F472209

General Info

Members Datasets Scaffolds Average Seq Length
646 290 645 207

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0002330|Ga0395899_0002330_12767_13444
Length 225
Sequence MAFGRRVLRSRSDEEGGPVKLFGPRYPEEIAKRIPPGQRLVKTWPVLHFGPIPDFDESTWTLEVNGLVDNPYTLTYSELKDLGPVDVQADMHCVTGWSTLDNTWTGVPFRVLADKAGVQAEAKWVIAHCDYGYTSDLSLQAMLDDDVLVAWAHGGEPLTGEHGFPLRLVIPKRYAWKSAKWLRGLEFSEQNKRGFWEVRGYHVHAEPWAEERYSYQEGPRAELEP

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
167 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
186 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.41
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005789 3300001976 Bacteria 1614
2 JGI24751J29686_10000383 3300002459 Bacteria 14840
3 Ga0065707_10131735 3300005295 Bacteria 1909
4 Ga0070676_10012261 3300005328 Bacteria 4674
5 Ga0070690_100001288 3300005330 Bacteria 13023
6 Ga0070690_100098414 3300005330 Unclassified 1936
7 Ga0070690_100392636 3300005330 Bacteria 1017
8 Ga0070670_100006976 3300005331 Bacteria 9575
9 Ga0070670_100113727 3300005331 Bacteria 2333
10 Ga0068869_100034253 3300005334 Bacteria 3591
11 Ga0070680_100059551 3300005336 Bacteria 3125
12 Ga0070689_100072798 3300005340 Bacteria 2686
13 Ga0070691_10161078 3300005341 Unclassified 1157
14 Ga0070687_100085288 3300005343 Bacteria 1733
15 Ga0070661_100017181 3300005344 Bacteria 5128
16 Ga0070692_10339662 3300005345 Bacteria 930
17 Ga0070692_10441844 3300005345 Bacteria 831
18 Ga0070669_100024278 3300005353 Bacteria 4347
19 Ga0070675_100056146 3300005354 Bacteria 3244
20 Ga0070671_100102180 3300005355 Bacteria 2405
21 Ga0070674_100013151 3300005356 Bacteria 5106
22 Ga0070674_100355509 3300005356 Unclassified 1184
23 Ga0070688_100250424 3300005365 Bacteria 1261
24 Ga0070659_100210417 3300005366 Bacteria 1603
25 Ga0070703_10000030 3300005406 Bacteria 70119
26 Ga0070703_10088814 3300005406 Bacteria 1068
27 Ga0070714_100000129 3300005435 Bacteria 59328
28 Ga0070714_100114963 3300005435 Bacteria 2388
29 Ga0070710_10270332 3300005437 Bacteria 1099
30 Ga0070710_10459535 3300005437 Unclassified 864
31 Ga0070701_10020700 3300005438 Bacteria 3126
32 Ga0070701_10187826 3300005438 Bacteria 1214
33 Ga0070711_100039385 3300005439 Bacteria 3183
34 Ga0070700_100002109 3300005441 Bacteria 10100
35 Ga0070700_100045991 3300005441 Bacteria 2695
36 Ga0070700_100111757 3300005441 Unclassified 1817
37 Ga0070700_100744844 3300005441 Bacteria 783
38 Ga0070700_100888041 3300005441 Unclassified 725
39 Ga0070694_100001859 3300005444 Bacteria 12509
40 Ga0070694_100027034 3300005444 Bacteria 3723
41 Ga0070694_100081550 3300005444 Unclassified 2251
42 Ga0070694_100130381 3300005444 Bacteria 1815
43 Ga0070694_100314745 3300005444 Bacteria 1203
44 Ga0070694_100366241 3300005444 Bacteria 1120
45 Ga0070708_100022679 3300005445 Bacteria 5328
46 Ga0070708_100023416 3300005445 Bacteria 5252
47 Ga0070708_100113844 3300005445 Bacteria 2488
48 Ga0070708_100176649 3300005445 Bacteria 1995
49 Ga0070663_100127142 3300005455 Bacteria 1932
50 Ga0070678_100022202 3300005456 Bacteria 4200
51 Ga0070678_100087874 3300005456 Unclassified 2375
52 Ga0070662_100400150 3300005457 Bacteria 1133
53 Ga0068867_100028632 3300005459 Bacteria 4012
54 Ga0068867_100046360 3300005459 Bacteria 3193
55 Ga0068867_100116032 3300005459 Bacteria 2063
56 Ga0068867_100324170 3300005459 Bacteria 1277
57 Ga0070685_10249010 3300005466 Bacteria 1176
58 Ga0070706_100000256 3300005467 Bacteria 64555
59 Ga0070706_100130880 3300005467 Bacteria 2341
60 Ga0070706_100206115 3300005467 Unclassified 1836
61 Ga0070706_100345553 3300005467 Bacteria 1387
62 Ga0070706_100380829 3300005467 Bacteria 1314
63 Ga0070706_100673397 3300005467 Bacteria 960
64 Ga0070707_100001775 3300005468 Bacteria 20731
65 Ga0070707_100091703 3300005468 Bacteria 2941
66 Ga0070707_100105623 3300005468 Bacteria 2730
67 Ga0070707_100225189 3300005468 Bacteria 1826
68 Ga0070707_100226993 3300005468 Bacteria 1818
69 Ga0070707_100243268 3300005468 Bacteria 1751
70 Ga0070707_100364411 3300005468 Unclassified 1404
71 Ga0070707_100540663 3300005468 Bacteria 1127
72 Ga0070698_100000165 3300005471 Bacteria 60856
73 Ga0070698_100000827 3300005471 Bacteria 33885
74 Ga0070698_100064492 3300005471 Bacteria 3690
75 Ga0070698_100285894 3300005471 Bacteria 1580
76 Ga0070698_100495968 3300005471 Bacteria 1159
77 Ga0070699_100018238 3300005518 Bacteria 6030
78 Ga0070699_100053741 3300005518 Bacteria 3486
79 Ga0070699_100068945 3300005518 Bacteria 3073
80 Ga0070699_100464788 3300005518 Bacteria 1148
81 Ga0070684_100006153 3300005535 Bacteria 9253
82 Ga0070684_100389505 3300005535 Bacteria 1284
83 Ga0070697_100008022 3300005536 Bacteria 8232
84 Ga0070697_100049567 3300005536 Bacteria 3408
85 Ga0070697_100070217 3300005536 Bacteria 2871
86 Ga0070697_100126138 3300005536 Unclassified 2144
87 Ga0070697_101041903 3300005536 Bacteria 728
88 Ga0070686_100002999 3300005544 Bacteria 9250
89 Ga0070686_100284570 3300005544 Bacteria 1221
90 Ga0070695_100046700 3300005545 Unclassified 2763
91 Ga0070695_100314381 3300005545 Bacteria 1162
92 Ga0070696_100004343 3300005546 Bacteria 9447
93 Ga0070696_100024491 3300005546 Bacteria 4103
94 Ga0070693_100030656 3300005547 Bacteria 2942
95 Ga0070704_100003309 3300005549 Bacteria 9221
96 Ga0070704_100050940 3300005549 Bacteria 2913
97 Ga0070704_100221435 3300005549 Bacteria 1539
98 Ga0070704_100249524 3300005549 Bacteria 1457
99 Ga0070704_100555208 3300005549 Bacteria 1004
100 Ga0070664_100002319 3300005564 Bacteria 15284
101 Ga0068857_100022120 3300005577 Bacteria 5593
102 Ga0068854_100393036 3300005578 Unclassified 1145
103 Ga0068854_100543246 3300005578 Bacteria 984
104 Ga0070702_100025964 3300005615 Bacteria 3143
105 Ga0068852_100115978 3300005616 Bacteria 2443
106 Ga0068859_100289817 3300005617 Unclassified 1730
107 Ga0068864_100041579 3300005618 Bacteria 3932
108 Ga0068864_100064581 3300005618 Bacteria 3175
109 Ga0068864_100074187 3300005618 Bacteria 2968
110 Ga0068866_10021883 3300005718 Bacteria 2951
111 Ga0068866_10422290 3300005718 Bacteria 865
112 Ga0068861_100341530 3300005719 Bacteria 1310
113 Ga0068861_100449866 3300005719 Unclassified 1154
114 Ga0068851_10055213 3300005834 Bacteria 2023
115 Ga0068870_10000226 3300005840 Bacteria 20692
116 Ga0068870_10066093 3300005840 Bacteria 1958
117 Ga0068863_100028894 3300005841 Bacteria 5295
118 Ga0068863_100149551 3300005841 Unclassified 2234
119 Ga0068863_100426853 3300005841 Bacteria 1299
120 Ga0068858_100771972 3300005842 Bacteria 937
121 Ga0068858_100933345 3300005842 Unclassified 849
122 Ga0068860_100158437 3300005843 Unclassified 2182
123 Ga0068860_100760754 3300005843 Bacteria 981
124 Ga0068860_101487317 3300005843 Unclassified 699
125 Ga0068862_100053790 3300005844 Bacteria 3447
126 Ga0081455_10005219 3300005937 Bacteria 14289
127 Ga0081455_10008629 3300005937 Bacteria 10567
128 Ga0081455_10099271 3300005937 Bacteria 2342
129 Ga0081455_10246985 3300005937 Bacteria 1308
130 Ga0081538_10026269 3300005981 Bacteria 4076
131 Ga0081539_10022550 3300005985 Bacteria 4161
132 Ga0081539_10040675 3300005985 Bacteria 2727
133 Ga0081539_10055955 3300005985 Bacteria 2192
134 Ga0070716_100076847 3300006173 Bacteria 1980
135 Ga0070712_100008229 3300006175 Bacteria 6552
136 Ga0097621_100015984 3300006237 Bacteria 5659
137 Ga0075428_100076851 3300006844 Bacteria 3645
138 Ga0075428_100135738 3300006844 Bacteria 2675
139 Ga0075428_100392298 3300006844 Bacteria 1488
140 Ga0075430_100000348 3300006846 Bacteria 33561
141 Ga0075430_100141761 3300006846 Bacteria 2001
142 Ga0075431_100000742 3300006847 Bacteria 28178
143 Ga0075431_100047088 3300006847 Bacteria 4446
144 Ga0075431_100079392 3300006847 Bacteria 3387
145 Ga0075433_10000393 3300006852 Bacteria 27755
146 Ga0075433_10011979 3300006852 Bacteria 6992
147 Ga0075434_100002976 3300006871 Bacteria 15076
148 Ga0075434_100078593 3300006871 Bacteria 3295
149 Ga0075434_100092307 3300006871 Bacteria 3030
150 Ga0075434_100957745 3300006871 Bacteria 870
151 Ga0075429_100003403 3300006880 Bacteria 13562
152 Ga0075429_100132861 3300006880 Bacteria 2178
153 Ga0075429_100382752 3300006880 Unclassified 1232
154 Ga0068865_100063173 3300006881 Bacteria 2602
155 Ga0068865_100109198 3300006881 Bacteria 2038
156 Ga0068865_100191352 3300006881 Bacteria 1582
157 Ga0068865_100336611 3300006881 Unclassified 1218
158 Ga0075435_100012895 3300007076 Bacteria 6200
159 Ga0075435_100323498 3300007076 Bacteria 1320
160 Ga0105251_10052177 3300009011 Bacteria 1948
161 Ga0111539_10047773 3300009094 Bacteria 5115
162 Ga0111539_10259866 3300009094 Bacteria 2021
163 Ga0111539_10444270 3300009094 Bacteria 1510
164 Ga0105245_10060419 3300009098 Bacteria 3413
165 Ga0105245_10072307 3300009098 Bacteria 3133
166 Ga0105245_10186639 3300009098 Bacteria 1984
167 Ga0105245_10569603 3300009098 Bacteria 1156
168 Ga0114129_10009240 3300009147 Bacteria 14062
169 Ga0114129_10025791 3300009147 Bacteria 8325
170 Ga0114129_10048271 3300009147 Bacteria 5982
171 Ga0114129_10081207 3300009147 Bacteria 4507
172 Ga0114129_10257484 3300009147 Bacteria 2340
173 Ga0114129_10339857 3300009147 Bacteria 1991
174 Ga0114129_10401849 3300009147 Bacteria 1805
175 Ga0114129_10542502 3300009147 Bacteria 1513
176 Ga0105243_10012242 3300009148 Bacteria 6487
177 Ga0105243_10052502 3300009148 Bacteria 3229
178 Ga0105243_10054694 3300009148 Bacteria 3169
179 Ga0105243_10058923 3300009148 Bacteria 3062
180 Ga0105243_10075060 3300009148 Bacteria 2744
181 Ga0105243_10120740 3300009148 Unclassified 2209
182 Ga0105242_10003933 3300009176 Bacteria 11547
183 Ga0105242_10015992 3300009176 Bacteria 5831
184 Ga0105242_10140887 3300009176 Unclassified 2092
185 Ga0105248_10067611 3300009177 Bacteria 4012
186 Ga0105248_10217043 3300009177 Unclassified 2154
187 Ga0105248_10429992 3300009177 Bacteria 1487
188 Ga0105238_10067436 3300009551 Bacteria 3579
189 Ga0105249_10122412 3300009553 Bacteria 2474
190 Ga0105249_10297360 3300009553 Bacteria 1618
191 Ga0105246_10015599 3300011119 Bacteria 4800
192 Ga0105246_10038980 3300011119 Bacteria 3198
193 Ga0105246_10142783 3300011119 Bacteria 1802
194 Ga0157374_10036695 3300013296 Bacteria 4492
195 Ga0157378_10089576 3300013297 Unclassified 2795
196 Ga0157378_10383227 3300013297 Bacteria 1381
197 Ga0157378_10425472 3300013297 Bacteria 1313
198 Ga0157378_10425655 3300013297 Unclassified 1313
199 Ga0157378_10543036 3300013297 Bacteria 1166
200 Ga0157378_10547140 3300013297 Bacteria 1162
201 Ga0157375_10032734 3300013308 Bacteria 4933
202 Ga0157375_10100613 3300013308 Bacteria 2972
203 Ga0157375_10286967 3300013308 Unclassified 1809
204 Ga0163163_10001408 3300014325 Bacteria 20316
205 Ga0163163_10088893 3300014325 Unclassified 3101
206 Ga0163163_10472374 3300014325 Bacteria 1315
207 Ga0157380_10402848 3300014326 Bacteria 1299
208 Ga0157380_10752859 3300014326 Bacteria 986
209 Ga0157380_11036980 3300014326 Bacteria 856
210 Ga0157380_11404527 3300014326 Unclassified 749
211 Ga0157380_11666167 3300014326 Bacteria 695
212 Ga0157377_10035761 3300014745 Bacteria 2727
213 Ga0157377_10118610 3300014745 Bacteria 1600
214 Ga0157379_10224139 3300014968 Bacteria 1704
215 Ga0157379_10395446 3300014968 Bacteria 1270
216 Ga0157379_10479367 3300014968 Unclassified 1151
217 Ga0157376_10428912 3300014969 Bacteria 1285
218 Ga0163161_10806803 3300017792 Unclassified 789
219 Ga0207713_1044347 3300025735 Bacteria 1827
220 Ga0207653_10000010 3300025885 Bacteria 165368
221 Ga0207653_10003356 3300025885 Bacteria 5053
222 Ga0207692_10002955 3300025898 Bacteria 6583
223 Ga0207688_10002728 3300025901 Bacteria 9553
224 Ga0207647_10035041 3300025904 Bacteria 3201
225 Ga0207645_10005796 3300025907 Bacteria 8911
226 Ga0207643_10000427 3300025908 Bacteria 27828
227 Ga0207643_10034063 3300025908 Unclassified 2852
228 Ga0207643_10080644 3300025908 Bacteria 1885
229 Ga0207684_10000016 3300025910 Bacteria 409263
230 Ga0207684_10000160 3300025910 Bacteria 115343
231 Ga0207684_10320720 3300025910 Bacteria 1335
232 Ga0207684_10368617 3300025910 Bacteria 1236
233 Ga0207684_10552066 3300025910 Bacteria 985
234 Ga0207693_10000862 3300025915 Bacteria 27068
235 Ga0207660_10248716 3300025917 Bacteria 1403
236 Ga0207662_10157055 3300025918 Unclassified 1451
237 Ga0207646_10000205 3300025922 Bacteria 80302
238 Ga0207646_10010984 3300025922 Bacteria 8794
239 Ga0207646_10203228 3300025922 Bacteria 1790
240 Ga0207646_10302111 3300025922 Bacteria 1446
241 Ga0207650_10008407 3300025925 Bacteria 7046
242 Ga0207659_10042950 3300025926 Bacteria 3172
243 Ga0207659_10317892 3300025926 Unclassified 1283
244 Ga0207687_10013352 3300025927 Bacteria 5363
245 Ga0207687_10612571 3300025927 Bacteria 918
246 Ga0207664_10000139 3300025929 Bacteria 60860
247 Ga0207664_10298187 3300025929 Bacteria 1417
248 Ga0207690_10097096 3300025932 Bacteria 2096
249 Ga0207706_10100853 3300025933 Bacteria 2540
250 Ga0207686_10025998 3300025934 Bacteria 3413
251 Ga0207709_10014252 3300025935 Bacteria 4387
252 Ga0207709_10014541 3300025935 Bacteria 4348
253 Ga0207709_10106518 3300025935 Bacteria 1865
254 Ga0207670_10239780 3300025936 Bacteria 1396
255 Ga0207669_10034223 3300025937 Bacteria 2877
256 Ga0207669_10769422 3300025937 Unclassified 796
257 Ga0207704_10010705 3300025938 Bacteria 4485
258 Ga0207704_10186454 3300025938 Bacteria 1505
259 Ga0207704_10416558 3300025938 Unclassified 1064
260 Ga0207665_10034153 3300025939 Bacteria 3375
261 Ga0207665_10042501 3300025939 Bacteria 3038
262 Ga0207711_10243534 3300025941 Bacteria 1649
263 Ga0207689_10007393 3300025942 Bacteria 9632
264 Ga0207679_10077038 3300025945 Bacteria 2535
265 Ga0207679_10546212 3300025945 Unclassified 1039
266 Ga0207712_10370892 3300025961 Bacteria 1195
267 Ga0207712_10440936 3300025961 Bacteria 1102
268 Ga0207712_10563899 3300025961 Bacteria 981
269 Ga0207640_10200093 3300025981 Unclassified 1513
270 Ga0207677_10226404 3300026023 Bacteria 1503
271 Ga0207703_10060330 3300026035 Bacteria 3101
272 Ga0207703_10536185 3300026035 Bacteria 1102
273 Ga0207678_10059567 3300026067 Bacteria 3285
274 Ga0207708_10004840 3300026075 Bacteria 9922
275 Ga0207708_10017620 3300026075 Bacteria 5377
276 Ga0207708_10427804 3300026075 Bacteria 1099
277 Ga0207708_10648525 3300026075 Bacteria 898
278 Ga0207641_11097373 3300026088 Unclassified 794
279 Ga0207648_10004190 3300026089 Bacteria 14902
280 Ga0207648_10148152 3300026089 Bacteria 2071
281 Ga0207648_10507757 3300026089 Bacteria 1104
282 Ga0207676_10006125 3300026095 Bacteria 8491
283 Ga0207676_10057138 3300026095 Bacteria 3072
284 Ga0207674_10001990 3300026116 Bacteria 25893
285 Ga0207675_100010000 3300026118 Bacteria 8887
286 Ga0207675_100030824 3300026118 Bacteria 4995
287 Ga0207675_100241999 3300026118 Unclassified 1744
288 Ga0207683_10002897 3300026121 Bacteria 14962
289 Ga0207683_10161031 3300026121 Unclassified 2029
290 Ga0207698_10247089 3300026142 Bacteria 1630
291 Ga0207428_10003462 3300027907 Bacteria 15322
292 Ga0207428_10034775 3300027907 Bacteria 4126
293 Ga0207428_10035985 3300027907 Bacteria 4042
294 Ga0207428_10255343 3300027907 Bacteria 1306
295 Ga0268264_10205674 3300028381 Bacteria 1804
296 Ga0268264_10473059 3300028381 Bacteria 1218
297 Ga0265328_10034994 3300031239 Bacteria 1858
298 Ga0265327_10000103 3300031251 Bacteria 185405
299 Ga0307416_100463594 3300032002 Bacteria 1323
300 Ga0373926_0000125 3300035083 Bacteria 15707
301 Ga0373944_0000010 3300035089 Bacteria 36036
302 Ga0373951_0046218 3300035091 Bacteria 1061
303 Ga0373923_0085774 3300035111 Bacteria 1371
304 Ga0373932_0043476 3300035112 Bacteria 1307
305 Ga0373936_0050102 3300035113 Unclassified 1688
306 Ga0373939_0026025 3300035114 Bacteria 1645
307 Ga0373941_0062214 3300035115 Bacteria 1218
308 Ga0373945_0004388 3300035116 Bacteria 4480
309 Ga0373953_0095069 3300035117 Bacteria 1250
310 Ga0373943_0003882 3300035170 Bacteria 6803
311 Ga0373946_0001954 3300035171 Bacteria 7210
312 Ga0373946_0117794 3300035171 Bacteria 1209
313 Ga0373955_0049623 3300035172 Bacteria 2279
314 Ga0373955_0117364 3300035172 Bacteria 1544
315 Ga0373961_0108949 3300035241 Bacteria 905
316 Ga0373924_0008899 3300035410 Bacteria 3665
317 Ga0373931_0117879 3300035691 Bacteria 1514
318 Ga0373935_0004975 3300035692 Bacteria 7818
319 Ga0373927_0030229 3300035695 Bacteria 3534
320 Ga0373947_0004480 3300035725 Bacteria 8198
321 Ga0373947_0007423 3300035725 Bacteria 6347
322 Ga0373937_0414446 3300036401 Bacteria 1278
323 Ga0373925_0010309 3300037068 Bacteria 6780
324 Ga0373925_0012869 3300037068 Bacteria 6060
325 Ga0373925_0070861 3300037068 Bacteria 2636
326 Ga0373925_0421936 3300037068 Bacteria 1090
327 Ga0395899_0002330 3300037312 Bacteria 15461
328 Ga0395899_0010262 3300037312 Bacteria 7179
329 Ga0395899_0042162 3300037312 Bacteria 3408
330 Ga0395899_0059542 3300037312 Bacteria 2815
331 Ga0395900_0001049 3300037418 Bacteria 35386
332 Ga0395900_0009135 3300037418 Bacteria 10152
333 Ga0395900_0037385 3300037418 Bacteria 5006
334 Ga0395900_0039519 3300037418 Bacteria 4861
335 Ga0395900_0410046 3300037418 Bacteria 1317
336 Ga0395898_0003996 3300037466 Bacteria 16226
337 Ga0395898_0145072 3300037466 Bacteria 2272
338 Ga0395898_0171527 3300037466 Bacteria 2074
339 Ga0395905_0004519 3300037471 Bacteria 14409
340 Ga0395905_0008136 3300037471 Bacteria 10357
341 Ga0395905_0035730 3300037471 Bacteria 4667
342 Ga0395905_0131466 3300037471 Bacteria 2354
343 Ga0395905_0334442 3300037471 Bacteria 1405
344 Ga0395901_0003279 3300038443 Bacteria 16290
345 Ga0395901_0015014 3300038443 Bacteria 7874
346 Ga0395901_0031555 3300038443 Bacteria 5462
347 Ga0395901_0066764 3300038443 Bacteria 3746
348 Ga0395901_0342294 3300038443 Bacteria 1545
349 Ga0395901_0809112 3300038443 Bacteria 925
350 Ga0439443_029644 3300042003 Bacteria 897
351 Ga0439448_0063639 3300042005 Bacteria 1222
352 Ga0439450_032341 3300042008 Bacteria 1181
353 Ga0450893_0018496 3300042532 Bacteria 1188
354 Ga0439440_0033172 3300042993 Bacteria 1229
355 Ga0495627_016010 3300046453 Bacteria 2577
356 Ga0495627_041781 3300046453 Unclassified 1407
357 Ga0495592_0172491 3300046454 Bacteria 1480
358 Ga0495592_0357537 3300046454 Bacteria 935
359 Ga0495603_0004290 3300046455 Bacteria 8498
360 Ga0495603_0004579 3300046455 Bacteria 8254
361 Ga0495603_0011637 3300046455 Bacteria 5325
362 Ga0495603_0017730 3300046455 Bacteria 4309
363 Ga0495591_041878 3300046458 Bacteria 1298
364 Ga0495629_0001109 3300046459 Bacteria 21318
365 Ga0495629_0001444 3300046459 Bacteria 18742
366 Ga0495641_0003130 3300046461 Bacteria 12612
367 Ga0495641_0029947 3300046461 Bacteria 2617
368 Ga0495653_0057245 3300046463 Bacteria 2968
369 Ga0495580_0073210 3300046472 Bacteria 2392
370 Ga0495580_0131205 3300046472 Bacteria 1738
371 Ga0495582_0003569 3300046473 Bacteria 8770
372 Ga0495582_0003894 3300046473 Bacteria 8394
373 Ga0495582_0256575 3300046473 Bacteria 1003
374 Ga0495605_0045120 3300046474 Bacteria 2174
375 Ga0495605_0122021 3300046474 Archaea 1181
376 Ga0495639_0009337 3300046475 Bacteria 4206
377 Ga0495639_0011606 3300046475 Bacteria 3800
378 Ga0495639_0184464 3300046475 Unclassified 1017
379 Ga0495639_0189208 3300046475 Bacteria 1004
380 Ga0495662_0002966 3300046476 Bacteria 8561
381 Ga0495584_0076420 3300046491 Bacteria 1684
382 Ga0495584_0136710 3300046491 Bacteria 1244
383 Ga0495584_0140733 3300046491 Bacteria 1225
384 Ga0495584_0229344 3300046491 Bacteria 944
385 Ga0495585_0009316 3300046492 Bacteria 5897
386 Ga0495585_0035576 3300046492 Bacteria 2813
387 Ga0495585_0045353 3300046492 Bacteria 2454
388 Ga0495594_0010551 3300046499 Bacteria 4791
389 Ga0495594_0014179 3300046499 Bacteria 4173
390 Ga0495594_0064300 3300046499 Bacteria 2034
391 Ga0495594_0129451 3300046499 Bacteria 1429
392 Ga0495596_0063124 3300046500 Bacteria 1441
393 Ga0495596_0122329 3300046500 Bacteria 1010
394 Ga0495607_0112525 3300046501 Unclassified 1441
395 Ga0495607_0213883 3300046501 Bacteria 947
396 Ga0495583_0066878 3300046506 Bacteria 1589
397 Ga0495618_0009695 3300046514 Bacteria 5816
398 Ga0495618_0034958 3300046514 Unclassified 3153
399 Ga0495618_0107212 3300046514 Bacteria 1789
400 Ga0495618_0249573 3300046514 Bacteria 1114
401 Ga0495628_0027305 3300046516 Bacteria 4646
402 Ga0495630_0002369 3300046517 Bacteria 13073
403 Ga0495630_0071387 3300046517 Bacteria 2613
404 Ga0495630_0328591 3300046517 Bacteria 1169
405 Ga0495630_0576915 3300046517 Bacteria 862
406 Ga0495631_0041846 3300046518 Unclassified 2026
407 Ga0495631_0252642 3300046518 Unclassified 751
408 Ga0495644_0021649 3300046523 Bacteria 2451
409 Ga0495644_0062354 3300046523 Bacteria 1401
410 Ga0495644_0081274 3300046523 Bacteria 1222
411 Ga0495644_0184058 3300046523 Bacteria 803
412 Ga0495663_0004574 3300046525 Bacteria 3878
413 Ga0495663_0005838 3300046525 Bacteria 3408
414 Ga0495666_0000679 3300046526 Bacteria 15425
415 Ga0495642_0032426 3300046528 Bacteria 2096
416 Ga0495665_0000073 3300046531 Bacteria 42772
417 Ga0495665_0008503 3300046531 Bacteria 5572
418 Ga0495665_0019239 3300046531 Bacteria 3671
419 Ga0495640_0006425 3300046533 Bacteria 9293
420 Ga0495640_0215386 3300046533 Bacteria 1213
421 Ga0495640_0431891 3300046533 Bacteria 806
422 Ga0495586_0006826 3300046535 Bacteria 6088
423 Ga0495586_0046367 3300046535 Bacteria 2343
424 Ga0495598_0001351 3300046537 Bacteria 4819
425 Ga0495609_0007774 3300046538 Bacteria 5314
426 Ga0495609_0043568 3300046538 Bacteria 2015
427 Ga0495609_0140764 3300046538 Bacteria 1030
428 Ga0495621_0010224 3300046539 Bacteria 2865
429 Ga0495621_0026286 3300046539 Bacteria 1962
430 Ga0495621_0069082 3300046539 Bacteria 1298
431 Ga0495667_0143852 3300046559 Bacteria 1536
432 Ga0495656_0000313 3300046615 Bacteria 16745
433 Ga0495656_0002836 3300046615 Bacteria 5802
434 Ga0495656_0107347 3300046615 Bacteria 1300
435 Ga0495656_0114393 3300046615 Bacteria 1266
436 Ga0495656_0170423 3300046615 Bacteria 1064
437 Ga0495634_0004835 3300046642 Bacteria 10452
438 Ga0495634_0096187 3300046642 Bacteria 1918
439 Ga0495634_0098034 3300046642 Bacteria 1897
440 Ga0495611_0215325 3300046648 Bacteria 894
441 Ga0495635_0001368 3300046663 Bacteria 16236
442 Ga0495659_0041581 3300046664 Bacteria 1642
443 Ga0495659_0204292 3300046664 Bacteria 811
444 Ga0495659_0268435 3300046664 Bacteria 714
445 Ga0495588_0000418 3300046674 Bacteria 23045
446 Ga0495588_0004957 3300046674 Bacteria 5910
447 Ga0495588_0163439 3300046674 Bacteria 1177
448 Ga0495647_0000379 3300046681 Bacteria 12628
449 Ga0495647_0147060 3300046681 Bacteria 1008
450 Ga0495647_0306885 3300046681 Bacteria 716
451 Ga0495658_0001073 3300046683 Bacteria 14397
452 Ga0495658_0003070 3300046683 Bacteria 8353
453 Ga0495658_0494317 3300046683 Unclassified 782
454 Ga0495658_0705508 3300046683 Bacteria 646
455 Ga0495669_0250769 3300046684 Bacteria 850
456 Ga0495613_0001308 3300046689 Bacteria 19041
457 Ga0495613_0001902 3300046689 Bacteria 15829
458 Ga0495613_0011942 3300046689 Bacteria 6456
459 Ga0495613_0442009 3300046689 Bacteria 882
460 Ga0495624_0002222 3300046690 Bacteria 14801
461 Ga0495624_0066093 3300046690 Bacteria 2258
462 Ga0495624_0100888 3300046690 Bacteria 1777
463 Ga0495670_0012491 3300046691 Bacteria 4178
464 Ga0495670_0092866 3300046691 Bacteria 1546
465 Ga0495670_0173707 3300046691 Bacteria 1135
466 Ga0495671_0141060 3300046692 Unclassified 1174
467 Ga0495589_0107191 3300046794 Unclassified 1350
468 Ga0495589_0110129 3300046794 Bacteria 1329
469 Ga0495581_0002452 3300047315 Bacteria 10495
470 Ga0495581_0016562 3300047315 Bacteria 4283
471 Ga0495581_0018904 3300047315 Bacteria 4000
472 Ga0495581_0019909 3300047315 Bacteria 3896
473 Ga0495581_0318094 3300047315 Unclassified 909
474 Ga0495636_0042980 3300047318 Bacteria 1879
475 Ga0495674_0017706 3300047319 Bacteria 6633
476 Ga0495676_0048865 3300047321 Bacteria 3406
477 Ga0495676_0334797 3300047321 Bacteria 1014
478 Ga0495680_0003484 3300047322 Bacteria 15456
479 Ga0495683_0272799 3300047323 Bacteria 735
480 Ga0495677_0037073 3300047445 Bacteria 1781
481 Ga0495677_0266343 3300047445 Bacteria 671
482 Ga0495684_0024980 3300047471 Bacteria 4595
483 Ga0495684_0541883 3300047471 Unclassified 794
484 Ga0495593_0001860 3300047673 Bacteria 12569
485 Ga0495593_0445248 3300047673 Bacteria 648
486 Ga0495614_0012235 3300048089 Bacteria 3769
487 Ga0495614_0049634 3300048089 Bacteria 1799
488 Ga0495615_0005517 3300048090 Bacteria 2279
489 Ga0496100_0056226 3300048903 Bacteria 2573
490 Ga0496101_0097221 3300048904 Unclassified 2198
491 Ga0496102_0089947 3300048905 Unclassified 2840
492 Ga0496102_0703442 3300048905 Unclassified 933
493 Ga0496103_0037023 3300048906 Bacteria 2990
494 Ga0496103_0646833 3300048906 Bacteria 672
495 Ga0496104_0384635 3300048907 Bacteria 1316
496 Ga0496106_0016777 3300048909 Bacteria 5419
497 Ga0496106_0260903 3300048909 Bacteria 1386
498 Ga0496107_0077734 3300048910 Unclassified 2417
499 Ga0496108_0037155 3300048911 Bacteria 4055
500 Ga0496108_0402716 3300048911 Unclassified 1195
501 Ga0496109_0002327 3300048912 Bacteria 15834
502 Ga0496109_0205344 3300048912 Bacteria 1852
503 Ga0496110_0049391 3300048913 Unclassified 3690
504 Ga0496110_0194859 3300048913 Bacteria 1840
505 Ga0496111_0027400 3300048914 Bacteria 4031
506 Ga0496111_0038698 3300048914 Bacteria 3418
507 Ga0496112_0093846 3300048915 Bacteria 2971
508 Ga0496113_0070208 3300048916 Bacteria 2662
509 Ga0496113_0861776 3300048916 Bacteria 718
510 Ga0496114_0036014 3300048917 Bacteria 4090
511 Ga0501031_0028597 3300049568 Bacteria 3634
512 Ga0501031_0062378 3300049568 Bacteria 2429
513 Ga0501031_0168156 3300049568 Unclassified 1432
514 Ga0501032_0021284 3300049569 Bacteria 4509
515 Ga0501033_0041979 3300049570 Bacteria 3411
516 Ga0501034_0018577 3300049571 Bacteria 7127
517 Ga0501036_0097950 3300049572 Bacteria 2479
518 Ga0501036_0119925 3300049572 Bacteria 2221
519 Ga0501036_1003360 3300049572 Bacteria 683
520 Ga0501037_0008371 3300049573 Bacteria 7582
521 Ga0501038_0004634 3300049574 Bacteria 12796
522 Ga0501038_0019322 3300049574 Bacteria 6145
523 Ga0501038_0031058 3300049574 Bacteria 4722
524 Ga0501039_0023190 3300049575 Bacteria 4762
525 Ga0501039_0067357 3300049575 Bacteria 2780
526 Ga0501040_0021703 3300049576 Bacteria 4291
527 Ga0501040_0232550 3300049576 Bacteria 1313
528 Ga0501040_0248134 3300049576 Bacteria 1269
529 Ga0501040_0424401 3300049576 Bacteria 956
530 Ga0501041_0015190 3300049577 Bacteria 4572
531 Ga0501041_0023676 3300049577 Bacteria 3682
532 Ga0501041_0024222 3300049577 Bacteria 3642
533 Ga0501042_0006723 3300049578 Bacteria 7495
534 Ga0501042_0044553 3300049578 Bacteria 3161
535 Ga0501042_0053599 3300049578 Bacteria 2877
536 Ga0501042_0132790 3300049578 Bacteria 1794
537 Ga0501043_0017270 3300049579 Bacteria 5660
538 Ga0501046_0096462 3300049580 Bacteria 2271
539 Ga0501047_0164420 3300049581 Bacteria 2090
540 Ga0501048_0011919 3300049582 Bacteria 6482
541 Ga0501048_0015366 3300049582 Bacteria 5653
542 Ga0501048_0019749 3300049582 Bacteria 4941
543 Ga0501067_0145652 3300049583 Unclassified 1320
544 Ga0501067_0329401 3300049583 Bacteria 850
545 Ga0501068_0074928 3300049584 Bacteria 2069
546 Ga0501069_0003125 3300049585 Bacteria 8489
547 Ga0501069_0089762 3300049585 Unclassified 1738
548 Ga0501070_0016930 3300049586 Bacteria 6116
549 Ga0501070_0179207 3300049586 Unclassified 1744
550 Ga0501071_0053792 3300049587 Bacteria 2904
551 Ga0501072_0019158 3300049588 Bacteria 5286
552 Ga0501072_0033954 3300049588 Bacteria 3996
553 Ga0501072_0555490 3300049588 Unclassified 906
554 Ga0501073_0008093 3300049589 Bacteria 7800
555 Ga0501073_0031653 3300049589 Bacteria 3774
556 Ga0501074_0005966 3300049590 Bacteria 8788
557 Ga0501074_0072707 3300049590 Bacteria 2470
558 Ga0501075_0035250 3300049591 Bacteria 3730
559 Ga0501075_0064110 3300049591 Bacteria 2771
560 Ga0501075_0261120 3300049591 Bacteria 1320
561 Ga0501075_0372567 3300049591 Bacteria 1088
562 Ga0501076_0007561 3300049592 Bacteria 7909
563 Ga0501076_0008160 3300049592 Bacteria 7662
564 Ga0501076_0018274 3300049592 Bacteria 5342
565 Ga0501076_0085229 3300049592 Bacteria 2538
566 Ga0501076_0279942 3300049592 Bacteria 1366
567 Ga0501077_0017837 3300049593 Bacteria 4485
568 Ga0501077_0024873 3300049593 Bacteria 3802
569 Ga0501077_0050264 3300049593 Bacteria 2650
570 Ga0501077_0134628 3300049593 Bacteria 1567
571 Ga0501077_0313194 3300049593 Bacteria 1000
572 Ga0501077_0330018 3300049593 Bacteria 973
573 Ga0501077_0413150 3300049593 Bacteria 863
574 Ga0501079_0033494 3300049741 Bacteria 3952
575 Ga0501079_0041286 3300049741 Bacteria 3561
576 Ga0501079_0092401 3300049741 Bacteria 2344
577 Ga0501079_0221402 3300049741 Unclassified 1478
578 Ga0501079_0239124 3300049741 Bacteria 1419
579 Ga0501079_0502354 3300049741 Bacteria 953
580 Ga0501080_0013456 3300049742 Bacteria 7527
581 Ga0501080_0301864 3300049742 Bacteria 1452
582 Ga0501080_0407070 3300049742 Unclassified 1223
583 Ga0501081_0015424 3300049743 Bacteria 5042
584 Ga0501081_0147394 3300049743 Bacteria 1689
585 Ga0501081_0170144 3300049743 Bacteria 1573
586 Ga0501081_0822942 3300049743 Bacteria 699
587 Ga0501083_0016237 3300049744 Bacteria 5214
588 Ga0501083_0135835 3300049744 Unclassified 1611
589 Ga0501035_0030944 3300049822 Bacteria 4875
590 Ga0501044_0007431 3300049823 Bacteria 12051
591 Ga0501044_0483341 3300049823 Unclassified 1141
592 Ga0501045_0012796 3300049824 Bacteria 5911
593 Ga0501045_0084957 3300049824 Bacteria 2335
594 Ga0501045_0100451 3300049824 Bacteria 2141
595 Ga0501045_0520730 3300049824 Bacteria 883
596 nmdc:mga05p37_10596_c1 3300050507 Bacteria 10933
597 nmdc:mga05p37_134457_c1 3300050507 Bacteria 3034
598 nmdc:mga05p37_146257_c1 3300050507 Bacteria 2894
599 nmdc:mga05p37_277187_c1 3300050507 Bacteria 2001
600 nmdc:mga05p37_42514_c1 3300050507 Bacteria 5584
601 nmdc:mga05p37_778473_c1 3300050507 Bacteria 1050
602 nmdc:mga05p37_78472_c1 3300050507 Bacteria 4066
603 nmdc:mga09592_237736_c1 3300050508 Bacteria 1578
604 nmdc:mga09592_2556_c1 3300050508 Bacteria 14724
605 nmdc:mga09592_312257_c1 3300050508 Bacteria 1362
606 nmdc:mga0qj67_401_c1 3300050509 Bacteria 29850
607 nmdc:mga06r32_114873_c1 3300050510 Bacteria 2651
608 nmdc:mga06r32_79363_c1 3300050510 Bacteria 3193
609 nmdc:mga06r32_85686_c1 3300050510 Bacteria 3072
610 nmdc:mga08y16_186831_c1 3300050511 Bacteria 2150
611 nmdc:mga08y16_45503_c1 3300050511 Bacteria 4599
612 nmdc:mga08y16_807413_c1 3300050511 Bacteria 931
613 nmdc:mga08y16_91690_c1 3300050511 Bacteria 3167
614 nmdc:mga0n895_130902_c1 3300050512 Bacteria 2534
615 nmdc:mga0n895_20970_c1 3300050512 Bacteria 6104
616 nmdc:mga0n895_307192_c1 3300050512 Bacteria 1608
617 nmdc:mga0n895_88528_c1 3300050512 Bacteria 3096
618 nmdc:mga0n895_900543_c1 3300050512 Bacteria 870
619 nmdc:mga0rr50_247114_c1 3300050513 Bacteria 1480
620 nmdc:mga0a205_15142_c1 3300050515 Bacteria 7205
621 nmdc:mga0a205_6301_c1 3300050515 Bacteria 10712
622 nmdc:mga0a205_75654_c1 3300050515 Bacteria 3254
623 nmdc:mga0a205_867225_c1 3300050515 Unclassified 750
624 Ga0495601_0008228 3300053077 Bacteria 6153
625 Ga0495612_0024778 3300053078 Bacteria 2409
626 Ga0495655_0047735 3300053083 Bacteria 1122
627 Ga0495655_0068421 3300053083 Bacteria 987
628 Ga0495595_0015178 3300053084 Unclassified 3282
629 Ga0495619_0001824 3300053085 Bacteria 14160
630 Ga0495619_0018986 3300053085 Bacteria 4367
631 Ga0501084_0055716 3300054114 Bacteria 3307
632 Ga0501084_0158014 3300054114 Bacteria 1912
633 Ga0501084_0198323 3300054114 Bacteria 1693
634 Ga0501084_0694374 3300054114 Bacteria 858
635 Ga0590075_012567 3300059424 Bacteria 2057
636 Ga0501082_0026533 3300060353 Bacteria 4993
637 Ga0501082_0045693 3300060353 Bacteria 3776
638 Ga0501082_0089403 3300060353 Bacteria 2659
639 Ga0501082_0142473 3300060353 Unclassified 2080
640 Ga0501082_0151857 3300060353 Bacteria 2012
641 Ga0530510_0043036 3300061734 Bacteria 3262
642 Ga0530510_0091330 3300061734 Bacteria 2221
643 Ga0530510_0129539 3300061734 Unclassified 1855
644 Ga0530510_0144600 3300061734 Bacteria 1754
645 Ga0530510_0228934 3300061734 Unclassified 1382

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2526164512 2526212220 181
2 3300005468 Ga0070707_100225189 Ga0070707_1002251893 185
3 3300025922 Ga0207646_10302111 Ga0207646_103021111 185
4 3300046683 Ga0495658_0705508 Ga0495658_0705508_55_612 185
5 3300047315 Ga0495581_0318094 Ga0495581_0318094_41_598 185
6 3300047323 Ga0495683_0272799 Ga0495683_0272799_165_722 185
7 3300049743 Ga0501081_0822942 Ga0501081_0822942_22_579 185
8 3300048906 Ga0496103_0646833 Ga0496103_0646833_60_620 186
9 3300035171 Ga0373946_0117794 Ga0373946_0117794_235_804 187
10 3300035172 Ga0373955_0049623 Ga0373955_0049623_773_1342 187
11 3300037068 Ga0373925_0421936 Ga0373925_0421936_465_1034 187
12 3300046514 Ga0495618_0249573 Ga0495618_0249573_219_788 187
13 3300046516 Ga0495628_0027305 Ga0495628_0027305_530_1099 187
14 3300046533 Ga0495640_0431891 Ga0495640_0431891_144_713 187
15 3300046642 Ga0495634_0098034 Ga0495634_0098034_656_1225 187
16 3300046454 Ga0495592_0357537 Ga0495592_0357537_34_606 188
17 3300046689 Ga0495613_0442009 Ga0495613_0442009_271_843 188
18 3300035117 Ga0373953_0095069 Ga0373953_0095069_64_645 191
19 3300035172 Ga0373955_0117364 Ga0373955_0117364_826_1407 191
20 3300053078 Ga0495612_0024778 Ga0495612_0024778_1271_1852 191
21 3300009147 Ga0114129_10401849 Ga0114129_104018492 192
22 3300005435 Ga0070714_100000129 Ga0070714_10000012955 195
23 3300025929 Ga0207664_10000139 Ga0207664_1000013955 195
24 3300005435 Ga0070714_100114963 Ga0070714_1001149632 196
25 3300005445 Ga0070708_100022679 Ga0070708_1000226795 196
26 3300005445 Ga0070708_100176649 Ga0070708_1001766493 196
27 3300005467 Ga0070706_100000256 Ga0070706_10000025654 196
28 3300005467 Ga0070706_100130880 Ga0070706_1001308802 196
29 3300005468 Ga0070707_100001775 Ga0070707_10000177510 196
30 3300005468 Ga0070707_100091703 Ga0070707_1000917033 196
31 3300005468 Ga0070707_100226993 Ga0070707_1002269931 196
32 3300005471 Ga0070698_100000165 Ga0070698_10000016523 196
33 3300005471 Ga0070698_100000827 Ga0070698_10000082722 196
34 3300005471 Ga0070698_100495968 Ga0070698_1004959682 196
35 3300005518 Ga0070699_100464788 Ga0070699_1004647883 196
36 3300005536 Ga0070697_100008022 Ga0070697_10000802212 196
37 3300006173 Ga0070716_100076847 Ga0070716_1000768472 196
38 3300025910 Ga0207684_10000016 Ga0207684_10000016218 196
39 3300025910 Ga0207684_10552066 Ga0207684_105520662 196
40 3300025922 Ga0207646_10000205 Ga0207646_1000020513 196
41 3300025922 Ga0207646_10010984 Ga0207646_100109843 196
42 3300025933 Ga0207706_10100853 Ga0207706_101008533 196
43 3300005437 Ga0070710_10459535 Ga0070710_104595352 197
44 3300025917 Ga0207660_10248716 Ga0207660_102487162 197
45 3300025929 Ga0207664_10298187 Ga0207664_102981872 198
46 3300025939 Ga0207665_10042501 Ga0207665_100425012 198
47 3300031239 Ga0265328_10034994 Ga0265328_100349943 202
48 3300031251 Ga0265327_10000103 Ga0265327_10000103117 202
49 3300046523 Ga0495644_0184058 Ga0495644_0184058_15_623 202
50 3300005295 Ga0065707_10131735 Ga0065707_101317351 203
51 3300005353 Ga0070669_100024278 Ga0070669_1000242782 203
52 3300005330 Ga0070690_100001288 Ga0070690_1000012882 204
53 3300005441 Ga0070700_100002109 Ga0070700_1000021097 204
54 3300005459 Ga0068867_100324170 Ga0068867_1003241702 204
55 3300009177 Ga0105248_10067611 Ga0105248_100676113 204
56 3300013297 Ga0157378_10547140 Ga0157378_105471402 204
57 3300025945 Ga0207679_10546212 Ga0207679_105462122 205
58 3300049578 Ga0501042_0132790 Ga0501042_0132790_801_1418 205
59 3300049593 Ga0501077_0313194 Ga0501077_0313194_186_803 205
60 3300046514 Ga0495618_0009695 Ga0495618_0009695_3969_4592 206
61 3300046517 Ga0495630_0071387 Ga0495630_0071387_855_1478 206
62 3300046642 Ga0495634_0096187 Ga0495634_0096187_1175_1798 206
63 3300046681 Ga0495647_0306885 Ga0495647_0306885_70_693 206
64 3300046690 Ga0495624_0066093 Ga0495624_0066093_297_920 206
65 3300047471 Ga0495684_0541883 Ga0495684_0541883_157_780 206
66 3300049576 Ga0501040_0232550 Ga0501040_0232550_274_894 206
67 3300049591 Ga0501075_0372567 Ga0501075_0372567_346_966 206
68 3300049741 Ga0501079_0239124 Ga0501079_0239124_497_1117 206
69 3300049824 Ga0501045_0520730 Ga0501045_0520730_57_677 206
70 3300002459 JGI24751J29686_10000383 JGI24751J29686_100003837 207
71 3300005328 Ga0070676_10012261 Ga0070676_100122612 207
72 3300005330 Ga0070690_100098414 Ga0070690_1000984142 207
73 3300005330 Ga0070690_100392636 Ga0070690_1003926362 207
74 3300005331 Ga0070670_100006976 Ga0070670_1000069767 207
75 3300005331 Ga0070670_100113727 Ga0070670_1001137272 207
76 3300005334 Ga0068869_100034253 Ga0068869_1000342533 207
77 3300005336 Ga0070680_100059551 Ga0070680_1000595513 207
78 3300005340 Ga0070689_100072798 Ga0070689_1000727983 207
79 3300005341 Ga0070691_10161078 Ga0070691_101610782 207
80 3300005343 Ga0070687_100085288 Ga0070687_1000852882 207
81 3300005344 Ga0070661_100017181 Ga0070661_1000171814 207
82 3300005345 Ga0070692_10339662 Ga0070692_103396622 207
83 3300005345 Ga0070692_10441844 Ga0070692_104418441 207
84 3300005354 Ga0070675_100056146 Ga0070675_1000561462 207
85 3300005355 Ga0070671_100102180 Ga0070671_1001021802 207
86 3300005356 Ga0070674_100013151 Ga0070674_1000131512 207
87 3300005356 Ga0070674_100355509 Ga0070674_1003555092 207
88 3300005365 Ga0070688_100250424 Ga0070688_1002504242 207
89 3300005366 Ga0070659_100210417 Ga0070659_1002104171 207
90 3300005406 Ga0070703_10000030 Ga0070703_1000003025 207
91 3300005406 Ga0070703_10088814 Ga0070703_100888141 207
92 3300005437 Ga0070710_10270332 Ga0070710_102703322 207
93 3300005438 Ga0070701_10020700 Ga0070701_100207002 207
94 3300005438 Ga0070701_10187826 Ga0070701_101878261 207
95 3300005439 Ga0070711_100039385 Ga0070711_1000393852 207
96 3300005441 Ga0070700_100045991 Ga0070700_1000459912 207
97 3300005441 Ga0070700_100111757 Ga0070700_1001117572 207
98 3300005441 Ga0070700_100744844 Ga0070700_1007448441 207
99 3300005441 Ga0070700_100888041 Ga0070700_1008880411 207
100 3300005444 Ga0070694_100001859 Ga0070694_10000185912 207
101 3300005444 Ga0070694_100027034 Ga0070694_1000270342 207
102 3300005444 Ga0070694_100081550 Ga0070694_1000815502 207
103 3300005444 Ga0070694_100130381 Ga0070694_1001303812 207
104 3300005444 Ga0070694_100314745 Ga0070694_1003147452 207
105 3300005444 Ga0070694_100366241 Ga0070694_1003662412 207
106 3300005445 Ga0070708_100023416 Ga0070708_1000234161 207
107 3300005445 Ga0070708_100113844 Ga0070708_1001138442 207
108 3300005455 Ga0070663_100127142 Ga0070663_1001271422 207
109 3300005456 Ga0070678_100022202 Ga0070678_1000222022 207
110 3300005456 Ga0070678_100087874 Ga0070678_1000878742 207
111 3300005457 Ga0070662_100400150 Ga0070662_1004001502 207
112 3300005459 Ga0068867_100028632 Ga0068867_1000286324 207
113 3300005459 Ga0068867_100046360 Ga0068867_1000463605 207
114 3300005459 Ga0068867_100116032 Ga0068867_1001160322 207
115 3300005466 Ga0070685_10249010 Ga0070685_102490102 207
116 3300005467 Ga0070706_100206115 Ga0070706_1002061152 207
117 3300005467 Ga0070706_100380829 Ga0070706_1003808292 207
118 3300005467 Ga0070706_100673397 Ga0070706_1006733972 207
119 3300005468 Ga0070707_100105623 Ga0070707_1001056231 207
120 3300005468 Ga0070707_100243268 Ga0070707_1002432682 207
121 3300005468 Ga0070707_100364411 Ga0070707_1003644112 207
122 3300005468 Ga0070707_100540663 Ga0070707_1005406632 207
123 3300005471 Ga0070698_100064492 Ga0070698_1000644922 207
124 3300005471 Ga0070698_100285894 Ga0070698_1002858942 207
125 3300005518 Ga0070699_100018238 Ga0070699_1000182383 207
126 3300005518 Ga0070699_100053741 Ga0070699_1000537412 207
127 3300005518 Ga0070699_100068945 Ga0070699_1000689453 207
128 3300005535 Ga0070684_100006153 Ga0070684_1000061537 207
129 3300005535 Ga0070684_100389505 Ga0070684_1003895052 207
130 3300005536 Ga0070697_100049567 Ga0070697_1000495672 207
131 3300005536 Ga0070697_100070217 Ga0070697_1000702173 207
132 3300005536 Ga0070697_100126138 Ga0070697_1001261381 207
133 3300005536 Ga0070697_101041903 Ga0070697_1010419031 207
134 3300005544 Ga0070686_100002999 Ga0070686_1000029995 207
135 3300005544 Ga0070686_100284570 Ga0070686_1002845701 207
136 3300005545 Ga0070695_100046700 Ga0070695_1000467002 207
137 3300005545 Ga0070695_100314381 Ga0070695_1003143812 207
138 3300005546 Ga0070696_100004343 Ga0070696_1000043432 207
139 3300005546 Ga0070696_100024491 Ga0070696_1000244915 207
140 3300005547 Ga0070693_100030656 Ga0070693_1000306562 207
141 3300005549 Ga0070704_100003309 Ga0070704_1000033099 207
142 3300005549 Ga0070704_100050940 Ga0070704_1000509403 207
143 3300005549 Ga0070704_100221435 Ga0070704_1002214352 207
144 3300005549 Ga0070704_100249524 Ga0070704_1002495242 207
145 3300005549 Ga0070704_100555208 Ga0070704_1005552082 207
146 3300005564 Ga0070664_100002319 Ga0070664_1000023196 207
147 3300005577 Ga0068857_100022120 Ga0068857_1000221206 207
148 3300005578 Ga0068854_100393036 Ga0068854_1003930362 207
149 3300005578 Ga0068854_100543246 Ga0068854_1005432462 207
150 3300005615 Ga0070702_100025964 Ga0070702_1000259642 207
151 3300005616 Ga0068852_100115978 Ga0068852_1001159783 207
152 3300005617 Ga0068859_100289817 Ga0068859_1002898172 207
153 3300005618 Ga0068864_100041579 Ga0068864_1000415792 207
154 3300005618 Ga0068864_100064581 Ga0068864_1000645813 207
155 3300005618 Ga0068864_100074187 Ga0068864_1000741873 207
156 3300005718 Ga0068866_10021883 Ga0068866_100218833 207
157 3300005718 Ga0068866_10422290 Ga0068866_104222901 207
158 3300005719 Ga0068861_100341530 Ga0068861_1003415302 207
159 3300005719 Ga0068861_100449866 Ga0068861_1004498662 207
160 3300005834 Ga0068851_10055213 Ga0068851_100552132 207
161 3300005840 Ga0068870_10000226 Ga0068870_1000022618 207
162 3300005840 Ga0068870_10066093 Ga0068870_100660932 207
163 3300005841 Ga0068863_100028894 Ga0068863_1000288946 207
164 3300005841 Ga0068863_100149551 Ga0068863_1001495513 207
165 3300005841 Ga0068863_100426853 Ga0068863_1004268532 207
166 3300005842 Ga0068858_100771972 Ga0068858_1007719722 207
167 3300005842 Ga0068858_100933345 Ga0068858_1009333452 207
168 3300005843 Ga0068860_100158437 Ga0068860_1001584373 207
169 3300005843 Ga0068860_100760754 Ga0068860_1007607542 207
170 3300005843 Ga0068860_101487317 Ga0068860_1014873171 207
171 3300005844 Ga0068862_100053790 Ga0068862_1000537903 207
172 3300005937 Ga0081455_10005219 Ga0081455_100052194 207
173 3300005937 Ga0081455_10008629 Ga0081455_100086292 207
174 3300005937 Ga0081455_10099271 Ga0081455_100992712 207
175 3300005937 Ga0081455_10246985 Ga0081455_102469852 207
176 3300005981 Ga0081538_10026269 Ga0081538_100262693 207
177 3300005985 Ga0081539_10022550 Ga0081539_100225505 207
178 3300005985 Ga0081539_10040675 Ga0081539_100406753 207
179 3300005985 Ga0081539_10055955 Ga0081539_100559552 207
180 3300006175 Ga0070712_100008229 Ga0070712_1000082296 207
181 3300006237 Ga0097621_100015984 Ga0097621_1000159844 207
182 3300006844 Ga0075428_100076851 Ga0075428_1000768515 207
183 3300006844 Ga0075428_100135738 Ga0075428_1001357383 207
184 3300006844 Ga0075428_100392298 Ga0075428_1003922983 207
185 3300006846 Ga0075430_100000348 Ga0075430_10000034814 207
186 3300006846 Ga0075430_100141761 Ga0075430_1001417612 207
187 3300006847 Ga0075431_100000742 Ga0075431_10000074215 207
188 3300006847 Ga0075431_100047088 Ga0075431_1000470883 207
189 3300006847 Ga0075431_100079392 Ga0075431_1000793922 207
190 3300006852 Ga0075433_10000393 Ga0075433_1000039315 207
191 3300006852 Ga0075433_10011979 Ga0075433_100119798 207
192 3300006871 Ga0075434_100002976 Ga0075434_10000297613 207
193 3300006871 Ga0075434_100078593 Ga0075434_1000785934 207
194 3300006871 Ga0075434_100092307 Ga0075434_1000923073 207
195 3300006871 Ga0075434_100957745 Ga0075434_1009577451 207
196 3300006880 Ga0075429_100003403 Ga0075429_1000034035 207
197 3300006880 Ga0075429_100132861 Ga0075429_1001328614 207
198 3300006880 Ga0075429_100382752 Ga0075429_1003827522 207
199 3300006881 Ga0068865_100063173 Ga0068865_1000631733 207
200 3300006881 Ga0068865_100109198 Ga0068865_1001091982 207
201 3300006881 Ga0068865_100191352 Ga0068865_1001913522 207
202 3300006881 Ga0068865_100336611 Ga0068865_1003366112 207
203 3300007076 Ga0075435_100012895 Ga0075435_1000128956 207
204 3300007076 Ga0075435_100323498 Ga0075435_1003234982 207
205 3300009011 Ga0105251_10052177 Ga0105251_100521772 207
206 3300009094 Ga0111539_10047773 Ga0111539_100477732 207
207 3300009094 Ga0111539_10259866 Ga0111539_102598662 207
208 3300009094 Ga0111539_10444270 Ga0111539_104442702 207
209 3300009098 Ga0105245_10060419 Ga0105245_100604193 207
210 3300009098 Ga0105245_10072307 Ga0105245_100723072 207
211 3300009098 Ga0105245_10186639 Ga0105245_101866392 207
212 3300009098 Ga0105245_10569603 Ga0105245_105696032 207
213 3300009147 Ga0114129_10009240 Ga0114129_1000924014 207
214 3300009147 Ga0114129_10025791 Ga0114129_100257915 207
215 3300009147 Ga0114129_10048271 Ga0114129_100482715 207
216 3300009147 Ga0114129_10081207 Ga0114129_100812074 207
217 3300009147 Ga0114129_10257484 Ga0114129_102574842 207
218 3300009147 Ga0114129_10339857 Ga0114129_103398572 207
219 3300009147 Ga0114129_10542502 Ga0114129_105425022 207
220 3300009148 Ga0105243_10012242 Ga0105243_100122425 207
221 3300009148 Ga0105243_10052502 Ga0105243_100525024 207
222 3300009148 Ga0105243_10054694 Ga0105243_100546942 207
223 3300009148 Ga0105243_10058923 Ga0105243_100589233 207
224 3300009148 Ga0105243_10075060 Ga0105243_100750603 207
225 3300009148 Ga0105243_10120740 Ga0105243_101207402 207
226 3300009176 Ga0105242_10003933 Ga0105242_100039332 207
227 3300009176 Ga0105242_10015992 Ga0105242_100159927 207
228 3300009176 Ga0105242_10140887 Ga0105242_101408872 207
229 3300009177 Ga0105248_10217043 Ga0105248_102170432 207
230 3300009177 Ga0105248_10429992 Ga0105248_104299922 207
231 3300009551 Ga0105238_10067436 Ga0105238_100674363 207
232 3300009553 Ga0105249_10122412 Ga0105249_101224124 207
233 3300009553 Ga0105249_10297360 Ga0105249_102973602 207
234 3300011119 Ga0105246_10015599 Ga0105246_100155993 207
235 3300011119 Ga0105246_10038980 Ga0105246_100389804 207
236 3300011119 Ga0105246_10142783 Ga0105246_101427832 207
237 3300013296 Ga0157374_10036695 Ga0157374_100366953 207
238 3300013297 Ga0157378_10089576 Ga0157378_100895762 207
239 3300013297 Ga0157378_10383227 Ga0157378_103832272 207
240 3300013297 Ga0157378_10425472 Ga0157378_104254722 207
241 3300013297 Ga0157378_10425655 Ga0157378_104256552 207
242 3300013297 Ga0157378_10543036 Ga0157378_105430362 207
243 3300013308 Ga0157375_10032734 Ga0157375_100327343 207
244 3300013308 Ga0157375_10100613 Ga0157375_101006132 207
245 3300013308 Ga0157375_10286967 Ga0157375_102869671 207
246 3300014325 Ga0163163_10001408 Ga0163163_100014087 207
247 3300014325 Ga0163163_10088893 Ga0163163_100888933 207
248 3300014325 Ga0163163_10472374 Ga0163163_104723742 207
249 3300014326 Ga0157380_10402848 Ga0157380_104028482 207
250 3300014326 Ga0157380_10752859 Ga0157380_107528592 207
251 3300014326 Ga0157380_11036980 Ga0157380_110369801 207
252 3300014326 Ga0157380_11404527 Ga0157380_114045272 207
253 3300014326 Ga0157380_11666167 Ga0157380_116661671 207
254 3300014745 Ga0157377_10035761 Ga0157377_100357613 207
255 3300014745 Ga0157377_10118610 Ga0157377_101186102 207
256 3300014968 Ga0157379_10224139 Ga0157379_102241392 207
257 3300014968 Ga0157379_10395446 Ga0157379_103954462 207
258 3300014968 Ga0157379_10479367 Ga0157379_104793672 207
259 3300014969 Ga0157376_10428912 Ga0157376_104289122 207
260 3300017792 Ga0163161_10806803 Ga0163161_108068031 207
261 3300025735 Ga0207713_1044347 Ga0207713_10443472 207
262 3300025885 Ga0207653_10000010 Ga0207653_1000001036 207
263 3300025885 Ga0207653_10003356 Ga0207653_100033564 207
264 3300025898 Ga0207692_10002955 Ga0207692_100029556 207
265 3300025901 Ga0207688_10002728 Ga0207688_100027282 207
266 3300025904 Ga0207647_10035041 Ga0207647_100350414 207
267 3300025907 Ga0207645_10005796 Ga0207645_100057967 207
268 3300025908 Ga0207643_10000427 Ga0207643_1000042718 207
269 3300025908 Ga0207643_10034063 Ga0207643_100340632 207
270 3300025908 Ga0207643_10080644 Ga0207643_100806443 207
271 3300025910 Ga0207684_10000160 Ga0207684_1000016082 207
272 3300025910 Ga0207684_10320720 Ga0207684_103207202 207
273 3300025910 Ga0207684_10368617 Ga0207684_103686172 207
274 3300025915 Ga0207693_10000862 Ga0207693_1000086213 207
275 3300025918 Ga0207662_10157055 Ga0207662_101570552 207
276 3300025922 Ga0207646_10203228 Ga0207646_102032282 207
277 3300025925 Ga0207650_10008407 Ga0207650_100084072 207
278 3300025926 Ga0207659_10042950 Ga0207659_100429502 207
279 3300025926 Ga0207659_10317892 Ga0207659_103178922 207
280 3300025927 Ga0207687_10013352 Ga0207687_100133527 207
281 3300025927 Ga0207687_10612571 Ga0207687_106125712 207
282 3300025932 Ga0207690_10097096 Ga0207690_100970962 207
283 3300025934 Ga0207686_10025998 Ga0207686_100259982 207
284 3300025935 Ga0207709_10014252 Ga0207709_100142522 207
285 3300025935 Ga0207709_10014541 Ga0207709_100145415 207
286 3300025935 Ga0207709_10106518 Ga0207709_101065182 207
287 3300025936 Ga0207670_10239780 Ga0207670_102397802 207
288 3300025937 Ga0207669_10034223 Ga0207669_100342233 207
289 3300025937 Ga0207669_10769422 Ga0207669_107694222 207
290 3300025938 Ga0207704_10010705 Ga0207704_100107054 207
291 3300025938 Ga0207704_10186454 Ga0207704_101864542 207
292 3300025938 Ga0207704_10416558 Ga0207704_104165582 207
293 3300025939 Ga0207665_10034153 Ga0207665_100341533 207
294 3300025941 Ga0207711_10243534 Ga0207711_102435342 207
295 3300025942 Ga0207689_10007393 Ga0207689_100073933 207
296 3300025945 Ga0207679_10077038 Ga0207679_100770383 207
297 3300025961 Ga0207712_10370892 Ga0207712_103708922 207
298 3300025961 Ga0207712_10440936 Ga0207712_104409362 207
299 3300025961 Ga0207712_10563899 Ga0207712_105638992 207
300 3300025981 Ga0207640_10200093 Ga0207640_102000932 207
301 3300026023 Ga0207677_10226404 Ga0207677_102264042 207
302 3300026035 Ga0207703_10060330 Ga0207703_100603303 207
303 3300026035 Ga0207703_10536185 Ga0207703_105361852 207
304 3300026067 Ga0207678_10059567 Ga0207678_100595675 207
305 3300026075 Ga0207708_10004840 Ga0207708_1000484010 207
306 3300026075 Ga0207708_10017620 Ga0207708_100176205 207
307 3300026075 Ga0207708_10427804 Ga0207708_104278041 207
308 3300026075 Ga0207708_10648525 Ga0207708_106485252 207
309 3300026088 Ga0207641_11097373 Ga0207641_110973731 207
310 3300026089 Ga0207648_10004190 Ga0207648_1000419011 207
311 3300026089 Ga0207648_10148152 Ga0207648_101481522 207
312 3300026089 Ga0207648_10507757 Ga0207648_105077572 207
313 3300026095 Ga0207676_10006125 Ga0207676_100061254 207
314 3300026095 Ga0207676_10057138 Ga0207676_100571383 207
315 3300026116 Ga0207674_10001990 Ga0207674_100019904 207
316 3300026118 Ga0207675_100010000 Ga0207675_1000100004 207
317 3300026118 Ga0207675_100030824 Ga0207675_1000308242 207
318 3300026118 Ga0207675_100241999 Ga0207675_1002419992 207
319 3300026121 Ga0207683_10002897 Ga0207683_100028972 207
320 3300026121 Ga0207683_10161031 Ga0207683_101610312 207
321 3300026142 Ga0207698_10247089 Ga0207698_102470892 207
322 3300027907 Ga0207428_10003462 Ga0207428_1000346211 207
323 3300027907 Ga0207428_10034775 Ga0207428_100347754 207
324 3300027907 Ga0207428_10035985 Ga0207428_100359852 207
325 3300027907 Ga0207428_10255343 Ga0207428_102553432 207
326 3300028381 Ga0268264_10205674 Ga0268264_102056742 207
327 3300028381 Ga0268264_10473059 Ga0268264_104730592 207
328 3300032002 Ga0307416_100463594 Ga0307416_1004635942 207
329 3300035083 Ga0373926_0000125 Ga0373926_0000125_12263_12886 207
330 3300035089 Ga0373944_0000010 Ga0373944_0000010_11216_11839 207
331 3300035091 Ga0373951_0046218 Ga0373951_0046218_225_848 207
332 3300035111 Ga0373923_0085774 Ga0373923_0085774_330_953 207
333 3300035112 Ga0373932_0043476 Ga0373932_0043476_391_1014 207
334 3300035113 Ga0373936_0050102 Ga0373936_0050102_959_1582 207
335 3300035114 Ga0373939_0026025 Ga0373939_0026025_332_955 207
336 3300035115 Ga0373941_0062214 Ga0373941_0062214_222_845 207
337 3300035116 Ga0373945_0004388 Ga0373945_0004388_2832_3455 207
338 3300035170 Ga0373943_0003882 Ga0373943_0003882_3349_3972 207
339 3300035171 Ga0373946_0001954 Ga0373946_0001954_6234_6857 207
340 3300035241 Ga0373961_0108949 Ga0373961_0108949_12_635 207
341 3300035410 Ga0373924_0008899 Ga0373924_0008899_1095_1718 207
342 3300035691 Ga0373931_0117879 Ga0373931_0117879_364_987 207
343 3300035692 Ga0373935_0004975 Ga0373935_0004975_6008_6631 207
344 3300035695 Ga0373927_0030229 Ga0373927_0030229_2345_2968 207
345 3300035725 Ga0373947_0004480 Ga0373947_0004480_3097_3720 207
346 3300035725 Ga0373947_0007423 Ga0373947_0007423_2869_3492 207
347 3300036401 Ga0373937_0414446 Ga0373937_0414446_277_900 207
348 3300037068 Ga0373925_0010309 Ga0373925_0010309_3718_4341 207
349 3300037068 Ga0373925_0012869 Ga0373925_0012869_959_1582 207
350 3300037312 Ga0395899_0010262 Ga0395899_0010262_3572_4195 207
351 3300037312 Ga0395899_0042162 Ga0395899_0042162_495_1118 207
352 3300037312 Ga0395899_0059542 Ga0395899_0059542_1657_2280 207
353 3300037418 Ga0395900_0009135 Ga0395900_0009135_3495_4118 207
354 3300037418 Ga0395900_0037385 Ga0395900_0037385_1445_2068 207
355 3300037418 Ga0395900_0039519 Ga0395900_0039519_620_1243 207
356 3300037418 Ga0395900_0410046 Ga0395900_0410046_254_877 207
357 3300037466 Ga0395898_0145072 Ga0395898_0145072_712_1335 207
358 3300037466 Ga0395898_0171527 Ga0395898_0171527_867_1490 207
359 3300037471 Ga0395905_0008136 Ga0395905_0008136_867_1490 207
360 3300037471 Ga0395905_0035730 Ga0395905_0035730_1149_1772 207
361 3300037471 Ga0395905_0131466 Ga0395905_0131466_1054_1677 207
362 3300037471 Ga0395905_0334442 Ga0395905_0334442_87_710 207
363 3300038443 Ga0395901_0003279 Ga0395901_0003279_9382_10005 207
364 3300038443 Ga0395901_0015014 Ga0395901_0015014_983_1606 207
365 3300038443 Ga0395901_0031555 Ga0395901_0031555_1253_1876 207
366 3300038443 Ga0395901_0066764 Ga0395901_0066764_1976_2599 207
367 3300038443 Ga0395901_0342294 Ga0395901_0342294_292_915 207
368 3300038443 Ga0395901_0809112 Ga0395901_0809112_75_698 207
369 3300042003 Ga0439443_029644 Ga0439443_029644_145_768 207
370 3300042005 Ga0439448_0063639 Ga0439448_0063639_338_961 207
371 3300042008 Ga0439450_032341 Ga0439450_032341_217_840 207
372 3300042532 Ga0450893_0018496 Ga0450893_0018496_264_887 207
373 3300042993 Ga0439440_0033172 Ga0439440_0033172_77_700 207
374 3300046453 Ga0495627_016010 Ga0495627_016010_1447_2070 207
375 3300046453 Ga0495627_041781 Ga0495627_041781_532_1155 207
376 3300046454 Ga0495592_0172491 Ga0495592_0172491_704_1330 207
377 3300046455 Ga0495603_0004579 Ga0495603_0004579_3983_4606 207
378 3300046455 Ga0495603_0011637 Ga0495603_0011637_895_1518 207
379 3300046455 Ga0495603_0017730 Ga0495603_0017730_3291_3914 207
380 3300046458 Ga0495591_041878 Ga0495591_041878_660_1283 207
381 3300046459 Ga0495629_0001109 Ga0495629_0001109_16040_16663 207
382 3300046459 Ga0495629_0001444 Ga0495629_0001444_6321_6944 207
383 3300046461 Ga0495641_0003130 Ga0495641_0003130_5244_5867 207
384 3300046461 Ga0495641_0029947 Ga0495641_0029947_1478_2101 207
385 3300046463 Ga0495653_0057245 Ga0495653_0057245_1233_1856 207
386 3300046472 Ga0495580_0073210 Ga0495580_0073210_1517_2140 207
387 3300046472 Ga0495580_0131205 Ga0495580_0131205_1013_1636 207
388 3300046473 Ga0495582_0003894 Ga0495582_0003894_1969_2592 207
389 3300046473 Ga0495582_0256575 Ga0495582_0256575_195_818 207
390 3300046474 Ga0495605_0045120 Ga0495605_0045120_1071_1694 207
391 3300046474 Ga0495605_0122021 Ga0495605_0122021_111_734 207
392 3300046475 Ga0495639_0009337 Ga0495639_0009337_572_1195 207
393 3300046475 Ga0495639_0011606 Ga0495639_0011606_356_979 207
394 3300046475 Ga0495639_0184464 Ga0495639_0184464_361_984 207
395 3300046475 Ga0495639_0189208 Ga0495639_0189208_51_674 207
396 3300046476 Ga0495662_0002966 Ga0495662_0002966_2439_3062 207
397 3300046491 Ga0495584_0076420 Ga0495584_0076420_107_730 207
398 3300046491 Ga0495584_0136710 Ga0495584_0136710_191_814 207
399 3300046491 Ga0495584_0140733 Ga0495584_0140733_276_899 207
400 3300046491 Ga0495584_0229344 Ga0495584_0229344_286_909 207
401 3300046492 Ga0495585_0009316 Ga0495585_0009316_2533_3156 207
402 3300046492 Ga0495585_0035576 Ga0495585_0035576_976_1599 207
403 3300046499 Ga0495594_0010551 Ga0495594_0010551_2928_3551 207
404 3300046499 Ga0495594_0014179 Ga0495594_0014179_252_875 207
405 3300046499 Ga0495594_0064300 Ga0495594_0064300_1179_1802 207
406 3300046499 Ga0495594_0129451 Ga0495594_0129451_541_1164 207
407 3300046500 Ga0495596_0063124 Ga0495596_0063124_737_1360 207
408 3300046500 Ga0495596_0122329 Ga0495596_0122329_163_786 207
409 3300046501 Ga0495607_0112525 Ga0495607_0112525_241_864 207
410 3300046501 Ga0495607_0213883 Ga0495607_0213883_93_716 207
411 3300046506 Ga0495583_0066878 Ga0495583_0066878_162_785 207
412 3300046514 Ga0495618_0034958 Ga0495618_0034958_2472_3098 207
413 3300046514 Ga0495618_0107212 Ga0495618_0107212_50_676 207
414 3300046517 Ga0495630_0002369 Ga0495630_0002369_3224_3847 207
415 3300046517 Ga0495630_0328591 Ga0495630_0328591_384_1010 207
416 3300046517 Ga0495630_0576915 Ga0495630_0576915_159_782 207
417 3300046518 Ga0495631_0041846 Ga0495631_0041846_785_1408 207
418 3300046523 Ga0495644_0021649 Ga0495644_0021649_1028_1651 207
419 3300046523 Ga0495644_0062354 Ga0495644_0062354_213_836 207
420 3300046523 Ga0495644_0081274 Ga0495644_0081274_202_825 207
421 3300046525 Ga0495663_0004574 Ga0495663_0004574_1428_2051 207
422 3300046525 Ga0495663_0005838 Ga0495663_0005838_2326_2949 207
423 3300046526 Ga0495666_0000679 Ga0495666_0000679_11360_11983 207
424 3300046528 Ga0495642_0032426 Ga0495642_0032426_685_1308 207
425 3300046531 Ga0495665_0000073 Ga0495665_0000073_35979_36602 207
426 3300046531 Ga0495665_0008503 Ga0495665_0008503_1624_2247 207
427 3300046531 Ga0495665_0019239 Ga0495665_0019239_2813_3436 207
428 3300046533 Ga0495640_0006425 Ga0495640_0006425_2649_3272 207
429 3300046533 Ga0495640_0215386 Ga0495640_0215386_121_744 207
430 3300046535 Ga0495586_0006826 Ga0495586_0006826_89_712 207
431 3300046535 Ga0495586_0046367 Ga0495586_0046367_1104_1727 207
432 3300046537 Ga0495598_0001351 Ga0495598_0001351_31_654 207
433 3300046538 Ga0495609_0007774 Ga0495609_0007774_3360_3983 207
434 3300046538 Ga0495609_0140764 Ga0495609_0140764_29_652 207
435 3300046539 Ga0495621_0010224 Ga0495621_0010224_1780_2403 207
436 3300046539 Ga0495621_0026286 Ga0495621_0026286_1120_1743 207
437 3300046539 Ga0495621_0069082 Ga0495621_0069082_296_919 207
438 3300046559 Ga0495667_0143852 Ga0495667_0143852_879_1502 207
439 3300046615 Ga0495656_0000313 Ga0495656_0000313_13667_14290 207
440 3300046615 Ga0495656_0107347 Ga0495656_0107347_126_749 207
441 3300046615 Ga0495656_0114393 Ga0495656_0114393_40_663 207
442 3300046615 Ga0495656_0170423 Ga0495656_0170423_204_827 207
443 3300046642 Ga0495634_0004835 Ga0495634_0004835_4397_5020 207
444 3300046648 Ga0495611_0215325 Ga0495611_0215325_18_641 207
445 3300046663 Ga0495635_0001368 Ga0495635_0001368_5154_5777 207
446 3300046664 Ga0495659_0041581 Ga0495659_0041581_789_1412 207
447 3300046664 Ga0495659_0268435 Ga0495659_0268435_76_699 207
448 3300046674 Ga0495588_0000418 Ga0495588_0000418_3224_3847 207
449 3300046674 Ga0495588_0004957 Ga0495588_0004957_4846_5469 207
450 3300046674 Ga0495588_0163439 Ga0495588_0163439_398_1021 207
451 3300046681 Ga0495647_0000379 Ga0495647_0000379_2695_3318 207
452 3300046681 Ga0495647_0147060 Ga0495647_0147060_370_993 207
453 3300046683 Ga0495658_0001073 Ga0495658_0001073_4067_4690 207
454 3300046683 Ga0495658_0003070 Ga0495658_0003070_3647_4270 207
455 3300046683 Ga0495658_0494317 Ga0495658_0494317_58_681 207
456 3300046684 Ga0495669_0250769 Ga0495669_0250769_144_767 207
457 3300046689 Ga0495613_0001308 Ga0495613_0001308_17961_18584 207
458 3300046689 Ga0495613_0001902 Ga0495613_0001902_14165_14788 207
459 3300046689 Ga0495613_0011942 Ga0495613_0011942_3780_4403 207
460 3300046690 Ga0495624_0002222 Ga0495624_0002222_2695_3318 207
461 3300046690 Ga0495624_0100888 Ga0495624_0100888_695_1318 207
462 3300046691 Ga0495670_0012491 Ga0495670_0012491_2257_2880 207
463 3300046691 Ga0495670_0092866 Ga0495670_0092866_611_1234 207
464 3300046691 Ga0495670_0173707 Ga0495670_0173707_489_1112 207
465 3300046692 Ga0495671_0141060 Ga0495671_0141060_102_725 207
466 3300046794 Ga0495589_0110129 Ga0495589_0110129_272_895 207
467 3300047315 Ga0495581_0002452 Ga0495581_0002452_9528_10151 207
468 3300047315 Ga0495581_0016562 Ga0495581_0016562_2345_2968 207
469 3300047315 Ga0495581_0018904 Ga0495581_0018904_1619_2242 207
470 3300047315 Ga0495581_0019909 Ga0495581_0019909_2940_3563 207
471 3300047318 Ga0495636_0042980 Ga0495636_0042980_810_1433 207
472 3300047319 Ga0495674_0017706 Ga0495674_0017706_2668_3291 207
473 3300047321 Ga0495676_0048865 Ga0495676_0048865_567_1190 207
474 3300047321 Ga0495676_0334797 Ga0495676_0334797_360_983 207
475 3300047322 Ga0495680_0003484 Ga0495680_0003484_3349_3972 207
476 3300047445 Ga0495677_0037073 Ga0495677_0037073_585_1208 207
477 3300047445 Ga0495677_0266343 Ga0495677_0266343_26_649 207
478 3300047471 Ga0495684_0024980 Ga0495684_0024980_1661_2284 207
479 3300047673 Ga0495593_0001860 Ga0495593_0001860_1316_1939 207
480 3300047673 Ga0495593_0445248 Ga0495593_0445248_13_636 207
481 3300048089 Ga0495614_0012235 Ga0495614_0012235_2822_3445 207
482 3300048089 Ga0495614_0049634 Ga0495614_0049634_469_1092 207
483 3300048090 Ga0495615_0005517 Ga0495615_0005517_955_1578 207
484 3300048903 Ga0496100_0056226 Ga0496100_0056226_108_731 207
485 3300048904 Ga0496101_0097221 Ga0496101_0097221_560_1183 207
486 3300048905 Ga0496102_0089947 Ga0496102_0089947_2107_2730 207
487 3300048905 Ga0496102_0703442 Ga0496102_0703442_265_888 207
488 3300048906 Ga0496103_0037023 Ga0496103_0037023_263_886 207
489 3300048907 Ga0496104_0384635 Ga0496104_0384635_561_1184 207
490 3300048909 Ga0496106_0016777 Ga0496106_0016777_4345_4968 207
491 3300048909 Ga0496106_0260903 Ga0496106_0260903_656_1279 207
492 3300048910 Ga0496107_0077734 Ga0496107_0077734_1566_2189 207
493 3300048911 Ga0496108_0037155 Ga0496108_0037155_3303_3926 207
494 3300048911 Ga0496108_0402716 Ga0496108_0402716_79_702 207
495 3300048912 Ga0496109_0002327 Ga0496109_0002327_10837_11460 207
496 3300048912 Ga0496109_0205344 Ga0496109_0205344_691_1314 207
497 3300048913 Ga0496110_0049391 Ga0496110_0049391_448_1071 207
498 3300048914 Ga0496111_0027400 Ga0496111_0027400_229_852 207
499 3300048915 Ga0496112_0093846 Ga0496112_0093846_676_1299 207
500 3300048916 Ga0496113_0861776 Ga0496113_0861776_28_651 207
501 3300048917 Ga0496114_0036014 Ga0496114_0036014_2130_2753 207
502 3300049568 Ga0501031_0028597 Ga0501031_0028597_2007_2630 207
503 3300049568 Ga0501031_0062378 Ga0501031_0062378_1361_1984 207
504 3300049568 Ga0501031_0168156 Ga0501031_0168156_246_869 207
505 3300049569 Ga0501032_0021284 Ga0501032_0021284_12_635 207
506 3300049570 Ga0501033_0041979 Ga0501033_0041979_1778_2401 207
507 3300049571 Ga0501034_0018577 Ga0501034_0018577_3562_4185 207
508 3300049572 Ga0501036_0097950 Ga0501036_0097950_1146_1769 207
509 3300049572 Ga0501036_0119925 Ga0501036_0119925_1085_1708 207
510 3300049572 Ga0501036_1003360 Ga0501036_1003360_35_658 207
511 3300049573 Ga0501037_0008371 Ga0501037_0008371_2496_3119 207
512 3300049574 Ga0501038_0004634 Ga0501038_0004634_9569_10192 207
513 3300049574 Ga0501038_0019322 Ga0501038_0019322_2056_2679 207
514 3300049574 Ga0501038_0031058 Ga0501038_0031058_3015_3638 207
515 3300049575 Ga0501039_0023190 Ga0501039_0023190_1302_1925 207
516 3300049575 Ga0501039_0067357 Ga0501039_0067357_1469_2092 207
517 3300049576 Ga0501040_0021703 Ga0501040_0021703_2411_3034 207
518 3300049576 Ga0501040_0248134 Ga0501040_0248134_41_664 207
519 3300049576 Ga0501040_0424401 Ga0501040_0424401_57_680 207
520 3300049577 Ga0501041_0015190 Ga0501041_0015190_737_1360 207
521 3300049577 Ga0501041_0023676 Ga0501041_0023676_764_1387 207
522 3300049577 Ga0501041_0024222 Ga0501041_0024222_1367_1990 207
523 3300049578 Ga0501042_0006723 Ga0501042_0006723_4715_5338 207
524 3300049578 Ga0501042_0044553 Ga0501042_0044553_179_802 207
525 3300049578 Ga0501042_0053599 Ga0501042_0053599_187_810 207
526 3300049579 Ga0501043_0017270 Ga0501043_0017270_3636_4259 207
527 3300049580 Ga0501046_0096462 Ga0501046_0096462_1614_2237 207
528 3300049581 Ga0501047_0164420 Ga0501047_0164420_955_1578 207
529 3300049582 Ga0501048_0011919 Ga0501048_0011919_2065_2688 207
530 3300049582 Ga0501048_0015366 Ga0501048_0015366_1208_1831 207
531 3300049582 Ga0501048_0019749 Ga0501048_0019749_737_1360 207
532 3300049583 Ga0501067_0145652 Ga0501067_0145652_499_1122 207
533 3300049583 Ga0501067_0329401 Ga0501067_0329401_32_655 207
534 3300049584 Ga0501068_0074928 Ga0501068_0074928_1027_1650 207
535 3300049585 Ga0501069_0003125 Ga0501069_0003125_3575_4198 207
536 3300049585 Ga0501069_0089762 Ga0501069_0089762_429_1052 207
537 3300049586 Ga0501070_0016930 Ga0501070_0016930_1948_2571 207
538 3300049586 Ga0501070_0179207 Ga0501070_0179207_300_923 207
539 3300049587 Ga0501071_0053792 Ga0501071_0053792_1208_1831 207
540 3300049588 Ga0501072_0019158 Ga0501072_0019158_1613_2236 207
541 3300049588 Ga0501072_0033954 Ga0501072_0033954_400_1023 207
542 3300049588 Ga0501072_0555490 Ga0501072_0555490_248_871 207
543 3300049589 Ga0501073_0008093 Ga0501073_0008093_3555_4178 207
544 3300049589 Ga0501073_0031653 Ga0501073_0031653_687_1310 207
545 3300049590 Ga0501074_0005966 Ga0501074_0005966_564_1187 207
546 3300049590 Ga0501074_0072707 Ga0501074_0072707_1545_2168 207
547 3300049591 Ga0501075_0035250 Ga0501075_0035250_2538_3161 207
548 3300049591 Ga0501075_0064110 Ga0501075_0064110_1909_2532 207
549 3300049591 Ga0501075_0261120 Ga0501075_0261120_614_1237 207
550 3300049592 Ga0501076_0007561 Ga0501076_0007561_1101_1724 207
551 3300049592 Ga0501076_0008160 Ga0501076_0008160_880_1503 207
552 3300049592 Ga0501076_0018274 Ga0501076_0018274_2075_2698 207
553 3300049592 Ga0501076_0085229 Ga0501076_0085229_1402_2025 207
554 3300049592 Ga0501076_0279942 Ga0501076_0279942_193_816 207
555 3300049593 Ga0501077_0017837 Ga0501077_0017837_1085_1708 207
556 3300049593 Ga0501077_0024873 Ga0501077_0024873_1101_1724 207
557 3300049593 Ga0501077_0050264 Ga0501077_0050264_256_879 207
558 3300049593 Ga0501077_0134628 Ga0501077_0134628_498_1121 207
559 3300049593 Ga0501077_0330018 Ga0501077_0330018_255_878 207
560 3300049593 Ga0501077_0413150 Ga0501077_0413150_64_687 207
561 3300049741 Ga0501079_0033494 Ga0501079_0033494_2229_2852 207
562 3300049741 Ga0501079_0041286 Ga0501079_0041286_1628_2251 207
563 3300049741 Ga0501079_0092401 Ga0501079_0092401_1467_2090 207
564 3300049741 Ga0501079_0221402 Ga0501079_0221402_544_1167 207
565 3300049741 Ga0501079_0502354 Ga0501079_0502354_314_937 207
566 3300049742 Ga0501080_0013456 Ga0501080_0013456_4622_5245 207
567 3300049742 Ga0501080_0301864 Ga0501080_0301864_778_1401 207
568 3300049742 Ga0501080_0407070 Ga0501080_0407070_585_1208 207
569 3300049743 Ga0501081_0015424 Ga0501081_0015424_3397_4020 207
570 3300049743 Ga0501081_0147394 Ga0501081_0147394_988_1611 207
571 3300049743 Ga0501081_0170144 Ga0501081_0170144_608_1231 207
572 3300049744 Ga0501083_0016237 Ga0501083_0016237_2181_2804 207
573 3300049744 Ga0501083_0135835 Ga0501083_0135835_570_1193 207
574 3300049822 Ga0501035_0030944 Ga0501035_0030944_2079_2702 207
575 3300049823 Ga0501044_0007431 Ga0501044_0007431_3646_4269 207
576 3300049823 Ga0501044_0483341 Ga0501044_0483341_89_712 207
577 3300049824 Ga0501045_0012796 Ga0501045_0012796_2792_3415 207
578 3300049824 Ga0501045_0084957 Ga0501045_0084957_1059_1682 207
579 3300049824 Ga0501045_0100451 Ga0501045_0100451_708_1331 207
580 3300050507 nmdc:mga05p37_10596_c1 nmdc:mga05p37_10596_c1_9765_10388 207
581 3300050507 nmdc:mga05p37_134457_c1 nmdc:mga05p37_134457_c1_2290_2913 207
582 3300050507 nmdc:mga05p37_146257_c1 nmdc:mga05p37_146257_c1_1003_1626 207
583 3300050507 nmdc:mga05p37_277187_c1 nmdc:mga05p37_277187_c1_855_1478 207
584 3300050507 nmdc:mga05p37_42514_c1 nmdc:mga05p37_42514_c1_2977_3600 207
585 3300050507 nmdc:mga05p37_778473_c1 nmdc:mga05p37_778473_c1_141_764 207
586 3300050507 nmdc:mga05p37_78472_c1 nmdc:mga05p37_78472_c1_3073_3696 207
587 3300050508 nmdc:mga09592_237736_c1 nmdc:mga09592_237736_c1_749_1372 207
588 3300050508 nmdc:mga09592_2556_c1 nmdc:mga09592_2556_c1_8152_8775 207
589 3300050508 nmdc:mga09592_312257_c1 nmdc:mga09592_312257_c1_226_849 207
590 3300050509 nmdc:mga0qj67_401_c1 nmdc:mga0qj67_401_c1_12148_12771 207
591 3300050510 nmdc:mga06r32_114873_c1 nmdc:mga06r32_114873_c1_132_755 207
592 3300050510 nmdc:mga06r32_79363_c1 nmdc:mga06r32_79363_c1_1998_2621 207
593 3300050510 nmdc:mga06r32_85686_c1 nmdc:mga06r32_85686_c1_1238_1861 207
594 3300050511 nmdc:mga08y16_186831_c1 nmdc:mga08y16_186831_c1_923_1546 207
595 3300050511 nmdc:mga08y16_45503_c1 nmdc:mga08y16_45503_c1_3893_4516 207
596 3300050511 nmdc:mga08y16_807413_c1 nmdc:mga08y16_807413_c1_177_800 207
597 3300050511 nmdc:mga08y16_91690_c1 nmdc:mga08y16_91690_c1_275_898 207
598 3300050512 nmdc:mga0n895_130902_c1 nmdc:mga0n895_130902_c1_757_1380 207
599 3300050512 nmdc:mga0n895_20970_c1 nmdc:mga0n895_20970_c1_804_1427 207
600 3300050512 nmdc:mga0n895_307192_c1 nmdc:mga0n895_307192_c1_86_709 207
601 3300050512 nmdc:mga0n895_88528_c1 nmdc:mga0n895_88528_c1_731_1354 207
602 3300050512 nmdc:mga0n895_900543_c1 nmdc:mga0n895_900543_c1_205_828 207
603 3300050513 nmdc:mga0rr50_247114_c1 nmdc:mga0rr50_247114_c1_562_1185 207
604 3300050515 nmdc:mga0a205_15142_c1 nmdc:mga0a205_15142_c1_4344_4967 207
605 3300050515 nmdc:mga0a205_6301_c1 nmdc:mga0a205_6301_c1_9171_9794 207
606 3300050515 nmdc:mga0a205_75654_c1 nmdc:mga0a205_75654_c1_2455_3078 207
607 3300050515 nmdc:mga0a205_867225_c1 nmdc:mga0a205_867225_c1_56_679 207
608 3300053077 Ga0495601_0008228 Ga0495601_0008228_5269_5895 207
609 3300053083 Ga0495655_0047735 Ga0495655_0047735_10_633 207
610 3300053083 Ga0495655_0068421 Ga0495655_0068421_309_932 207
611 3300053084 Ga0495595_0015178 Ga0495595_0015178_2466_3092 207
612 3300053085 Ga0495619_0001824 Ga0495619_0001824_10578_11201 207
613 3300053085 Ga0495619_0018986 Ga0495619_0018986_3147_3773 207
614 3300054114 Ga0501084_0055716 Ga0501084_0055716_1948_2571 207
615 3300054114 Ga0501084_0158014 Ga0501084_0158014_678_1301 207
616 3300054114 Ga0501084_0198323 Ga0501084_0198323_463_1086 207
617 3300054114 Ga0501084_0694374 Ga0501084_0694374_91_714 207
618 3300059424 Ga0590075_012567 Ga0590075_012567_582_1205 207
619 3300060353 Ga0501082_0026533 Ga0501082_0026533_737_1360 207
620 3300060353 Ga0501082_0045693 Ga0501082_0045693_1313_1936 207
621 3300060353 Ga0501082_0089403 Ga0501082_0089403_1962_2585 207
622 3300060353 Ga0501082_0142473 Ga0501082_0142473_1036_1659 207
623 3300060353 Ga0501082_0151857 Ga0501082_0151857_1063_1686 207
624 3300061734 Ga0530510_0043036 Ga0530510_0043036_1549_2172 207
625 3300061734 Ga0530510_0091330 Ga0530510_0091330_1085_1708 207
626 3300061734 Ga0530510_0129539 Ga0530510_0129539_422_1045 207
627 3300061734 Ga0530510_0144600 Ga0530510_0144600_566_1189 207
628 3300061734 Ga0530510_0228934 Ga0530510_0228934_233_856 207
629 3300037068 Ga0373925_0070861 Ga0373925_0070861_345_1007 211
630 3300037312 Ga0395899_0002330 Ga0395899_0002330_12767_13444 211
631 3300037418 Ga0395900_0001049 Ga0395900_0001049_11177_11854 211
632 3300037466 Ga0395898_0003996 Ga0395898_0003996_7134_7811 211
633 3300037471 Ga0395905_0004519 Ga0395905_0004519_7875_8552 211
634 3300046455 Ga0495603_0004290 Ga0495603_0004290_1962_2624 211
635 3300046473 Ga0495582_0003569 Ga0495582_0003569_8091_8753 211
636 3300046518 Ga0495631_0252642 Ga0495631_0252642_45_707 211
637 3300046615 Ga0495656_0002836 Ga0495656_0002836_2085_2747 211
638 3300046664 Ga0495659_0204292 Ga0495659_0204292_111_752 211
639 3300046794 Ga0495589_0107191 Ga0495589_0107191_662_1324 211
640 3300001976 JGI24752J21851_1005789 JGI24752J21851_10057893 212
641 3300005467 Ga0070706_100345553 Ga0070706_1003455532 212
642 3300046492 Ga0495585_0045353 Ga0495585_0045353_1193_1831 212
643 3300046538 Ga0495609_0043568 Ga0495609_0043568_506_1144 212
644 3300048913 Ga0496110_0194859 Ga0496110_0194859_153_791 212
645 3300048914 Ga0496111_0038698 Ga0496111_0038698_2176_2814 212
646 3300048916 Ga0496113_0070208 Ga0496113_0070208_1365_2003 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

49

196

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.924 47 193
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9143 42 193
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8961 41 184
1sox-assembly1.cif.gz_A sulfite oxidase from chicken liver 0.8952 33 188
2bih-assembly1.cif.gz_A-2 crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase 0.8946 33 184
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9183 42 193 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9062 33 183 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8943 33 184 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8905 33 188 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8892 46 174 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A1G1F991-F1-model_v4 Oxidoreductase 0.9858 20 158
AF-A0A6J7FQQ5-F1-model_v4 Unannotated protein 0.9799 19 203
AF-A0A1Q7C5H5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9797 19 200
AF-A0A3L7QPB5-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9797 20 200
AF-A0A3D5D7B0-F1-model_v4 Sulfite oxidase-like oxidoreductase 0.9795 20 126

Feature Viewer

pLDDT pTM Quality
87.81 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map