71195
260 Ga0209257_1003682 3300025304 Bacteria 12792
261 Ga0207656_10000502 3300025321 Bacteria 12890
262 Ga0207696_1000650 3300025711 Bacteria 25058
263 Ga0207692_10092399 3300025898 Bacteria 1644
264 Ga0207642_10005130 3300025899 Bacteria 4262
265 Ga0207642_10021361 3300025899 Bacteria 2547
266 Ga0207710_10000254 3300025900 Bacteria 44382
267 Ga0207680_10014062 3300025903 Bacteria 4128
268 Ga0207647_10001957 3300025904 Bacteria 15733
269 Ga0207647_10027768 3300025904 Bacteria 3686
270 Ga0207699_10029287 3300025906 Bacteria 3069
271 Ga0207699_10111473 3300025906 Bacteria 1754
272 Ga0207645_10001415 3300025907 Bacteria 19666
273 Ga0207705_10000076 3300025909 Bacteria 122975
274 Ga0207705_10000318 3300025909 Bacteria 43984
275 Ga0207707_10003643 3300025912 Bacteria 13664
276 Ga0207707_10023342 3300025912 Bacteria 5411
277 Ga0207707_10033187 3300025912 Bacteria 4518
278 Ga0207707_10219063 3300025912 Bacteria 1657
279 Ga0207695_10000003 3300025913 Bacteria 1368691
280 Ga0207695_10022627 3300025913 Bacteria 7127
281 Ga0207671_10254512 3300025914 Bacteria 1381
282 Ga0207693_10001359 3300025915 Bacteria 21653
283 Ga0207693_10013634 3300025915 Bacteria 6550
284 Ga0207693_10024551 3300025915 Bacteria 4781
285 Ga0207663_10131399 3300025916 Bacteria 1730
286 Ga0207660_10111433 3300025917 Bacteria 2060
287 Ga0207657_10009342 3300025919 Bacteria 9869
288 Ga0207657_10058460 3300025919 Bacteria 3318
289 Ga0207649_10173597 3300025920 Bacteria 1503
290 Ga0207652_10083796 3300025921 Bacteria 2792
291 Ga0207652_10292008 3300025921 Bacteria 1471
292 Ga0207646_10024490 3300025922 Bacteria 5529
293 Ga0207646_10032512 3300025922 Bacteria 4722
294 Ga0207694_10000016 3300025924 Bacteria 349087
295 Ga0207694_10299407 3300025924 Bacteria 1324
296 Ga0207650_10146676 3300025925 Bacteria 1859
297 Ga0207659_10037745 3300025926 Bacteria 3356
298 Ga0207687_10020363 3300025927 Bacteria 4399
299 Ga0207687_10068778 3300025927 Bacteria 2523
300 Ga0207700_10147070 3300025928 Bacteria 1943
301 Ga0207664_10096694 3300025929 Bacteria 2431
302 Ga0207664_10111597 3300025929 Bacteria 2275
303 Ga0207644_10002165 3300025931 Bacteria 12741
304 Ga0207644_10003390 3300025931 Bacteria 10281
305 Ga0207644_10006912 3300025931 Bacteria 7391
306 Ga0207644_10029905 3300025931 Bacteria 3782
307 Ga0207644_10100855 3300025931 Bacteria 2168
308 Ga0207690_10000196 3300025932 Bacteria 47111
309 Ga0207706_10023120 3300025933 Bacteria 5583
310 Ga0207686_10001088 3300025934 Bacteria 15923
311 Ga0207686_10093090 3300025934 Bacteria 1995
312 Ga0207709_10000569 3300025935 Bacteria 31183
313 Ga0207669_10015285 3300025937 Bacteria 3868
314 Ga0207669_10184765 3300025937 Bacteria 1498
315 Ga0207704_10000001 3300025938 Bacteria 716296
316 Ga0207704_10054983 3300025938 Bacteria 2430
317 Ga0207691_10003180 3300025940 Bacteria 16050
318 Ga0207691_10250448 3300025940 Bacteria 1529
319 Ga0207711_10021251 3300025941 Bacteria 5421
320 Ga0207711_10086146 3300025941 Bacteria 2754
321 Ga0207689_10000154 3300025942 Bacteria 59594
322 Ga0207661_10134604 3300025944 Bacteria 2121
323 Ga0207679_10007201 3300025945 Bacteria 7046
324 Ga0207679_10011695 3300025945 Bacteria 5697
325 Ga0207679_10108840 3300025945 Bacteria 2183
326 Ga0207667_10000021 3300025949 Bacteria 370524
327 Ga0207667_10000391 3300025949 Bacteria 59208
328 Ga0207651_10000002 3300025960 Bacteria 427663
329 Ga0207651_10004096 3300025960 Bacteria 7274
330 Ga0207712_10032085 3300025961 Bacteria 3543
331 Ga0207712_10145830 3300025961 Bacteria 1822
332 Ga0207640_10000063 3300025981 Bacteria 87065
333 Ga0207640_10104924 3300025981 Bacteria 1990
334 Ga0207640_10152616 3300025981 Bacteria 1699
335 Ga0207658_10007374 3300025986 Bacteria 7498
336 Ga0207658_10086446 3300025986 Bacteria 2418
337 Ga0207658_10258147 3300025986 Bacteria 1484
338 Ga0207677_10000190 3300026023 Bacteria 49575
339 Ga0207677_10005649 3300026023 Bacteria 6802
340 Ga0207677_10043664 3300026023 Bacteria 2982
341 Ga0207703_10000183 3300026035 Bacteria 73109
342 Ga0207703_10003754 3300026035 Bacteria 12643
343 Ga0207639_10037315 3300026041 Bacteria 3609
344 Ga0207639_10093271 3300026041 Bacteria 2414
345 Ga0207678_10003591 3300026067 Bacteria 13939
346 Ga0207678_10037803 3300026067 Bacteria 4198
347 Ga0207678_10238335 3300026067 Bacteria 1558
348 Ga0207678_10247228 3300026067 Bacteria 1527
349 Ga0207708_10025002 3300026075 Bacteria 4517
350 Ga0207702_10030102 3300026078 Bacteria 4522
351 Ga0207702_10128868 3300026078 Bacteria 2275
352 Ga0207641_10003340 3300026088 Bacteria 14261
353 Ga0207641_10049927 3300026088 Bacteria 3537
354 Ga0207641_10210119 3300026088 Bacteria 1799
355 Ga0207641_10218521 3300026088 Bacteria 1766
356 Ga0207648_10000001 3300026089 Bacteria 427499
357 Ga0207648_10002889 3300026089 Bacteria 18185
358 Ga0207648_10012268 3300026089 Bacteria 8021
359 Ga0207648_10083282 3300026089 Bacteria 2790
360 Ga0207676_10044471 3300026095 Bacteria 3426
361 Ga0207674_10345727 3300026116 Bacteria 1438
362 Ga0207683_10015496 3300026121 Bacteria 6490
363 Ga0207683_10023931 3300026121 Bacteria 5255
364 Ga0207683_10392970 3300026121 Bacteria 1275
365 Ga0207698_10001101 3300026142 Bacteria 15747
366 Ga0207698_10002042 3300026142 Bacteria 11909
367 Ga0207698_10041520 3300026142 Bacteria 3428
368 Ga0209179_1000212 3300027512 Bacteria 5434
369 Ga0209282_1000045 3300027666 Bacteria 118401
370 Ga0268266_10003994 3300028379 Bacteria 14291
371 Ga0268266_10059835 3300028379 Bacteria 3282
372 Ga0268266_10125953 3300028379 Bacteria 2286
373 Ga0268265_10008728 3300028380 Bacteria 6853
374 Ga0268265_10033470 3300028380 Bacteria 3737
375 Ga0268264_10000057 3300028381 Bacteria 309824
376 Ga0268264_10000494 3300028381 Bacteria 51670
377 Ga0268264_10007801 3300028381 Bacteria 8910
378 Ga0268264_10010977 3300028381 Bacteria 7480
379 Ga0265334_10000283 3300028573 Bacteria 28659
380 Ga0265318_10003208 3300028577 Bacteria 8344
381 Ga0307517_10071309 3300028786 Bacteria 3116
382 Ga0307515_10053261 3300028794 Bacteria 5976
383 Ga0265338_10026969 3300028800 Bacteria 5778
384 Ga0265338_10069066 3300028800 Bacteria 3039
385 Ga0307511_10000342 3300030521 Bacteria 49561
386 Ga0265330_10075110 3300031235 Bacteria 1460
387 Ga0265328_10000005 3300031239 Bacteria 230229
388 Ga0265328_10034368 3300031239 Bacteria 1877
389 Ga0265320_10064125 3300031240 Bacteria 1746
390 Ga0265325_10019725 3300031241 Bacteria 3724
391 Ga0265340_10004746 3300031247 Bacteria 7557
392 Ga0265340_10016953 3300031247 Bacteria 3768
393 Ga0265340_10034050 3300031247 Bacteria 2534
394 Ga0265331_10008472 3300031250 Bacteria 5845
395 Ga0265331_10029696 3300031250 Bacteria 2726
396 Ga0265327_10001684 3300031251 Bacteria 26440
397 Ga0265327_10031145 3300031251 Bacteria 3002
398 Ga0265327_10044612 3300031251 Bacteria 2362
399 Ga0265316_10066208 3300031344 Bacteria 2797
400 Ga0265316_10068581 3300031344 Bacteria 2739
401 Ga0307509_10000013 3300031507 Bacteria 283027
402 Ga0265314_10001425 3300031711 Bacteria 26784
403 Ga0265314_10063179 3300031711 Bacteria 2513
404 Ga0265342_10007015 3300031712 Bacteria 8317
405 Ga0307516_10011630 3300031730 Bacteria 9550
406 Ga0307413_10111969 3300031824 Bacteria 1829
407 Ga0307414_10064347 3300032004 Bacteria 2611
408 Ga0307510_10000014 3300033180 Bacteria 271607
409 Ga0307510_10018623 3300033180 Bacteria 8166
410 Ga0373934_0000072 3300035086 Bacteria 34972
411 Ga0373934_0005302 3300035086 Bacteria 4768
412 Ga0373944_0024108 3300035089 Bacteria 1780
413 Ga0373923_0000974 3300035111 Bacteria 7701
414 Ga0373936_0001443 3300035113 Bacteria 8631
415 Ga0373945_0090056 3300035116 Bacteria 1187
416 Ga0373953_0002533 3300035117 Bacteria 5520
417 Ga0373954_0000630 3300035118 Bacteria 13476
418 Ga0373954_0003849 3300035118 Bacteria 6421
419 Ga0373954_0028113 3300035118 Bacteria 2583
420 Ga0373956_0000032 3300035119 Bacteria 44749
421 Ga0373957_0007034 3300035120 Bacteria 3579
422 Ga0373955_0001080 3300035172 Bacteria 11591
423 Ga0373955_0022631 3300035172 Bacteria 3190
424 Ga0373924_0015524 3300035410 Bacteria 2897
425 Ga0373935_0008847 3300035692 Bacteria 6025
426 Ga0373927_0001927 3300035695 Bacteria 15327
427 Ga0373927_0038274 3300035695 Bacteria 3114
428 Ga0373933_0000493 3300035724 Bacteria 24615
429 Ga0373933_0002186 3300035724 Bacteria 11195
430 Ga0373933_0007508 3300035724 Bacteria 5954
431 Ga0373933_0068164 3300035724 Bacteria 2160
432 Ga0373937_0000974 3300036401 Bacteria 24291
433 Ga0373937_0005704 3300036401 Bacteria 10689
434 Ga0373937_0016485 3300036401 Bacteria 6564
435 Ga0373937_0059611 3300036401 Bacteria 3508
436 Ga0373937_0061080 3300036401 Bacteria 3464
437 Ga0373937_0066901 3300036401 Bacteria 3310
438 Ga0373937_0165017 3300036401 Bacteria 2077
439 Ga0373925_0001600 3300037068 Bacteria 19119
440 Ga0373925_0005929 3300037068 Bacteria 9056
441 Ga0373925_0156770 3300037068 Bacteria 1791
442 Ga0395900_0066820 3300037418 Bacteria 3695
443 Ga0395900_0071230 3300037418 Bacteria 3573
444 Ga0395900_0144179 3300037418 Bacteria 2437
445 Ga0395900_0232120 3300037418 Bacteria 1855
446 Ga0395905_0000222 3300037471 Bacteria 86759
447 Ga0395905_0001348 3300037471 Bacteria 29903
448 Ga0395905_0010524 3300037471 Bacteria 8986
449 Ga0395905_0019680 3300037471 Bacteria 6397
450 Ga0395905_0062266 3300037471 Bacteria 3490
451 Ga0395905_0396763 3300037471 Bacteria 1274
452 Ga0436364_0004186 3300037853 Bacteria 33279
453 Ga0436364_0542842 3300037853 Bacteria 26703
454 Ga0395901_0068345 3300038443 Bacteria 3701
455 Ga0395901_0248877 3300038443 Bacteria 1852
456 Ga0436365_0475879 3300039437 Bacteria 3568
457 Ga0436365_0974800 3300039437 Bacteria 3212
458 Ga0436365_1137141 3300039437 Bacteria 1658
459 Ga0436360_0674475 3300039438 Bacteria 19139
460 Ga0436361_0061503 3300039447 Bacteria 127805
461 Ga0436361_0073578 3300039447 Bacteria 9025
462 Ga0436361_0891393 3300039447 Bacteria 99242
463 Ga0436361_0985091 3300039447 Bacteria 1458
464 Ga0436363_1276848 3300039450 Bacteria 13012
465 Ga0436362_1048788 3300039453 Bacteria 1125
466 Ga0436362_1101836 3300039453 Bacteria 1527
467 Ga0439436_0008052 3300041404 Bacteria 3238
468 Ga0451853_4029564 3300041512 Bacteria 3598
469 Ga0439448_0003179 3300042005 Bacteria 4531
470 Ga0439455_0003399 3300042012 Bacteria 3035
471 Ga0450923_015751 3300042125 Bacteria 1418
472 Ga0439458_0000202 3300042157 Bacteria 13755
473 Ga0439458_0000718 3300042157 Bacteria 8559
474 Ga0466969_0000834 3300044656 Bacteria 16754
475 Ga0466972_0004441 3300044658 Bacteria 7018
476 Ga0466972_0036149 3300044658 Bacteria 2417
477 Ga0466972_0040330 3300044658 Bacteria 2275
478 Ga0466972_0059322 3300044658 Bacteria 1837
479 Ga0453683_0015347 3300044673 Bacteria 4962
480 Ga0466965_0001091 3300044683 Bacteria 10558
481 Ga0466966_0000445 3300044684 Bacteria 26600
482 Ga0466961_0025802 3300044693 Bacteria 3777
483 Ga0466961_0033290 3300044693 Bacteria 3312
484 Ga0466964_0000891 3300044706 Bacteria 9787
485 Ga0466964_0008011 3300044706 Bacteria 3958
486 Ga0466971_0000422 3300044719 Bacteria 16550
487 Ga0466971_0040755 3300044719 Bacteria 2086
488 Ga0466971_0133475 3300044719 Bacteria 1154
489 Ga0466968_0007304 3300044735 Bacteria 4197
490 Ga0466968_0022126 3300044735 Bacteria 2582
491 Ga0466970_0021721 3300044765 Bacteria 3345
492 Ga0466957_0008510 3300044842 Bacteria 5838
493 Ga0466957_0063460 3300044842 Bacteria 2271
494 Ga0466957_0067953 3300044842 Bacteria 2199
495 Ga0466959_0001608 3300045049 Bacteria 13911
496 Ga0451576_0078476 3300045051 Bacteria 3436
497 Ga0451576_0100998 3300045051 Bacteria 3000
498 Ga0466967_0379480 3300045976 Bacteria 1372
499 Ga0495592_0001874 3300046454 Bacteria 14796
500 Ga0495592_0033706 3300046454 Bacteria 3862
501 Ga0495592_0045919 3300046454 Bacteria 3257
502 Ga0495638_0064924 3300046460 Bacteria 2248
503 Ga0495651_0001383 3300046462 Bacteria 18832
504 Ga0495653_0015230 3300046463 Bacteria 6266
505 Ga0495580_0008358 3300046472 Bacteria 8233
506 Ga0495662_0017917 3300046476 Bacteria 3427
507 Ga0495662_0026238 3300046476 Bacteria 2814
508 Ga0495664_0010391 3300046477 Bacteria 5220
509 Ga0495664_0039875 3300046477 Bacteria 2775
510 Ga0495585_0118102 3300046492 Bacteria 1405
511 Ga0495596_0001569 3300046500 Bacteria 13023
512 Ga0495608_0018959 3300046511 Bacteria 4741
513 Ga0495610_0006802 3300046512 Bacteria 7759
514 Ga0495618_0041744 3300046514 Bacteria 2890
515 Ga0495618_0043216 3300046514 Bacteria 2843
516 Ga0495628_0001460 3300046516 Bacteria 21680
517 Ga0495628_0022275 3300046516 Bacteria 5205
518 Ga0495628_0097774 3300046516 Bacteria 2267
519 Ga0495630_0001826 3300046517 Bacteria 14854
520 Ga0495666_0027981 3300046526 Bacteria 2774
521 Ga0495652_0039742 3300046529 Bacteria 4067
522 Ga0495665_0027777 3300046531 Bacteria 3037
523 Ga0495640_0036375 3300046533 Bacteria 3478
524 Ga0495640_0054486 3300046533 Bacteria 2739
525 Ga0495586_0022586 3300046535 Bacteria 3358
526 Ga0495645_0000924 3300046543 Bacteria 19978
527 Ga0495667_0002059 3300046559 Bacteria 13347
528 Ga0495667_0016541 3300046559 Bacteria 4982
529 Ga0495668_0098808 3300046616 Bacteria 1597
530 Ga0495635_0020633 3300046663 Bacteria 4589
531 Ga0495635_0055523 3300046663 Bacteria 2728
532 Ga0495657_0061473 3300046675 Bacteria 2484
533 Ga0495599_0033120 3300046678 Bacteria 3246
534 Ga0495599_0044625 3300046678 Bacteria 2780
535 Ga0495599_0050464 3300046678 Bacteria 2607
536 Ga0495647_0001692 3300046681 Bacteria 6831
537 Ga0495647_0005350 3300046681 Bacteria 4205
538 Ga0495658_0004078 3300046683 Bacteria 7195
539 Ga0495600_0004697 3300046809 Bacteria 8193
540 Ga0495600_0015414 3300046809 Bacteria 4832
541 Ga0495604_0027136 3300047317 Bacteria 4556
542 Ga0495674_0023648 3300047319 Bacteria 5658
543 Ga0495680_0004554 3300047322 Bacteria 13243
544 Ga0495680_0021037 3300047322 Bacteria 5467
545 Ga0495680_0049350 3300047322 Bacteria 3296
546 Ga0495680_0160626 3300047322 Bacteria 1632
547 Ga0495687_028093 3300047443 Bacteria 2621
548 Ga0495675_0000830 3300047444 Bacteria 18920
549 Ga0495684_0012592 3300047471 Bacteria 6522
550 Ga0496101_0187483 3300048904 Bacteria 1595
551 Ga0496102_0005483 3300048905 Bacteria 10766
552 Ga0496102_0078276 3300048905 Bacteria 3043
553 Ga0496102_0119183 3300048905 Bacteria 2464
554 Ga0496103_0113604 3300048906 Bacteria 1721
555 Ga0496104_0045626 3300048907 Bacteria 4123
556 Ga0496104_0180820 3300048907 Bacteria 2019
557 Ga0496105_0092966 3300048908 Bacteria 2490
558 Ga0496109_0013545 3300048912 Bacteria 7080
559 Ga0496109_0025808 3300048912 Bacteria 5237
560 Ga0496109_0074008 3300048912 Bacteria 3131
561 Ga0496110_0020532 3300048913 Bacteria 5578
562 Ga0496110_0040229 3300048913 Bacteria 4074
563 Ga0496110_0213866 3300048913 Bacteria 1753
564 Ga0496110_0386373 3300048913 Bacteria 1276
565 Ga0496111_0226525 3300048914 Bacteria 1388
566 Ga0496112_0074762 3300048915 Bacteria 3351
567 Ga0496113_0199604 3300048916 Bacteria 1590
568 Ga0496114_0033416 3300048917 Bacteria 4238
569 Ga0496114_0176977 3300048917 Bacteria 1862
570 Ga0496114_0259962 3300048917 Bacteria 1528
571 Ga0496115_0020861 3300048918 Bacteria 5057
572 Ga0496115_0052221 3300048918 Bacteria 3279
573 Ga0496115_0089520 3300048918 Bacteria 2514
574 Ga0496117_0000156 3300048920 Bacteria 145285
575 Ga0496117_0033743 3300048920 Bacteria 3865
576 Ga0496118_0000005 3300048921 Bacteria 697350
577 Ga0496118_0042571 3300048921 Bacteria 3581
578 Ga0496119_0025756 3300048922 Bacteria 4100
579 Ga0496120_0002083 3300048923 Bacteria 21439
580 Ga0496121_0000371 3300048924 Bacteria 92354
581 Ga0496121_0058221 3300048924 Bacteria 3196
582 Ga0496121_0061757 3300048924 Bacteria 3073
583 Ga0496121_0076769 3300048924 Bacteria 2663
584 Ga0496123_0008833 3300048926 Bacteria 9182
585 Ga0496124_0085282 3300048927 Bacteria 2588
586 Ga0496124_0092711 3300048927 Bacteria 2460
587 Ga0496125_0000918 3300048928 Bacteria 46373
588 Ga0496125_0003733 3300048928 Bacteria 18142
589 Ga0496126_0026348 3300048929 Bacteria 5576
590 Ga0495682_0001030 3300049460 Bacteria 16454
591 Ga0501034_0000781 3300049571 Bacteria 47646
592 Ga0501067_0007408 3300049583 Bacteria 6097
593 Ga0501076_0025558 3300049592 Bacteria 4571
594 Ga0501077_0121969 3300049593 Bacteria 1652
595 Ga0501080_0047888 3300049742 Bacteria 3980
596 Ga0501080_0111828 3300049742 Bacteria 2532
597 Ga0501265_002810 3300049762 Bacteria 1976
598 Ga0501035_0156549 3300049822 Bacteria 1975
599 Ga0501044_0350711 3300049823 Bacteria 1395
600 nmdc:mga05p37_6511_c1 3300050507 Bacteria 13777
601 Ga0495601_0004508 3300053077 Bacteria 8052
602 Ga0495601_0008885 3300053077 Bacteria 5929
603 Ga0495601_0011591 3300053077 Bacteria 5282
604 Ga0500635_0000159 3300053080 Bacteria 36552
605 Ga0495595_0003382 3300053084 Bacteria 6336
606 Ga0495595_0026253 3300053084 Bacteria 2587
607 Ga0495595_0030023 3300053084 Bacteria 2436
608 Ga0495619_0015630 3300053085 Bacteria 4803
609 Ga0495619_0044754 3300053085 Bacteria 2906
610 Ga0495619_0074142 3300053085 Bacteria 2281
611 Ga0500643_001391 3300053087 Bacteria 14001
612 Ga0500566_0022992 3300053094 Bacteria 3661
613 Ga0500591_031057 3300053115 Bacteria 2576
614 Ga0500607_080275 3300053121 Bacteria 1665
615 Ga0500614_010530 3300053123 Bacteria 1987
616 Ga0500559_0011465 3300053136 Bacteria 3785
617 Ga0500559_0050120 3300053136 Bacteria 1841
618 Ga0500616_0119199 3300053153 Bacteria 1263
619 Ga0500624_000016 3300053157 Bacteria 134804
620 Ga0500636_0028398 3300053177 Bacteria 3304
621 Ga0500637_0000007 3300053178 Bacteria 93788
622 Ga0500637_0000318 3300053178 Bacteria 18049
623 Ga0500637_0037458 3300053178 Bacteria 2727
624 Ga0500637_0093283 3300053178 Bacteria 1744
625 Ga0466962_0000274 3300061719 Bacteria 21720
626 2512035544 2511231221 Bacteria 6846400
627 2513956410 2513237150 Bacteria 6553639
628 2514041510 2513237165 Bacteria 6771773
629 2821449102 2821443989 Bacteria 7658172
630 2834645032 2834641062 Bacteria 5559922
631 2842333579 2842333319 Bacteria 8899485
632 2843694623 2843690924 Bacteria 5169057
633 2846035051 2846033681 Bacteria 4377894
634 2846040730 2846037992 Bacteria 4526407
635 2858695230 2858688981 Bacteria 8184122
636 2889018917 2889016732 Bacteria 6700763
637 2901304680 2901300506 Bacteria 8463898
638 2904543568 2904541872 Bacteria 8915136
639 2919142639 2919138771 Bacteria 5281312
640 2928117477 2928115317 Bacteria 6477646
641 2929162897 2929160207 Bacteria 9075316
642 2929527295 2929520902 Bacteria 6765052
643 2952254873 2952252522 Bacteria 4171745
644 644748290 644736347 Bacteria 6476522
645 8003401418 8003400568 Bacteria 5535898
646 8054007661 8054002106 Bacteria 7987183
647 Ga0209148_1001033
648 JGI24739J22299_10001946
649 JGI24737J22298_10006052
650 JGI24737J22298_10019127
651 JGI24735J21928_10008194
652 JGI24735J21928_10012253
653 JGI24735J21928_10023634
654 JGI24738J21930_10001425
655 JGI24738J21930_10024014
656 JGI25157J39369_1007109
657 JGI25151J46595_10016465
658 JGI25165J46597_1000043
659 Ga0055525_1000011
660 Ga0055526_1002747
661 Ga0055526_1013470
662 Ga0055524_1010261
663 Ga0055524_1011094
664 Ga0055536_1000108
665 Ga0055534_1003353
666 Ga0055530_10000173
667 Ga0065165_1000238
668 Ga0070658_10004561
669 Ga0070658_10006478
670 Ga0070676_10001494
671 Ga0070683_100004025
672 Ga0070690_100305531
673 Ga0070670_100004276
674 Ga0070670_100128543
675 Ga0070670_100155600
676 Ga0070677_10058819
677 Ga0068869_100000027
678 Ga0068869_100370119
679 Ga0070666_10005332
680 Ga0068868_100001492
681 Ga0068868_100007661
682 Ga0068868_100013605
683 Ga0068868_100028612
684 Ga0068868_100151271
685 Ga0068868_100159805
686 Ga0070660_100001135
687 Ga0070660_100004021
688 Ga0070660_100054883
689 Ga0070689_100028921
690 Ga0070689_100044058
691 Ga0070661_100006628
692 Ga0070675_100003273
693 Ga0070675_100017311
694 Ga0070671_100002074
695 Ga0070671_100002161
696 Ga0070671_100002412
697 Ga0070671_100053201
698 Ga0070671_100243195
699 Ga0070671_100336295
700 Ga0070674_100018214
701 Ga0070674_100041085
702 Ga0070674_100044568
703 Ga0070673_100000006
704 Ga0070673_100006743
705 Ga0070659_100000916
706 Ga0070659_100012183
707 Ga0070667_100001034
708 Ga0070667_100190228
709 Ga0070709_10017438
710 Ga0070709_10037953
711 Ga0070714_100003291
712 Ga0070714_100270660
713 Ga0070713_100018594
714 Ga0070713_100028318
715 Ga0070710_10075922
716 Ga0070710_10163046
717 Ga0070711_100201384
718 Ga0070711_100279569
719 Ga0070700_100022676
720 Ga0070663_100002209
721 Ga0070678_100004129
722 Ga0070662_100034158
723 Ga0070681_10061085
724 Ga0068867_100000001
725 Ga0068867_100002638
726 Ga0068867_100013327
727 Ga0068867_100190308
728 Ga0070707_100022336
729 Ga0070707_100052277
730 Ga0070698_100007378
731 Ga0070699_100145502
732 Ga0070699_100217405
733 Ga0070679_100126232
734 Ga0070679_100396092
735 Ga0070684_100026663
736 Ga0070684_100338766
737 Ga0068853_100033653
738 Ga0068853_100087965
739 Ga0068853_100108606
740 Ga0070672_100002422
741 Ga0070672_100092636
742 Ga0070672_100285828
743 Ga0070695_100003973
744 Ga0070696_100109041
745 Ga0070665_100018843
746 Ga0070665_100030635
747 Ga0070665_100052411
748 Ga0070665_100175178
749 Ga0070704_100006609
750 Ga0070704_100058621
751 Ga0068855_100000024
752 Ga0068855_100000361
753 Ga0070664_100001995
754 Ga0070664_100002494
755 Ga0070664_100131079
756 Ga0068857_100279938
757 Ga0068857_100362824
758 Ga0068854_100000846
759 Ga0068854_100005028
760 Ga0068854_100019892
761 Ga0068854_100121490
762 Ga0068856_100062807
763 Ga0068856_100068067
764 Ga0068856_100097656
765 Ga0068852_100002615
766 Ga0068852_100002812
767 Ga0068852_100004961
768 Ga0068852_100035920
769 Ga0068852_100293714
770 Ga0068859_100000843
771 Ga0068859_100005465
772 Ga0068859_100030456
773 Ga0068859_100151797
774 Ga0068866_10006379
775 Ga0068851_10002171
776 Ga0068863_100001284
777 Ga0068863_100010255
778 Ga0068863_100142219
779 Ga0068858_100002531
780 Ga0068860_100000414
781 Ga0068860_100001786
782 Ga0068860_100004586
783 Ga0068860_100017414
784 Ga0068860_100031940
785 Ga0068862_100018264
786 Ga0068862_100148804
787 Ga0081540_1028407
788 Ga0070717_10000365
789 Ga0070717_10206516
790 Ga0070717_10219493
791 Ga0070712_100186090
792 Ga0097621_100002149
793 Ga0097621_100002536
794 Ga0075370_10004678
795 Ga0068871_100001773
796 Ga0068871_100003024
797 Ga0068871_100015672
798 Ga0068871_100247608
799 Ga0075428_100134111
800 Ga0075430_100027315
801 Ga0068865_100001619
802 Ga0068865_100022166
803 Ga0068865_100031838
804 Ga0097620_100000843
805 Ga0097620_100005465
806 Ga0097620_100030456
807 Ga0097620_100151801
808 Ga0099826_10000029
809 Ga0099795_10004771
810 Ga0099795_10021813
811 Ga0099795_10036961
812 Ga0105250_10112055
813 Ga0105240_10000132
814 Ga0105240_10034451
815 Ga0105245_10000933
816 Ga0105245_10039623
817 Ga0105245_10053839
818 Ga0105247_10000212
819 Ga0105247_10035344
820 Ga0114129_10002612
821 Ga0105243_10002887
822 Ga0105241_10020576
823 Ga0105242_10002003
824 Ga0105248_10012561
825 Ga0105248_10154407
826 Ga0105237_10039188
827 Ga0105238_10032211
828 Ga0105238_10035377
829 Ga0105238_10333196
830 Ga0105238_10349760
831 Ga0105238_10436970
832 Ga0105249_10143503
833 Ga0105249_10341709
834 Ga0105239_10002163
835 Ga0105239_10069223
836 Ga0105239_10211827
837 Ga0105239_10362018
838 Ga0105239_10379817
839 Ga0105246_10000769
840 Ga0105246_10012106
841 Ga0157373_10008357
842 Ga0157371_10078164
843 Ga0157370_10000181
844 Ga0157369_10037108
845 Ga0157369_10070632
846 Ga0157374_10002806
847 Ga0157374_10003474
848 Ga0157374_10010989
849 Ga0157374_10012920
850 Ga0157378_10035977
851 Ga0157378_10036237
852 Ga0157378_10048581
853 Ga0163162_10000654
854 Ga0163162_10021268
855 Ga0163162_10041835
856 Ga0157372_10041646
857 Ga0157372_10344701
858 Ga0157375_10000438
859 Ga0157375_10008146
860 Ga0157375_10013505
861 Ga0157375_10030878
862 Ga0157375_10103161
863 Ga0163163_10064401
864 Ga0163163_10122001
865 Ga0163163_10548108
866 Ga0182008_10000195
867 Ga0157379_10015624
868 Ga0157379_10017732
869 Ga0157376_10000144
870 Ga0157376_10085678
871 Ga0157376_10411235
872 Ga0213872_10000180
873 Ga0213872_10001658
874 Ga0213872_10004909
875 Ga0213876_10086681
876 Ga0213876_10180872
877 Ga0213875_10000091
878 Ga0213875_10006991
879 Ga0207427_102456
880 Ga0209026_1002178
881 Ga0209026_1003486
882 Ga0209148_1000117
883 Ga0209233_1000079
884 Ga0209565_1000252
885 Ga0209455_1000721
886 Ga0209673_1016627
887 Ga0209130_1018481
888 Ga0209675_1000229
889 Ga0209675_1000667
890 Ga0209675_1003353
891 Ga0209676_1000012
892 Ga0209025_1000214
893 Ga0209025_1000600
894 Ga0209025_1000963
895 Ga0209025_1001025
896 Ga0209025_1015461
897 Ga0209564_1002859
898 Ga0209564_1006430
899 Ga0209758_1000670
900 Ga0209758_1002660
901 Ga0209050_1000031
902 Ga0209256_1001006
903 Ga0209256_1002106
904 Ga0209051_1010096
905 Ga0209257_1000489
906 Ga0209257_1003682
907 Ga0207656_10000502
908 Ga0207696_1000650
909 Ga0207692_10092399
910 Ga0207642_10005130
911 Ga0207642_10021361
912 Ga0207710_10000254
913 Ga0207680_10014062
914 Ga0207647_10001957
915 Ga0207647_10027768
916 Ga0207699_10029287
917 Ga0207699_10111473
918 Ga0207645_10001415
919 Ga0207705_10000076
920 Ga0207705_10000318
921 Ga0207707_10003643
922 Ga0207707_10023342
923 Ga0207707_10033187
924 Ga0207707_10219063
925 Ga0207695_10000003
926 Ga0207695_10022627
927 Ga0207671_10254512
928 Ga0207693_10001359
929 Ga0207693_10013634
930 Ga0207693_10024551
931 Ga0207663_10131399
932 Ga0207660_10111433
933 Ga0207657_10009342
934 Ga0207657_10058460
935 Ga0207649_10173597
936 Ga0207652_10083796
937 Ga0207652_10292008
938 Ga0207646_10024490
939 Ga0207646_10032512
940 Ga0207694_10000016
941 Ga0207694_10299407
942 Ga0207650_10146676
943 Ga0207659_10037745
944 Ga0207687_10020363
945 Ga0207687_10068778
946 Ga0207700_10147070
947 Ga0207664_10096694
948 Ga0207664_10111597
949 Ga0207644_10002165
950 Ga0207644_10003390
951 Ga0207644_10006912
952 Ga0207644_10029905
953 Ga0207644_10100855
954 Ga0207690_10000196
955 Ga0207706_10023120
956 Ga0207686_10001088
957 Ga0207686_10093090
958 Ga0207709_10000569
959 Ga0207669_10015285
960 Ga0207669_10184765
961 Ga0207704_10000001
962 Ga0207704_10054983
963 Ga0207691_10003180
964 Ga0207691_10250448
965 Ga0207711_10021251
966 Ga0207711_10086146
967 Ga0207689_10000154
968 Ga0207661_10134604
969 Ga0207679_10007201
970 Ga0207679_10011695
971 Ga0207679_10108840
972 Ga0207667_10000021
973 Ga0207667_10000391
974 Ga0207651_10000002
975 Ga0207651_10004096
976 Ga0207712_10032085
977 Ga0207712_10145830
978 Ga0207640_10000063
979 Ga0207640_10104924
980 Ga0207640_10152616
981 Ga0207658_10007374
982 Ga0207658_10086446
983 Ga0207658_10258147
984 Ga0207677_10000190
985 Ga0207677_10005649
986 Ga0207677_10043664
987 Ga0207703_10000183
988 Ga0207703_10003754
989 Ga0207639_10037315
990 Ga0207639_10093271
991 Ga0207678_10003591
992 Ga0207678_10037803
993 Ga0207678_10238335
994 Ga0207678_10247228
995 Ga0207708_10025002
996 Ga0207702_10030102
997 Ga0207702_10128868
998 Ga0207641_10003340
999 Ga0207641_10049927
1000 Ga0207641_10210119
1001 Ga0207641_10218521
1002 Ga0207648_10000001
1003 Ga0207648_10002889
1004 Ga0207648_10012268
1005 Ga0207648_10083282
1006 Ga0207676_10044471
1007 Ga0207674_10345727
1008 Ga0207683_10015496
1009 Ga0207683_10023931
1010 Ga0207683_10392970
1011 Ga0207698_10001101
1012 Ga0207698_10002042
1013 Ga0207698_10041520
1014 Ga0209179_1000212
1015 Ga0209282_1000045
1016 Ga0268266_10003994
1017 Ga0268266_10059835
1018 Ga0268266_10125953
1019 Ga0268265_10008728
1020 Ga0268265_10033470
1021 Ga0268264_10000057
1022 Ga0268264_10000494
1023 Ga0268264_10007801
1024 Ga0268264_10010977
1025 Ga0265334_10000283
1026 Ga0265318_10003208
1027 Ga0307517_10071309
1028 Ga0307515_10053261
1029 Ga0265338_10026969
1030 Ga0265338_10069066
1031 Ga0307511_10000342
1032 Ga0265330_10075110
1033 Ga0265328_10000005
1034 Ga0265328_10034368
1035 Ga0265320_10064125
1036 Ga0265325_10019725
1037 Ga0265340_10004746
1038 Ga0265340_10016953
1039 Ga0265340_10034050
1040 Ga0265331_10008472
1041 Ga0265331_10029696
1042 Ga0265327_10001684
1043 Ga0265327_10031145
1044 Ga0265327_10044612
1045 Ga0265316_10066208
1046 Ga0265316_10068581
1047 Ga0307509_10000013
1048 Ga0265314_10001425
1049 Ga0265314_10063179
1050 Ga0265342_10007015
1051 Ga0307516_10011630
1052 Ga0307413_10111969
1053 Ga0307414_10064347
1054 Ga0307510_10000014
1055 Ga0307510_10018623
1056 Ga0373934_0000072
1057 Ga0373934_0005302
1058 Ga0373944_0024108
1059 Ga0373923_0000974
1060 Ga0373936_0001443
1061 Ga0373945_0090056
1062 Ga0373953_0002533
1063 Ga0373954_0000630
1064 Ga0373954_0003849
1065 Ga0373954_0028113
1066 Ga0373956_0000032
1067 Ga0373957_0007034
1068 Ga0373955_0001080
1069 Ga0373955_0022631
1070 Ga0373924_0015524
1071 Ga0373935_0008847
1072 Ga0373927_0001927
1073 Ga0373927_0038274
1074 Ga0373933_0000493
1075 Ga0373933_0002186
1076 Ga0373933_0007508
1077 Ga0373933_0068164
1078 Ga0373937_0000974
1079 Ga0373937_0005704
1080 Ga0373937_0016485
1081 Ga0373937_0059611
1082 Ga0373937_0061080
1083 Ga0373937_0066901
1084 Ga0373937_0165017
1085 Ga0373925_0001600
1086 Ga0373925_0005929
1087 Ga0373925_0156770
1088 Ga0395900_0066820
1089 Ga0395900_0071230
1090 Ga0395900_0144179
1091 Ga0395900_0232120
1092 Ga0395905_0000222
1093 Ga0395905_0001348
1094 Ga0395905_0010524
1095 Ga0395905_0019680
1096 Ga0395905_0062266
1097 Ga0395905_0396763
1098 Ga0436364_0004186
1099 Ga0436364_0542842
1100 Ga0395901_0068345
1101 Ga0395901_0248877
1102 Ga0436365_0475879
1103 Ga0436365_0974800
1104 Ga0436365_1137141
1105 Ga0436360_0674475
1106 Ga0436361_0061503
1107 Ga0436361_0073578
1108 Ga0436361_0891393
1109 Ga0436361_0985091
1110 Ga0436363_1276848
1111 Ga0436362_1048788
1112 Ga0436362_1101836
1113 Ga0439436_0008052
1114 Ga0451853_4029564
1115 Ga0439448_0003179
1116 Ga0439455_0003399
1117 Ga0450923_015751
1118 Ga0439458_0000202
1119 Ga0439458_0000718
1120 Ga0466969_0000834
1121 Ga0466972_0004441
1122 Ga0466972_0036149
1123 Ga0466972_0040330
1124 Ga0466972_0059322
1125 Ga0453683_0015347
1126 Ga0466965_0001091
1127 Ga0466966_0000445
1128 Ga0466961_0025802
1129 Ga0466961_0033290
1130 Ga0466964_0000891
1131 Ga0466964_0008011
1132 Ga0466971_0000422
1133 Ga0466971_0040755
1134 Ga0466971_0133475
1135 Ga0466968_0007304
1136 Ga0466968_0022126
1137 Ga0466970_0021721
1138 Ga0466957_0008510
1139 Ga0466957_0063460
1140 Ga0466957_0067953
1141 Ga0466959_0001608
1142 Ga0451576_0078476
1143 Ga0451576_0100998
1144 Ga0466967_0379480
1145 Ga0495592_0001874
1146 Ga0495592_0033706
1147 Ga0495592_0045919
1148 Ga0495638_0064924
1149 Ga0495651_0001383
1150 Ga0495653_0015230
1151 Ga0495580_0008358
1152 Ga0495662_0017917
1153 Ga0495662_0026238
1154 Ga0495664_0010391
1155 Ga0495664_0039875
1156 Ga0495585_0118102
1157 Ga0495596_0001569
1158 Ga0495608_0018959
1159 Ga0495610_0006802
1160 Ga0495618_0041744
1161 Ga0495618_0043216
1162 Ga0495628_0001460
1163 Ga0495628_0022275
1164 Ga0495628_0097774
1165 Ga0495630_0001826
1166 Ga0495666_0027981
1167 Ga0495652_0039742
1168 Ga0495665_0027777
1169 Ga0495640_0036375
1170 Ga0495640_0054486
1171 Ga0495586_0022586
1172 Ga0495645_0000924
1173 Ga0495667_0002059
1174 Ga0495667_0016541
1175 Ga0495668_0098808
1176 Ga0495635_0020633
1177 Ga0495635_0055523
1178 Ga0495657_0061473
1179 Ga0495599_0033120
1180 Ga0495599_0044625
1181 Ga0495599_0050464
1182 Ga0495647_0001692
1183 Ga0495647_0005350
1184 Ga0495658_0004078
1185 Ga0495600_0004697
1186 Ga0495600_0015414
1187 Ga0495604_0027136
1188 Ga0495674_0023648
1189 Ga0495680_0004554
1190 Ga0495680_0021037
1191 Ga0495680_0049350
1192 Ga0495680_0160626
1193 Ga0495687_028093
1194 Ga0495675_0000830
1195 Ga0495684_0012592
1196 Ga0496101_0187483
1197 Ga0496102_0005483
1198 Ga0496102_0078276
1199 Ga0496102_0119183
1200 Ga0496103_0113604
1201 Ga0496104_0045626
1202 Ga0496104_0180820
1203 Ga0496105_0092966
1204 Ga0496109_0013545
1205 Ga0496109_0025808
1206 Ga0496109_0074008
1207 Ga0496110_0020532
1208 Ga0496110_0040229
1209 Ga0496110_0213866
1210 Ga0496110_0386373
1211 Ga0496111_0226525
1212 Ga0496112_0074762
1213 Ga0496113_0199604
1214 Ga0496114_0033416
1215 Ga0496114_0176977
1216 Ga0496114_0259962
1217 Ga0496115_0020861
1218 Ga0496115_0052221
1219 Ga0496115_0089520
1220 Ga0496117_0000156
1221 Ga0496117_0033743
1222 Ga0496118_0000005
1223 Ga0496118_0042571
1224 Ga0496119_0025756
1225 Ga0496120_0002083
1226 Ga0496121_0000371
1227 Ga0496121_0058221
1228 Ga0496121_0061757
1229 Ga0496121_0076769
1230 Ga0496123_0008833
1231 Ga0496124_0085282
1232 Ga0496124_0092711
1233 Ga0496125_0000918
1234 Ga0496125_0003733
1235 Ga0496126_0026348
1236 Ga0495682_0001030
1237 Ga0501034_0000781
1238 Ga0501067_0007408
1239 Ga0501076_0025558
1240 Ga0501077_0121969
1241 Ga0501080_0047888
1242 Ga0501080_0111828
1243 Ga0501265_002810
1244 Ga0501035_0156549
1245 Ga0501044_0350711
1246 nmdc:mga05p37_6511_c1
1247 Ga0495601_0004508
1248 Ga0495601_0008885
1249 Ga0495601_0011591
1250 Ga0500635_0000159
1251 Ga0495595_0003382
1252 Ga0495595_0026253
1253 Ga0495595_0030023
1254 Ga0495619_0015630
1255 Ga0495619_0044754
1256 Ga0495619_0074142
1257 Ga0500643_001391
1258 Ga0500566_0022992
1259 Ga0500591_031057
1260 Ga0500607_080275
1261 Ga0500614_010530
1262 Ga0500559_0011465
1263 Ga0500559_0050120
1264 Ga0500616_0119199
1265 Ga0500624_000016
1266 Ga0500636_0028398
1267 Ga0500637_0000007
1268 Ga0500637_0000318
1269 Ga0500637_0037458
1270 Ga0500637_0093283
1271 Ga0466962_0000274
1272 2512035544
1273 2513956410
1274 2514041510
1275 2821449102
1276 2834645032
1277 2842333579
1278 2843694623
1279 2846035051
1280 2846040730
1281 2858695230
1282 2889018917
1283 2901304680
1284 2904543568
1285 2919142639
1286 2928117477
1287 2929162897
1288 2929527295
1289 2952254873
1290 644748290
1291 8003401418
1292 8054007661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

70

359

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9777 22 334
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.9746 22 334
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9681 22 334
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9621 22 334
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9614 22 332
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9854 97 273 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9744 97 273 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9683 22 334 3.40.190.10
5i84A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9556 22 334 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.948 98 273 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9935 110 215
AF-A0A1J9PHQ6-F1-model_v4 deleted 0.9818 103 273
AF-A0A2G8T783-F1-model_v4 Phosphate-binding protein PstS 0.9816 74 252 GO:0035435
GO:0042301
GO:0043190
AF-A0A257Q8T5-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9795 211 334
AF-A0A2H4V2I9-F1-model_v4 Phosphate-binding periplasmic protein of phosphate ABC transporter 0.9782 96 192

Map