F472209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 646 | 290 | 645 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0002330|Ga0395899_0002330_12767_13444 |
| Length | 225 |
| Sequence | MAFGRRVLRSRSDEEGGPVKLFGPRYPEEIAKRIPPGQRLVKTWPVLHFGPIPDFDESTWTLEVNGLVDNPYTLTYSELKDLGPVDVQADMHCVTGWSTLDNTWTGVPFRVLADKAGVQAEAKWVIAHCDYGYTSDLSLQAMLDDDVLVAWAHGGEPLTGEHGFPLRLVIPKRYAWKSAKWLRGLEFSEQNKRGFWEVRGYHVHAEPWAEERYSYQEGPRAELEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 153 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 165 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 166 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 167 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 168 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 169 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.41 |
| Rhizosphere | 96.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1005789 | 3300001976 | Bacteria | 1614 |
| 2 | JGI24751J29686_10000383 | 3300002459 | Bacteria | 14840 |
| 3 | Ga0065707_10131735 | 3300005295 | Bacteria | 1909 |
| 4 | Ga0070676_10012261 | 3300005328 | Bacteria | 4674 |
| 5 | Ga0070690_100001288 | 3300005330 | Bacteria | 13023 |
| 6 | Ga0070690_100098414 | 3300005330 | Unclassified | 1936 |
| 7 | Ga0070690_100392636 | 3300005330 | Bacteria | 1017 |
| 8 | Ga0070670_100006976 | 3300005331 | Bacteria | 9575 |
| 9 | Ga0070670_100113727 | 3300005331 | Bacteria | 2333 |
| 10 | Ga0068869_100034253 | 3300005334 | Bacteria | 3591 |
| 11 | Ga0070680_100059551 | 3300005336 | Bacteria | 3125 |
| 12 | Ga0070689_100072798 | 3300005340 | Bacteria | 2686 |
| 13 | Ga0070691_10161078 | 3300005341 | Unclassified | 1157 |
| 14 | Ga0070687_100085288 | 3300005343 | Bacteria | 1733 |
| 15 | Ga0070661_100017181 | 3300005344 | Bacteria | 5128 |
| 16 | Ga0070692_10339662 | 3300005345 | Bacteria | 930 |
| 17 | Ga0070692_10441844 | 3300005345 | Bacteria | 831 |
| 18 | Ga0070669_100024278 | 3300005353 | Bacteria | 4347 |
| 19 | Ga0070675_100056146 | 3300005354 | Bacteria | 3244 |
| 20 | Ga0070671_100102180 | 3300005355 | Bacteria | 2405 |
| 21 | Ga0070674_100013151 | 3300005356 | Bacteria | 5106 |
| 22 | Ga0070674_100355509 | 3300005356 | Unclassified | 1184 |
| 23 | Ga0070688_100250424 | 3300005365 | Bacteria | 1261 |
| 24 | Ga0070659_100210417 | 3300005366 | Bacteria | 1603 |
| 25 | Ga0070703_10000030 | 3300005406 | Bacteria | 70119 |
| 26 | Ga0070703_10088814 | 3300005406 | Bacteria | 1068 |
| 27 | Ga0070714_100000129 | 3300005435 | Bacteria | 59328 |
| 28 | Ga0070714_100114963 | 3300005435 | Bacteria | 2388 |
| 29 | Ga0070710_10270332 | 3300005437 | Bacteria | 1099 |
| 30 | Ga0070710_10459535 | 3300005437 | Unclassified | 864 |
| 31 | Ga0070701_10020700 | 3300005438 | Bacteria | 3126 |
| 32 | Ga0070701_10187826 | 3300005438 | Bacteria | 1214 |
| 33 | Ga0070711_100039385 | 3300005439 | Bacteria | 3183 |
| 34 | Ga0070700_100002109 | 3300005441 | Bacteria | 10100 |
| 35 | Ga0070700_100045991 | 3300005441 | Bacteria | 2695 |
| 36 | Ga0070700_100111757 | 3300005441 | Unclassified | 1817 |
| 37 | Ga0070700_100744844 | 3300005441 | Bacteria | 783 |
| 38 | Ga0070700_100888041 | 3300005441 | Unclassified | 725 |
| 39 | Ga0070694_100001859 | 3300005444 | Bacteria | 12509 |
| 40 | Ga0070694_100027034 | 3300005444 | Bacteria | 3723 |
| 41 | Ga0070694_100081550 | 3300005444 | Unclassified | 2251 |
| 42 | Ga0070694_100130381 | 3300005444 | Bacteria | 1815 |
| 43 | Ga0070694_100314745 | 3300005444 | Bacteria | 1203 |
| 44 | Ga0070694_100366241 | 3300005444 | Bacteria | 1120 |
| 45 | Ga0070708_100022679 | 3300005445 | Bacteria | 5328 |
| 46 | Ga0070708_100023416 | 3300005445 | Bacteria | 5252 |
| 47 | Ga0070708_100113844 | 3300005445 | Bacteria | 2488 |
| 48 | Ga0070708_100176649 | 3300005445 | Bacteria | 1995 |
| 49 | Ga0070663_100127142 | 3300005455 | Bacteria | 1932 |
| 50 | Ga0070678_100022202 | 3300005456 | Bacteria | 4200 |
| 51 | Ga0070678_100087874 | 3300005456 | Unclassified | 2375 |
| 52 | Ga0070662_100400150 | 3300005457 | Bacteria | 1133 |
| 53 | Ga0068867_100028632 | 3300005459 | Bacteria | 4012 |
| 54 | Ga0068867_100046360 | 3300005459 | Bacteria | 3193 |
| 55 | Ga0068867_100116032 | 3300005459 | Bacteria | 2063 |
| 56 | Ga0068867_100324170 | 3300005459 | Bacteria | 1277 |
| 57 | Ga0070685_10249010 | 3300005466 | Bacteria | 1176 |
| 58 | Ga0070706_100000256 | 3300005467 | Bacteria | 64555 |
| 59 | Ga0070706_100130880 | 3300005467 | Bacteria | 2341 |
| 60 | Ga0070706_100206115 | 3300005467 | Unclassified | 1836 |
| 61 | Ga0070706_100345553 | 3300005467 | Bacteria | 1387 |
| 62 | Ga0070706_100380829 | 3300005467 | Bacteria | 1314 |
| 63 | Ga0070706_100673397 | 3300005467 | Bacteria | 960 |
| 64 | Ga0070707_100001775 | 3300005468 | Bacteria | 20731 |
| 65 | Ga0070707_100091703 | 3300005468 | Bacteria | 2941 |
| 66 | Ga0070707_100105623 | 3300005468 | Bacteria | 2730 |
| 67 | Ga0070707_100225189 | 3300005468 | Bacteria | 1826 |
| 68 | Ga0070707_100226993 | 3300005468 | Bacteria | 1818 |
| 69 | Ga0070707_100243268 | 3300005468 | Bacteria | 1751 |
| 70 | Ga0070707_100364411 | 3300005468 | Unclassified | 1404 |
| 71 | Ga0070707_100540663 | 3300005468 | Bacteria | 1127 |
| 72 | Ga0070698_100000165 | 3300005471 | Bacteria | 60856 |
| 73 | Ga0070698_100000827 | 3300005471 | Bacteria | 33885 |
| 74 | Ga0070698_100064492 | 3300005471 | Bacteria | 3690 |
| 75 | Ga0070698_100285894 | 3300005471 | Bacteria | 1580 |
| 76 | Ga0070698_100495968 | 3300005471 | Bacteria | 1159 |
| 77 | Ga0070699_100018238 | 3300005518 | Bacteria | 6030 |
| 78 | Ga0070699_100053741 | 3300005518 | Bacteria | 3486 |
| 79 | Ga0070699_100068945 | 3300005518 | Bacteria | 3073 |
| 80 | Ga0070699_100464788 | 3300005518 | Bacteria | 1148 |
| 81 | Ga0070684_100006153 | 3300005535 | Bacteria | 9253 |
| 82 | Ga0070684_100389505 | 3300005535 | Bacteria | 1284 |
| 83 | Ga0070697_100008022 | 3300005536 | Bacteria | 8232 |
| 84 | Ga0070697_100049567 | 3300005536 | Bacteria | 3408 |
| 85 | Ga0070697_100070217 | 3300005536 | Bacteria | 2871 |
| 86 | Ga0070697_100126138 | 3300005536 | Unclassified | 2144 |
| 87 | Ga0070697_101041903 | 3300005536 | Bacteria | 728 |
| 88 | Ga0070686_100002999 | 3300005544 | Bacteria | 9250 |
| 89 | Ga0070686_100284570 | 3300005544 | Bacteria | 1221 |
| 90 | Ga0070695_100046700 | 3300005545 | Unclassified | 2763 |
| 91 | Ga0070695_100314381 | 3300005545 | Bacteria | 1162 |
| 92 | Ga0070696_100004343 | 3300005546 | Bacteria | 9447 |
| 93 | Ga0070696_100024491 | 3300005546 | Bacteria | 4103 |
| 94 | Ga0070693_100030656 | 3300005547 | Bacteria | 2942 |
| 95 | Ga0070704_100003309 | 3300005549 | Bacteria | 9221 |
| 96 | Ga0070704_100050940 | 3300005549 | Bacteria | 2913 |
| 97 | Ga0070704_100221435 | 3300005549 | Bacteria | 1539 |
| 98 | Ga0070704_100249524 | 3300005549 | Bacteria | 1457 |
| 99 | Ga0070704_100555208 | 3300005549 | Bacteria | 1004 |
| 100 | Ga0070664_100002319 | 3300005564 | Bacteria | 15284 |
| 101 | Ga0068857_100022120 | 3300005577 | Bacteria | 5593 |
| 102 | Ga0068854_100393036 | 3300005578 | Unclassified | 1145 |
| 103 | Ga0068854_100543246 | 3300005578 | Bacteria | 984 |
| 104 | Ga0070702_100025964 | 3300005615 | Bacteria | 3143 |
| 105 | Ga0068852_100115978 | 3300005616 | Bacteria | 2443 |
| 106 | Ga0068859_100289817 | 3300005617 | Unclassified | 1730 |
| 107 | Ga0068864_100041579 | 3300005618 | Bacteria | 3932 |
| 108 | Ga0068864_100064581 | 3300005618 | Bacteria | 3175 |
| 109 | Ga0068864_100074187 | 3300005618 | Bacteria | 2968 |
| 110 | Ga0068866_10021883 | 3300005718 | Bacteria | 2951 |
| 111 | Ga0068866_10422290 | 3300005718 | Bacteria | 865 |
| 112 | Ga0068861_100341530 | 3300005719 | Bacteria | 1310 |
| 113 | Ga0068861_100449866 | 3300005719 | Unclassified | 1154 |
| 114 | Ga0068851_10055213 | 3300005834 | Bacteria | 2023 |
| 115 | Ga0068870_10000226 | 3300005840 | Bacteria | 20692 |
| 116 | Ga0068870_10066093 | 3300005840 | Bacteria | 1958 |
| 117 | Ga0068863_100028894 | 3300005841 | Bacteria | 5295 |
| 118 | Ga0068863_100149551 | 3300005841 | Unclassified | 2234 |
| 119 | Ga0068863_100426853 | 3300005841 | Bacteria | 1299 |
| 120 | Ga0068858_100771972 | 3300005842 | Bacteria | 937 |
| 121 | Ga0068858_100933345 | 3300005842 | Unclassified | 849 |
| 122 | Ga0068860_100158437 | 3300005843 | Unclassified | 2182 |
| 123 | Ga0068860_100760754 | 3300005843 | Bacteria | 981 |
| 124 | Ga0068860_101487317 | 3300005843 | Unclassified | 699 |
| 125 | Ga0068862_100053790 | 3300005844 | Bacteria | 3447 |
| 126 | Ga0081455_10005219 | 3300005937 | Bacteria | 14289 |
| 127 | Ga0081455_10008629 | 3300005937 | Bacteria | 10567 |
| 128 | Ga0081455_10099271 | 3300005937 | Bacteria | 2342 |
| 129 | Ga0081455_10246985 | 3300005937 | Bacteria | 1308 |
| 130 | Ga0081538_10026269 | 3300005981 | Bacteria | 4076 |
| 131 | Ga0081539_10022550 | 3300005985 | Bacteria | 4161 |
| 132 | Ga0081539_10040675 | 3300005985 | Bacteria | 2727 |
| 133 | Ga0081539_10055955 | 3300005985 | Bacteria | 2192 |
| 134 | Ga0070716_100076847 | 3300006173 | Bacteria | 1980 |
| 135 | Ga0070712_100008229 | 3300006175 | Bacteria | 6552 |
| 136 | Ga0097621_100015984 | 3300006237 | Bacteria | 5659 |
| 137 | Ga0075428_100076851 | 3300006844 | Bacteria | 3645 |
| 138 | Ga0075428_100135738 | 3300006844 | Bacteria | 2675 |
| 139 | Ga0075428_100392298 | 3300006844 | Bacteria | 1488 |
| 140 | Ga0075430_100000348 | 3300006846 | Bacteria | 33561 |
| 141 | Ga0075430_100141761 | 3300006846 | Bacteria | 2001 |
| 142 | Ga0075431_100000742 | 3300006847 | Bacteria | 28178 |
| 143 | Ga0075431_100047088 | 3300006847 | Bacteria | 4446 |
| 144 | Ga0075431_100079392 | 3300006847 | Bacteria | 3387 |
| 145 | Ga0075433_10000393 | 3300006852 | Bacteria | 27755 |
| 146 | Ga0075433_10011979 | 3300006852 | Bacteria | 6992 |
| 147 | Ga0075434_100002976 | 3300006871 | Bacteria | 15076 |
| 148 | Ga0075434_100078593 | 3300006871 | Bacteria | 3295 |
| 149 | Ga0075434_100092307 | 3300006871 | Bacteria | 3030 |
| 150 | Ga0075434_100957745 | 3300006871 | Bacteria | 870 |
| 151 | Ga0075429_100003403 | 3300006880 | Bacteria | 13562 |
| 152 | Ga0075429_100132861 | 3300006880 | Bacteria | 2178 |
| 153 | Ga0075429_100382752 | 3300006880 | Unclassified | 1232 |
| 154 | Ga0068865_100063173 | 3300006881 | Bacteria | 2602 |
| 155 | Ga0068865_100109198 | 3300006881 | Bacteria | 2038 |
| 156 | Ga0068865_100191352 | 3300006881 | Bacteria | 1582 |
| 157 | Ga0068865_100336611 | 3300006881 | Unclassified | 1218 |
| 158 | Ga0075435_100012895 | 3300007076 | Bacteria | 6200 |
| 159 | Ga0075435_100323498 | 3300007076 | Bacteria | 1320 |
| 160 | Ga0105251_10052177 | 3300009011 | Bacteria | 1948 |
| 161 | Ga0111539_10047773 | 3300009094 | Bacteria | 5115 |
| 162 | Ga0111539_10259866 | 3300009094 | Bacteria | 2021 |
| 163 | Ga0111539_10444270 | 3300009094 | Bacteria | 1510 |
| 164 | Ga0105245_10060419 | 3300009098 | Bacteria | 3413 |
| 165 | Ga0105245_10072307 | 3300009098 | Bacteria | 3133 |
| 166 | Ga0105245_10186639 | 3300009098 | Bacteria | 1984 |
| 167 | Ga0105245_10569603 | 3300009098 | Bacteria | 1156 |
| 168 | Ga0114129_10009240 | 3300009147 | Bacteria | 14062 |
| 169 | Ga0114129_10025791 | 3300009147 | Bacteria | 8325 |
| 170 | Ga0114129_10048271 | 3300009147 | Bacteria | 5982 |
| 171 | Ga0114129_10081207 | 3300009147 | Bacteria | 4507 |
| 172 | Ga0114129_10257484 | 3300009147 | Bacteria | 2340 |
| 173 | Ga0114129_10339857 | 3300009147 | Bacteria | 1991 |
| 174 | Ga0114129_10401849 | 3300009147 | Bacteria | 1805 |
| 175 | Ga0114129_10542502 | 3300009147 | Bacteria | 1513 |
| 176 | Ga0105243_10012242 | 3300009148 | Bacteria | 6487 |
| 177 | Ga0105243_10052502 | 3300009148 | Bacteria | 3229 |
| 178 | Ga0105243_10054694 | 3300009148 | Bacteria | 3169 |
| 179 | Ga0105243_10058923 | 3300009148 | Bacteria | 3062 |
| 180 | Ga0105243_10075060 | 3300009148 | Bacteria | 2744 |
| 181 | Ga0105243_10120740 | 3300009148 | Unclassified | 2209 |
| 182 | Ga0105242_10003933 | 3300009176 | Bacteria | 11547 |
| 183 | Ga0105242_10015992 | 3300009176 | Bacteria | 5831 |
| 184 | Ga0105242_10140887 | 3300009176 | Unclassified | 2092 |
| 185 | Ga0105248_10067611 | 3300009177 | Bacteria | 4012 |
| 186 | Ga0105248_10217043 | 3300009177 | Unclassified | 2154 |
| 187 | Ga0105248_10429992 | 3300009177 | Bacteria | 1487 |
| 188 | Ga0105238_10067436 | 3300009551 | Bacteria | 3579 |
| 189 | Ga0105249_10122412 | 3300009553 | Bacteria | 2474 |
| 190 | Ga0105249_10297360 | 3300009553 | Bacteria | 1618 |
| 191 | Ga0105246_10015599 | 3300011119 | Bacteria | 4800 |
| 192 | Ga0105246_10038980 | 3300011119 | Bacteria | 3198 |
| 193 | Ga0105246_10142783 | 3300011119 | Bacteria | 1802 |
| 194 | Ga0157374_10036695 | 3300013296 | Bacteria | 4492 |
| 195 | Ga0157378_10089576 | 3300013297 | Unclassified | 2795 |
| 196 | Ga0157378_10383227 | 3300013297 | Bacteria | 1381 |
| 197 | Ga0157378_10425472 | 3300013297 | Bacteria | 1313 |
| 198 | Ga0157378_10425655 | 3300013297 | Unclassified | 1313 |
| 199 | Ga0157378_10543036 | 3300013297 | Bacteria | 1166 |
| 200 | Ga0157378_10547140 | 3300013297 | Bacteria | 1162 |
| 201 | Ga0157375_10032734 | 3300013308 | Bacteria | 4933 |
| 202 | Ga0157375_10100613 | 3300013308 | Bacteria | 2972 |
| 203 | Ga0157375_10286967 | 3300013308 | Unclassified | 1809 |
| 204 | Ga0163163_10001408 | 3300014325 | Bacteria | 20316 |
| 205 | Ga0163163_10088893 | 3300014325 | Unclassified | 3101 |
| 206 | Ga0163163_10472374 | 3300014325 | Bacteria | 1315 |
| 207 | Ga0157380_10402848 | 3300014326 | Bacteria | 1299 |
| 208 | Ga0157380_10752859 | 3300014326 | Bacteria | 986 |
| 209 | Ga0157380_11036980 | 3300014326 | Bacteria | 856 |
| 210 | Ga0157380_11404527 | 3300014326 | Unclassified | 749 |
| 211 | Ga0157380_11666167 | 3300014326 | Bacteria | 695 |
| 212 | Ga0157377_10035761 | 3300014745 | Bacteria | 2727 |
| 213 | Ga0157377_10118610 | 3300014745 | Bacteria | 1600 |
| 214 | Ga0157379_10224139 | 3300014968 | Bacteria | 1704 |
| 215 | Ga0157379_10395446 | 3300014968 | Bacteria | 1270 |
| 216 | Ga0157379_10479367 | 3300014968 | Unclassified | 1151 |
| 217 | Ga0157376_10428912 | 3300014969 | Bacteria | 1285 |
| 218 | Ga0163161_10806803 | 3300017792 | Unclassified | 789 |
| 219 | Ga0207713_1044347 | 3300025735 | Bacteria | 1827 |
| 220 | Ga0207653_10000010 | 3300025885 | Bacteria | 165368 |
| 221 | Ga0207653_10003356 | 3300025885 | Bacteria | 5053 |
| 222 | Ga0207692_10002955 | 3300025898 | Bacteria | 6583 |
| 223 | Ga0207688_10002728 | 3300025901 | Bacteria | 9553 |
| 224 | Ga0207647_10035041 | 3300025904 | Bacteria | 3201 |
| 225 | Ga0207645_10005796 | 3300025907 | Bacteria | 8911 |
| 226 | Ga0207643_10000427 | 3300025908 | Bacteria | 27828 |
| 227 | Ga0207643_10034063 | 3300025908 | Unclassified | 2852 |
| 228 | Ga0207643_10080644 | 3300025908 | Bacteria | 1885 |
| 229 | Ga0207684_10000016 | 3300025910 | Bacteria | 409263 |
| 230 | Ga0207684_10000160 | 3300025910 | Bacteria | 115343 |
| 231 | Ga0207684_10320720 | 3300025910 | Bacteria | 1335 |
| 232 | Ga0207684_10368617 | 3300025910 | Bacteria | 1236 |
| 233 | Ga0207684_10552066 | 3300025910 | Bacteria | 985 |
| 234 | Ga0207693_10000862 | 3300025915 | Bacteria | 27068 |
| 235 | Ga0207660_10248716 | 3300025917 | Bacteria | 1403 |
| 236 | Ga0207662_10157055 | 3300025918 | Unclassified | 1451 |
| 237 | Ga0207646_10000205 | 3300025922 | Bacteria | 80302 |
| 238 | Ga0207646_10010984 | 3300025922 | Bacteria | 8794 |
| 239 | Ga0207646_10203228 | 3300025922 | Bacteria | 1790 |
| 240 | Ga0207646_10302111 | 3300025922 | Bacteria | 1446 |
| 241 | Ga0207650_10008407 | 3300025925 | Bacteria | 7046 |
| 242 | Ga0207659_10042950 | 3300025926 | Bacteria | 3172 |
| 243 | Ga0207659_10317892 | 3300025926 | Unclassified | 1283 |
| 244 | Ga0207687_10013352 | 3300025927 | Bacteria | 5363 |
| 245 | Ga0207687_10612571 | 3300025927 | Bacteria | 918 |
| 246 | Ga0207664_10000139 | 3300025929 | Bacteria | 60860 |
| 247 | Ga0207664_10298187 | 3300025929 | Bacteria | 1417 |
| 248 | Ga0207690_10097096 | 3300025932 | Bacteria | 2096 |
| 249 | Ga0207706_10100853 | 3300025933 | Bacteria | 2540 |
| 250 | Ga0207686_10025998 | 3300025934 | Bacteria | 3413 |
| 251 | Ga0207709_10014252 | 3300025935 | Bacteria | 4387 |
| 252 | Ga0207709_10014541 | 3300025935 | Bacteria | 4348 |
| 253 | Ga0207709_10106518 | 3300025935 | Bacteria | 1865 |
| 254 | Ga0207670_10239780 | 3300025936 | Bacteria | 1396 |
| 255 | Ga0207669_10034223 | 3300025937 | Bacteria | 2877 |
| 256 | Ga0207669_10769422 | 3300025937 | Unclassified | 796 |
| 257 | Ga0207704_10010705 | 3300025938 | Bacteria | 4485 |
| 258 | Ga0207704_10186454 | 3300025938 | Bacteria | 1505 |
| 259 | Ga0207704_10416558 | 3300025938 | Unclassified | 1064 |
| 260 | Ga0207665_10034153 | 3300025939 | Bacteria | 3375 |
| 261 | Ga0207665_10042501 | 3300025939 | Bacteria | 3038 |
| 262 | Ga0207711_10243534 | 3300025941 | Bacteria | 1649 |
| 263 | Ga0207689_10007393 | 3300025942 | Bacteria | 9632 |
| 264 | Ga0207679_10077038 | 3300025945 | Bacteria | 2535 |
| 265 | Ga0207679_10546212 | 3300025945 | Unclassified | 1039 |
| 266 | Ga0207712_10370892 | 3300025961 | Bacteria | 1195 |
| 267 | Ga0207712_10440936 | 3300025961 | Bacteria | 1102 |
| 268 | Ga0207712_10563899 | 3300025961 | Bacteria | 981 |
| 269 | Ga0207640_10200093 | 3300025981 | Unclassified | 1513 |
| 270 | Ga0207677_10226404 | 3300026023 | Bacteria | 1503 |
| 271 | Ga0207703_10060330 | 3300026035 | Bacteria | 3101 |
| 272 | Ga0207703_10536185 | 3300026035 | Bacteria | 1102 |
| 273 | Ga0207678_10059567 | 3300026067 | Bacteria | 3285 |
| 274 | Ga0207708_10004840 | 3300026075 | Bacteria | 9922 |
| 275 | Ga0207708_10017620 | 3300026075 | Bacteria | 5377 |
| 276 | Ga0207708_10427804 | 3300026075 | Bacteria | 1099 |
| 277 | Ga0207708_10648525 | 3300026075 | Bacteria | 898 |
| 278 | Ga0207641_11097373 | 3300026088 | Unclassified | 794 |
| 279 | Ga0207648_10004190 | 3300026089 | Bacteria | 14902 |
| 280 | Ga0207648_10148152 | 3300026089 | Bacteria | 2071 |
| 281 | Ga0207648_10507757 | 3300026089 | Bacteria | 1104 |
| 282 | Ga0207676_10006125 | 3300026095 | Bacteria | 8491 |
| 283 | Ga0207676_10057138 | 3300026095 | Bacteria | 3072 |
| 284 | Ga0207674_10001990 | 3300026116 | Bacteria | 25893 |
| 285 | Ga0207675_100010000 | 3300026118 | Bacteria | 8887 |
| 286 | Ga0207675_100030824 | 3300026118 | Bacteria | 4995 |
| 287 | Ga0207675_100241999 | 3300026118 | Unclassified | 1744 |
| 288 | Ga0207683_10002897 | 3300026121 | Bacteria | 14962 |
| 289 | Ga0207683_10161031 | 3300026121 | Unclassified | 2029 |
| 290 | Ga0207698_10247089 | 3300026142 | Bacteria | 1630 |
| 291 | Ga0207428_10003462 | 3300027907 | Bacteria | 15322 |
| 292 | Ga0207428_10034775 | 3300027907 | Bacteria | 4126 |
| 293 | Ga0207428_10035985 | 3300027907 | Bacteria | 4042 |
| 294 | Ga0207428_10255343 | 3300027907 | Bacteria | 1306 |
| 295 | Ga0268264_10205674 | 3300028381 | Bacteria | 1804 |
| 296 | Ga0268264_10473059 | 3300028381 | Bacteria | 1218 |
| 297 | Ga0265328_10034994 | 3300031239 | Bacteria | 1858 |
| 298 | Ga0265327_10000103 | 3300031251 | Bacteria | 185405 |
| 299 | Ga0307416_100463594 | 3300032002 | Bacteria | 1323 |
| 300 | Ga0373926_0000125 | 3300035083 | Bacteria | 15707 |
| 301 | Ga0373944_0000010 | 3300035089 | Bacteria | 36036 |
| 302 | Ga0373951_0046218 | 3300035091 | Bacteria | 1061 |
| 303 | Ga0373923_0085774 | 3300035111 | Bacteria | 1371 |
| 304 | Ga0373932_0043476 | 3300035112 | Bacteria | 1307 |
| 305 | Ga0373936_0050102 | 3300035113 | Unclassified | 1688 |
| 306 | Ga0373939_0026025 | 3300035114 | Bacteria | 1645 |
| 307 | Ga0373941_0062214 | 3300035115 | Bacteria | 1218 |
| 308 | Ga0373945_0004388 | 3300035116 | Bacteria | 4480 |
| 309 | Ga0373953_0095069 | 3300035117 | Bacteria | 1250 |
| 310 | Ga0373943_0003882 | 3300035170 | Bacteria | 6803 |
| 311 | Ga0373946_0001954 | 3300035171 | Bacteria | 7210 |
| 312 | Ga0373946_0117794 | 3300035171 | Bacteria | 1209 |
| 313 | Ga0373955_0049623 | 3300035172 | Bacteria | 2279 |
| 314 | Ga0373955_0117364 | 3300035172 | Bacteria | 1544 |
| 315 | Ga0373961_0108949 | 3300035241 | Bacteria | 905 |
| 316 | Ga0373924_0008899 | 3300035410 | Bacteria | 3665 |
| 317 | Ga0373931_0117879 | 3300035691 | Bacteria | 1514 |
| 318 | Ga0373935_0004975 | 3300035692 | Bacteria | 7818 |
| 319 | Ga0373927_0030229 | 3300035695 | Bacteria | 3534 |
| 320 | Ga0373947_0004480 | 3300035725 | Bacteria | 8198 |
| 321 | Ga0373947_0007423 | 3300035725 | Bacteria | 6347 |
| 322 | Ga0373937_0414446 | 3300036401 | Bacteria | 1278 |
| 323 | Ga0373925_0010309 | 3300037068 | Bacteria | 6780 |
| 324 | Ga0373925_0012869 | 3300037068 | Bacteria | 6060 |
| 325 | Ga0373925_0070861 | 3300037068 | Bacteria | 2636 |
| 326 | Ga0373925_0421936 | 3300037068 | Bacteria | 1090 |
| 327 | Ga0395899_0002330 | 3300037312 | Bacteria | 15461 |
| 328 | Ga0395899_0010262 | 3300037312 | Bacteria | 7179 |
| 329 | Ga0395899_0042162 | 3300037312 | Bacteria | 3408 |
| 330 | Ga0395899_0059542 | 3300037312 | Bacteria | 2815 |
| 331 | Ga0395900_0001049 | 3300037418 | Bacteria | 35386 |
| 332 | Ga0395900_0009135 | 3300037418 | Bacteria | 10152 |
| 333 | Ga0395900_0037385 | 3300037418 | Bacteria | 5006 |
| 334 | Ga0395900_0039519 | 3300037418 | Bacteria | 4861 |
| 335 | Ga0395900_0410046 | 3300037418 | Bacteria | 1317 |
| 336 | Ga0395898_0003996 | 3300037466 | Bacteria | 16226 |
| 337 | Ga0395898_0145072 | 3300037466 | Bacteria | 2272 |
| 338 | Ga0395898_0171527 | 3300037466 | Bacteria | 2074 |
| 339 | Ga0395905_0004519 | 3300037471 | Bacteria | 14409 |
| 340 | Ga0395905_0008136 | 3300037471 | Bacteria | 10357 |
| 341 | Ga0395905_0035730 | 3300037471 | Bacteria | 4667 |
| 342 | Ga0395905_0131466 | 3300037471 | Bacteria | 2354 |
| 343 | Ga0395905_0334442 | 3300037471 | Bacteria | 1405 |
| 344 | Ga0395901_0003279 | 3300038443 | Bacteria | 16290 |
| 345 | Ga0395901_0015014 | 3300038443 | Bacteria | 7874 |
| 346 | Ga0395901_0031555 | 3300038443 | Bacteria | 5462 |
| 347 | Ga0395901_0066764 | 3300038443 | Bacteria | 3746 |
| 348 | Ga0395901_0342294 | 3300038443 | Bacteria | 1545 |
| 349 | Ga0395901_0809112 | 3300038443 | Bacteria | 925 |
| 350 | Ga0439443_029644 | 3300042003 | Bacteria | 897 |
| 351 | Ga0439448_0063639 | 3300042005 | Bacteria | 1222 |
| 352 | Ga0439450_032341 | 3300042008 | Bacteria | 1181 |
| 353 | Ga0450893_0018496 | 3300042532 | Bacteria | 1188 |
| 354 | Ga0439440_0033172 | 3300042993 | Bacteria | 1229 |
| 355 | Ga0495627_016010 | 3300046453 | Bacteria | 2577 |
| 356 | Ga0495627_041781 | 3300046453 | Unclassified | 1407 |
| 357 | Ga0495592_0172491 | 3300046454 | Bacteria | 1480 |
| 358 | Ga0495592_0357537 | 3300046454 | Bacteria | 935 |
| 359 | Ga0495603_0004290 | 3300046455 | Bacteria | 8498 |
| 360 | Ga0495603_0004579 | 3300046455 | Bacteria | 8254 |
| 361 | Ga0495603_0011637 | 3300046455 | Bacteria | 5325 |
| 362 | Ga0495603_0017730 | 3300046455 | Bacteria | 4309 |
| 363 | Ga0495591_041878 | 3300046458 | Bacteria | 1298 |
| 364 | Ga0495629_0001109 | 3300046459 | Bacteria | 21318 |
| 365 | Ga0495629_0001444 | 3300046459 | Bacteria | 18742 |
| 366 | Ga0495641_0003130 | 3300046461 | Bacteria | 12612 |
| 367 | Ga0495641_0029947 | 3300046461 | Bacteria | 2617 |
| 368 | Ga0495653_0057245 | 3300046463 | Bacteria | 2968 |
| 369 | Ga0495580_0073210 | 3300046472 | Bacteria | 2392 |
| 370 | Ga0495580_0131205 | 3300046472 | Bacteria | 1738 |
| 371 | Ga0495582_0003569 | 3300046473 | Bacteria | 8770 |
| 372 | Ga0495582_0003894 | 3300046473 | Bacteria | 8394 |
| 373 | Ga0495582_0256575 | 3300046473 | Bacteria | 1003 |
| 374 | Ga0495605_0045120 | 3300046474 | Bacteria | 2174 |
| 375 | Ga0495605_0122021 | 3300046474 | Archaea | 1181 |
| 376 | Ga0495639_0009337 | 3300046475 | Bacteria | 4206 |
| 377 | Ga0495639_0011606 | 3300046475 | Bacteria | 3800 |
| 378 | Ga0495639_0184464 | 3300046475 | Unclassified | 1017 |
| 379 | Ga0495639_0189208 | 3300046475 | Bacteria | 1004 |
| 380 | Ga0495662_0002966 | 3300046476 | Bacteria | 8561 |
| 381 | Ga0495584_0076420 | 3300046491 | Bacteria | 1684 |
| 382 | Ga0495584_0136710 | 3300046491 | Bacteria | 1244 |
| 383 | Ga0495584_0140733 | 3300046491 | Bacteria | 1225 |
| 384 | Ga0495584_0229344 | 3300046491 | Bacteria | 944 |
| 385 | Ga0495585_0009316 | 3300046492 | Bacteria | 5897 |
| 386 | Ga0495585_0035576 | 3300046492 | Bacteria | 2813 |
| 387 | Ga0495585_0045353 | 3300046492 | Bacteria | 2454 |
| 388 | Ga0495594_0010551 | 3300046499 | Bacteria | 4791 |
| 389 | Ga0495594_0014179 | 3300046499 | Bacteria | 4173 |
| 390 | Ga0495594_0064300 | 3300046499 | Bacteria | 2034 |
| 391 | Ga0495594_0129451 | 3300046499 | Bacteria | 1429 |
| 392 | Ga0495596_0063124 | 3300046500 | Bacteria | 1441 |
| 393 | Ga0495596_0122329 | 3300046500 | Bacteria | 1010 |
| 394 | Ga0495607_0112525 | 3300046501 | Unclassified | 1441 |
| 395 | Ga0495607_0213883 | 3300046501 | Bacteria | 947 |
| 396 | Ga0495583_0066878 | 3300046506 | Bacteria | 1589 |
| 397 | Ga0495618_0009695 | 3300046514 | Bacteria | 5816 |
| 398 | Ga0495618_0034958 | 3300046514 | Unclassified | 3153 |
| 399 | Ga0495618_0107212 | 3300046514 | Bacteria | 1789 |
| 400 | Ga0495618_0249573 | 3300046514 | Bacteria | 1114 |
| 401 | Ga0495628_0027305 | 3300046516 | Bacteria | 4646 |
| 402 | Ga0495630_0002369 | 3300046517 | Bacteria | 13073 |
| 403 | Ga0495630_0071387 | 3300046517 | Bacteria | 2613 |
| 404 | Ga0495630_0328591 | 3300046517 | Bacteria | 1169 |
| 405 | Ga0495630_0576915 | 3300046517 | Bacteria | 862 |
| 406 | Ga0495631_0041846 | 3300046518 | Unclassified | 2026 |
| 407 | Ga0495631_0252642 | 3300046518 | Unclassified | 751 |
| 408 | Ga0495644_0021649 | 3300046523 | Bacteria | 2451 |
| 409 | Ga0495644_0062354 | 3300046523 | Bacteria | 1401 |
| 410 | Ga0495644_0081274 | 3300046523 | Bacteria | 1222 |
| 411 | Ga0495644_0184058 | 3300046523 | Bacteria | 803 |
| 412 | Ga0495663_0004574 | 3300046525 | Bacteria | 3878 |
| 413 | Ga0495663_0005838 | 3300046525 | Bacteria | 3408 |
| 414 | Ga0495666_0000679 | 3300046526 | Bacteria | 15425 |
| 415 | Ga0495642_0032426 | 3300046528 | Bacteria | 2096 |
| 416 | Ga0495665_0000073 | 3300046531 | Bacteria | 42772 |
| 417 | Ga0495665_0008503 | 3300046531 | Bacteria | 5572 |
| 418 | Ga0495665_0019239 | 3300046531 | Bacteria | 3671 |
| 419 | Ga0495640_0006425 | 3300046533 | Bacteria | 9293 |
| 420 | Ga0495640_0215386 | 3300046533 | Bacteria | 1213 |
| 421 | Ga0495640_0431891 | 3300046533 | Bacteria | 806 |
| 422 | Ga0495586_0006826 | 3300046535 | Bacteria | 6088 |
| 423 | Ga0495586_0046367 | 3300046535 | Bacteria | 2343 |
| 424 | Ga0495598_0001351 | 3300046537 | Bacteria | 4819 |
| 425 | Ga0495609_0007774 | 3300046538 | Bacteria | 5314 |
| 426 | Ga0495609_0043568 | 3300046538 | Bacteria | 2015 |
| 427 | Ga0495609_0140764 | 3300046538 | Bacteria | 1030 |
| 428 | Ga0495621_0010224 | 3300046539 | Bacteria | 2865 |
| 429 | Ga0495621_0026286 | 3300046539 | Bacteria | 1962 |
| 430 | Ga0495621_0069082 | 3300046539 | Bacteria | 1298 |
| 431 | Ga0495667_0143852 | 3300046559 | Bacteria | 1536 |
| 432 | Ga0495656_0000313 | 3300046615 | Bacteria | 16745 |
| 433 | Ga0495656_0002836 | 3300046615 | Bacteria | 5802 |
| 434 | Ga0495656_0107347 | 3300046615 | Bacteria | 1300 |
| 435 | Ga0495656_0114393 | 3300046615 | Bacteria | 1266 |
| 436 | Ga0495656_0170423 | 3300046615 | Bacteria | 1064 |
| 437 | Ga0495634_0004835 | 3300046642 | Bacteria | 10452 |
| 438 | Ga0495634_0096187 | 3300046642 | Bacteria | 1918 |
| 439 | Ga0495634_0098034 | 3300046642 | Bacteria | 1897 |
| 440 | Ga0495611_0215325 | 3300046648 | Bacteria | 894 |
| 441 | Ga0495635_0001368 | 3300046663 | Bacteria | 16236 |
| 442 | Ga0495659_0041581 | 3300046664 | Bacteria | 1642 |
| 443 | Ga0495659_0204292 | 3300046664 | Bacteria | 811 |
| 444 | Ga0495659_0268435 | 3300046664 | Bacteria | 714 |
| 445 | Ga0495588_0000418 | 3300046674 | Bacteria | 23045 |
| 446 | Ga0495588_0004957 | 3300046674 | Bacteria | 5910 |
| 447 | Ga0495588_0163439 | 3300046674 | Bacteria | 1177 |
| 448 | Ga0495647_0000379 | 3300046681 | Bacteria | 12628 |
| 449 | Ga0495647_0147060 | 3300046681 | Bacteria | 1008 |
| 450 | Ga0495647_0306885 | 3300046681 | Bacteria | 716 |
| 451 | Ga0495658_0001073 | 3300046683 | Bacteria | 14397 |
| 452 | Ga0495658_0003070 | 3300046683 | Bacteria | 8353 |
| 453 | Ga0495658_0494317 | 3300046683 | Unclassified | 782 |
| 454 | Ga0495658_0705508 | 3300046683 | Bacteria | 646 |
| 455 | Ga0495669_0250769 | 3300046684 | Bacteria | 850 |
| 456 | Ga0495613_0001308 | 3300046689 | Bacteria | 19041 |
| 457 | Ga0495613_0001902 | 3300046689 | Bacteria | 15829 |
| 458 | Ga0495613_0011942 | 3300046689 | Bacteria | 6456 |
| 459 | Ga0495613_0442009 | 3300046689 | Bacteria | 882 |
| 460 | Ga0495624_0002222 | 3300046690 | Bacteria | 14801 |
| 461 | Ga0495624_0066093 | 3300046690 | Bacteria | 2258 |
| 462 | Ga0495624_0100888 | 3300046690 | Bacteria | 1777 |
| 463 | Ga0495670_0012491 | 3300046691 | Bacteria | 4178 |
| 464 | Ga0495670_0092866 | 3300046691 | Bacteria | 1546 |
| 465 | Ga0495670_0173707 | 3300046691 | Bacteria | 1135 |
| 466 | Ga0495671_0141060 | 3300046692 | Unclassified | 1174 |
| 467 | Ga0495589_0107191 | 3300046794 | Unclassified | 1350 |
| 468 | Ga0495589_0110129 | 3300046794 | Bacteria | 1329 |
| 469 | Ga0495581_0002452 | 3300047315 | Bacteria | 10495 |
| 470 | Ga0495581_0016562 | 3300047315 | Bacteria | 4283 |
| 471 | Ga0495581_0018904 | 3300047315 | Bacteria | 4000 |
| 472 | Ga0495581_0019909 | 3300047315 | Bacteria | 3896 |
| 473 | Ga0495581_0318094 | 3300047315 | Unclassified | 909 |
| 474 | Ga0495636_0042980 | 3300047318 | Bacteria | 1879 |
| 475 | Ga0495674_0017706 | 3300047319 | Bacteria | 6633 |
| 476 | Ga0495676_0048865 | 3300047321 | Bacteria | 3406 |
| 477 | Ga0495676_0334797 | 3300047321 | Bacteria | 1014 |
| 478 | Ga0495680_0003484 | 3300047322 | Bacteria | 15456 |
| 479 | Ga0495683_0272799 | 3300047323 | Bacteria | 735 |
| 480 | Ga0495677_0037073 | 3300047445 | Bacteria | 1781 |
| 481 | Ga0495677_0266343 | 3300047445 | Bacteria | 671 |
| 482 | Ga0495684_0024980 | 3300047471 | Bacteria | 4595 |
| 483 | Ga0495684_0541883 | 3300047471 | Unclassified | 794 |
| 484 | Ga0495593_0001860 | 3300047673 | Bacteria | 12569 |
| 485 | Ga0495593_0445248 | 3300047673 | Bacteria | 648 |
| 486 | Ga0495614_0012235 | 3300048089 | Bacteria | 3769 |
| 487 | Ga0495614_0049634 | 3300048089 | Bacteria | 1799 |
| 488 | Ga0495615_0005517 | 3300048090 | Bacteria | 2279 |
| 489 | Ga0496100_0056226 | 3300048903 | Bacteria | 2573 |
| 490 | Ga0496101_0097221 | 3300048904 | Unclassified | 2198 |
| 491 | Ga0496102_0089947 | 3300048905 | Unclassified | 2840 |
| 492 | Ga0496102_0703442 | 3300048905 | Unclassified | 933 |
| 493 | Ga0496103_0037023 | 3300048906 | Bacteria | 2990 |
| 494 | Ga0496103_0646833 | 3300048906 | Bacteria | 672 |
| 495 | Ga0496104_0384635 | 3300048907 | Bacteria | 1316 |
| 496 | Ga0496106_0016777 | 3300048909 | Bacteria | 5419 |
| 497 | Ga0496106_0260903 | 3300048909 | Bacteria | 1386 |
| 498 | Ga0496107_0077734 | 3300048910 | Unclassified | 2417 |
| 499 | Ga0496108_0037155 | 3300048911 | Bacteria | 4055 |
| 500 | Ga0496108_0402716 | 3300048911 | Unclassified | 1195 |
| 501 | Ga0496109_0002327 | 3300048912 | Bacteria | 15834 |
| 502 | Ga0496109_0205344 | 3300048912 | Bacteria | 1852 |
| 503 | Ga0496110_0049391 | 3300048913 | Unclassified | 3690 |
| 504 | Ga0496110_0194859 | 3300048913 | Bacteria | 1840 |
| 505 | Ga0496111_0027400 | 3300048914 | Bacteria | 4031 |
| 506 | Ga0496111_0038698 | 3300048914 | Bacteria | 3418 |
| 507 | Ga0496112_0093846 | 3300048915 | Bacteria | 2971 |
| 508 | Ga0496113_0070208 | 3300048916 | Bacteria | 2662 |
| 509 | Ga0496113_0861776 | 3300048916 | Bacteria | 718 |
| 510 | Ga0496114_0036014 | 3300048917 | Bacteria | 4090 |
| 511 | Ga0501031_0028597 | 3300049568 | Bacteria | 3634 |
| 512 | Ga0501031_0062378 | 3300049568 | Bacteria | 2429 |
| 513 | Ga0501031_0168156 | 3300049568 | Unclassified | 1432 |
| 514 | Ga0501032_0021284 | 3300049569 | Bacteria | 4509 |
| 515 | Ga0501033_0041979 | 3300049570 | Bacteria | 3411 |
| 516 | Ga0501034_0018577 | 3300049571 | Bacteria | 7127 |
| 517 | Ga0501036_0097950 | 3300049572 | Bacteria | 2479 |
| 518 | Ga0501036_0119925 | 3300049572 | Bacteria | 2221 |
| 519 | Ga0501036_1003360 | 3300049572 | Bacteria | 683 |
| 520 | Ga0501037_0008371 | 3300049573 | Bacteria | 7582 |
| 521 | Ga0501038_0004634 | 3300049574 | Bacteria | 12796 |
| 522 | Ga0501038_0019322 | 3300049574 | Bacteria | 6145 |
| 523 | Ga0501038_0031058 | 3300049574 | Bacteria | 4722 |
| 524 | Ga0501039_0023190 | 3300049575 | Bacteria | 4762 |
| 525 | Ga0501039_0067357 | 3300049575 | Bacteria | 2780 |
| 526 | Ga0501040_0021703 | 3300049576 | Bacteria | 4291 |
| 527 | Ga0501040_0232550 | 3300049576 | Bacteria | 1313 |
| 528 | Ga0501040_0248134 | 3300049576 | Bacteria | 1269 |
| 529 | Ga0501040_0424401 | 3300049576 | Bacteria | 956 |
| 530 | Ga0501041_0015190 | 3300049577 | Bacteria | 4572 |
| 531 | Ga0501041_0023676 | 3300049577 | Bacteria | 3682 |
| 532 | Ga0501041_0024222 | 3300049577 | Bacteria | 3642 |
| 533 | Ga0501042_0006723 | 3300049578 | Bacteria | 7495 |
| 534 | Ga0501042_0044553 | 3300049578 | Bacteria | 3161 |
| 535 | Ga0501042_0053599 | 3300049578 | Bacteria | 2877 |
| 536 | Ga0501042_0132790 | 3300049578 | Bacteria | 1794 |
| 537 | Ga0501043_0017270 | 3300049579 | Bacteria | 5660 |
| 538 | Ga0501046_0096462 | 3300049580 | Bacteria | 2271 |
| 539 | Ga0501047_0164420 | 3300049581 | Bacteria | 2090 |
| 540 | Ga0501048_0011919 | 3300049582 | Bacteria | 6482 |
| 541 | Ga0501048_0015366 | 3300049582 | Bacteria | 5653 |
| 542 | Ga0501048_0019749 | 3300049582 | Bacteria | 4941 |
| 543 | Ga0501067_0145652 | 3300049583 | Unclassified | 1320 |
| 544 | Ga0501067_0329401 | 3300049583 | Bacteria | 850 |
| 545 | Ga0501068_0074928 | 3300049584 | Bacteria | 2069 |
| 546 | Ga0501069_0003125 | 3300049585 | Bacteria | 8489 |
| 547 | Ga0501069_0089762 | 3300049585 | Unclassified | 1738 |
| 548 | Ga0501070_0016930 | 3300049586 | Bacteria | 6116 |
| 549 | Ga0501070_0179207 | 3300049586 | Unclassified | 1744 |
| 550 | Ga0501071_0053792 | 3300049587 | Bacteria | 2904 |
| 551 | Ga0501072_0019158 | 3300049588 | Bacteria | 5286 |
| 552 | Ga0501072_0033954 | 3300049588 | Bacteria | 3996 |
| 553 | Ga0501072_0555490 | 3300049588 | Unclassified | 906 |
| 554 | Ga0501073_0008093 | 3300049589 | Bacteria | 7800 |
| 555 | Ga0501073_0031653 | 3300049589 | Bacteria | 3774 |
| 556 | Ga0501074_0005966 | 3300049590 | Bacteria | 8788 |
| 557 | Ga0501074_0072707 | 3300049590 | Bacteria | 2470 |
| 558 | Ga0501075_0035250 | 3300049591 | Bacteria | 3730 |
| 559 | Ga0501075_0064110 | 3300049591 | Bacteria | 2771 |
| 560 | Ga0501075_0261120 | 3300049591 | Bacteria | 1320 |
| 561 | Ga0501075_0372567 | 3300049591 | Bacteria | 1088 |
| 562 | Ga0501076_0007561 | 3300049592 | Bacteria | 7909 |
| 563 | Ga0501076_0008160 | 3300049592 | Bacteria | 7662 |
| 564 | Ga0501076_0018274 | 3300049592 | Bacteria | 5342 |
| 565 | Ga0501076_0085229 | 3300049592 | Bacteria | 2538 |
| 566 | Ga0501076_0279942 | 3300049592 | Bacteria | 1366 |
| 567 | Ga0501077_0017837 | 3300049593 | Bacteria | 4485 |
| 568 | Ga0501077_0024873 | 3300049593 | Bacteria | 3802 |
| 569 | Ga0501077_0050264 | 3300049593 | Bacteria | 2650 |
| 570 | Ga0501077_0134628 | 3300049593 | Bacteria | 1567 |
| 571 | Ga0501077_0313194 | 3300049593 | Bacteria | 1000 |
| 572 | Ga0501077_0330018 | 3300049593 | Bacteria | 973 |
| 573 | Ga0501077_0413150 | 3300049593 | Bacteria | 863 |
| 574 | Ga0501079_0033494 | 3300049741 | Bacteria | 3952 |
| 575 | Ga0501079_0041286 | 3300049741 | Bacteria | 3561 |
| 576 | Ga0501079_0092401 | 3300049741 | Bacteria | 2344 |
| 577 | Ga0501079_0221402 | 3300049741 | Unclassified | 1478 |
| 578 | Ga0501079_0239124 | 3300049741 | Bacteria | 1419 |
| 579 | Ga0501079_0502354 | 3300049741 | Bacteria | 953 |
| 580 | Ga0501080_0013456 | 3300049742 | Bacteria | 7527 |
| 581 | Ga0501080_0301864 | 3300049742 | Bacteria | 1452 |
| 582 | Ga0501080_0407070 | 3300049742 | Unclassified | 1223 |
| 583 | Ga0501081_0015424 | 3300049743 | Bacteria | 5042 |
| 584 | Ga0501081_0147394 | 3300049743 | Bacteria | 1689 |
| 585 | Ga0501081_0170144 | 3300049743 | Bacteria | 1573 |
| 586 | Ga0501081_0822942 | 3300049743 | Bacteria | 699 |
| 587 | Ga0501083_0016237 | 3300049744 | Bacteria | 5214 |
| 588 | Ga0501083_0135835 | 3300049744 | Unclassified | 1611 |
| 589 | Ga0501035_0030944 | 3300049822 | Bacteria | 4875 |
| 590 | Ga0501044_0007431 | 3300049823 | Bacteria | 12051 |
| 591 | Ga0501044_0483341 | 3300049823 | Unclassified | 1141 |
| 592 | Ga0501045_0012796 | 3300049824 | Bacteria | 5911 |
| 593 | Ga0501045_0084957 | 3300049824 | Bacteria | 2335 |
| 594 | Ga0501045_0100451 | 3300049824 | Bacteria | 2141 |
| 595 | Ga0501045_0520730 | 3300049824 | Bacteria | 883 |
| 596 | nmdc:mga05p37_10596_c1 | 3300050507 | Bacteria | 10933 |
| 597 | nmdc:mga05p37_134457_c1 | 3300050507 | Bacteria | 3034 |
| 598 | nmdc:mga05p37_146257_c1 | 3300050507 | Bacteria | 2894 |
| 599 | nmdc:mga05p37_277187_c1 | 3300050507 | Bacteria | 2001 |
| 600 | nmdc:mga05p37_42514_c1 | 3300050507 | Bacteria | 5584 |
| 601 | nmdc:mga05p37_778473_c1 | 3300050507 | Bacteria | 1050 |
| 602 | nmdc:mga05p37_78472_c1 | 3300050507 | Bacteria | 4066 |
| 603 | nmdc:mga09592_237736_c1 | 3300050508 | Bacteria | 1578 |
| 604 | nmdc:mga09592_2556_c1 | 3300050508 | Bacteria | 14724 |
| 605 | nmdc:mga09592_312257_c1 | 3300050508 | Bacteria | 1362 |
| 606 | nmdc:mga0qj67_401_c1 | 3300050509 | Bacteria | 29850 |
| 607 | nmdc:mga06r32_114873_c1 | 3300050510 | Bacteria | 2651 |
| 608 | nmdc:mga06r32_79363_c1 | 3300050510 | Bacteria | 3193 |
| 609 | nmdc:mga06r32_85686_c1 | 3300050510 | Bacteria | 3072 |
| 610 | nmdc:mga08y16_186831_c1 | 3300050511 | Bacteria | 2150 |
| 611 | nmdc:mga08y16_45503_c1 | 3300050511 | Bacteria | 4599 |
| 612 | nmdc:mga08y16_807413_c1 | 3300050511 | Bacteria | 931 |
| 613 | nmdc:mga08y16_91690_c1 | 3300050511 | Bacteria | 3167 |
| 614 | nmdc:mga0n895_130902_c1 | 3300050512 | Bacteria | 2534 |
| 615 | nmdc:mga0n895_20970_c1 | 3300050512 | Bacteria | 6104 |
| 616 | nmdc:mga0n895_307192_c1 | 3300050512 | Bacteria | 1608 |
| 617 | nmdc:mga0n895_88528_c1 | 3300050512 | Bacteria | 3096 |
| 618 | nmdc:mga0n895_900543_c1 | 3300050512 | Bacteria | 870 |
| 619 | nmdc:mga0rr50_247114_c1 | 3300050513 | Bacteria | 1480 |
| 620 | nmdc:mga0a205_15142_c1 | 3300050515 | Bacteria | 7205 |
| 621 | nmdc:mga0a205_6301_c1 | 3300050515 | Bacteria | 10712 |
| 622 | nmdc:mga0a205_75654_c1 | 3300050515 | Bacteria | 3254 |
| 623 | nmdc:mga0a205_867225_c1 | 3300050515 | Unclassified | 750 |
| 624 | Ga0495601_0008228 | 3300053077 | Bacteria | 6153 |
| 625 | Ga0495612_0024778 | 3300053078 | Bacteria | 2409 |
| 626 | Ga0495655_0047735 | 3300053083 | Bacteria | 1122 |
| 627 | Ga0495655_0068421 | 3300053083 | Bacteria | 987 |
| 628 | Ga0495595_0015178 | 3300053084 | Unclassified | 3282 |
| 629 | Ga0495619_0001824 | 3300053085 | Bacteria | 14160 |
| 630 | Ga0495619_0018986 | 3300053085 | Bacteria | 4367 |
| 631 | Ga0501084_0055716 | 3300054114 | Bacteria | 3307 |
| 632 | Ga0501084_0158014 | 3300054114 | Bacteria | 1912 |
| 633 | Ga0501084_0198323 | 3300054114 | Bacteria | 1693 |
| 634 | Ga0501084_0694374 | 3300054114 | Bacteria | 858 |
| 635 | Ga0590075_012567 | 3300059424 | Bacteria | 2057 |
| 636 | Ga0501082_0026533 | 3300060353 | Bacteria | 4993 |
| 637 | Ga0501082_0045693 | 3300060353 | Bacteria | 3776 |
| 638 | Ga0501082_0089403 | 3300060353 | Bacteria | 2659 |
| 639 | Ga0501082_0142473 | 3300060353 | Unclassified | 2080 |
| 640 | Ga0501082_0151857 | 3300060353 | Bacteria | 2012 |
| 641 | Ga0530510_0043036 | 3300061734 | Bacteria | 3262 |
| 642 | Ga0530510_0091330 | 3300061734 | Bacteria | 2221 |
| 643 | Ga0530510_0129539 | 3300061734 | Unclassified | 1855 |
| 644 | Ga0530510_0144600 | 3300061734 | Bacteria | 1754 |
| 645 | Ga0530510_0228934 | 3300061734 | Unclassified | 1382 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2526164512 | 2526212220 | 181 |
| 2 | 3300005468 | Ga0070707_100225189 | Ga0070707_1002251893 | 185 |
| 3 | 3300025922 | Ga0207646_10302111 | Ga0207646_103021111 | 185 |
| 4 | 3300046683 | Ga0495658_0705508 | Ga0495658_0705508_55_612 | 185 |
| 5 | 3300047315 | Ga0495581_0318094 | Ga0495581_0318094_41_598 | 185 |
| 6 | 3300047323 | Ga0495683_0272799 | Ga0495683_0272799_165_722 | 185 |
| 7 | 3300049743 | Ga0501081_0822942 | Ga0501081_0822942_22_579 | 185 |
| 8 | 3300048906 | Ga0496103_0646833 | Ga0496103_0646833_60_620 | 186 |
| 9 | 3300035171 | Ga0373946_0117794 | Ga0373946_0117794_235_804 | 187 |
| 10 | 3300035172 | Ga0373955_0049623 | Ga0373955_0049623_773_1342 | 187 |
| 11 | 3300037068 | Ga0373925_0421936 | Ga0373925_0421936_465_1034 | 187 |
| 12 | 3300046514 | Ga0495618_0249573 | Ga0495618_0249573_219_788 | 187 |
| 13 | 3300046516 | Ga0495628_0027305 | Ga0495628_0027305_530_1099 | 187 |
| 14 | 3300046533 | Ga0495640_0431891 | Ga0495640_0431891_144_713 | 187 |
| 15 | 3300046642 | Ga0495634_0098034 | Ga0495634_0098034_656_1225 | 187 |
| 16 | 3300046454 | Ga0495592_0357537 | Ga0495592_0357537_34_606 | 188 |
| 17 | 3300046689 | Ga0495613_0442009 | Ga0495613_0442009_271_843 | 188 |
| 18 | 3300035117 | Ga0373953_0095069 | Ga0373953_0095069_64_645 | 191 |
| 19 | 3300035172 | Ga0373955_0117364 | Ga0373955_0117364_826_1407 | 191 |
| 20 | 3300053078 | Ga0495612_0024778 | Ga0495612_0024778_1271_1852 | 191 |
| 21 | 3300009147 | Ga0114129_10401849 | Ga0114129_104018492 | 192 |
| 22 | 3300005435 | Ga0070714_100000129 | Ga0070714_10000012955 | 195 |
| 23 | 3300025929 | Ga0207664_10000139 | Ga0207664_1000013955 | 195 |
| 24 | 3300005435 | Ga0070714_100114963 | Ga0070714_1001149632 | 196 |
| 25 | 3300005445 | Ga0070708_100022679 | Ga0070708_1000226795 | 196 |
| 26 | 3300005445 | Ga0070708_100176649 | Ga0070708_1001766493 | 196 |
| 27 | 3300005467 | Ga0070706_100000256 | Ga0070706_10000025654 | 196 |
| 28 | 3300005467 | Ga0070706_100130880 | Ga0070706_1001308802 | 196 |
| 29 | 3300005468 | Ga0070707_100001775 | Ga0070707_10000177510 | 196 |
| 30 | 3300005468 | Ga0070707_100091703 | Ga0070707_1000917033 | 196 |
| 31 | 3300005468 | Ga0070707_100226993 | Ga0070707_1002269931 | 196 |
| 32 | 3300005471 | Ga0070698_100000165 | Ga0070698_10000016523 | 196 |
| 33 | 3300005471 | Ga0070698_100000827 | Ga0070698_10000082722 | 196 |
| 34 | 3300005471 | Ga0070698_100495968 | Ga0070698_1004959682 | 196 |
| 35 | 3300005518 | Ga0070699_100464788 | Ga0070699_1004647883 | 196 |
| 36 | 3300005536 | Ga0070697_100008022 | Ga0070697_10000802212 | 196 |
| 37 | 3300006173 | Ga0070716_100076847 | Ga0070716_1000768472 | 196 |
| 38 | 3300025910 | Ga0207684_10000016 | Ga0207684_10000016218 | 196 |
| 39 | 3300025910 | Ga0207684_10552066 | Ga0207684_105520662 | 196 |
| 40 | 3300025922 | Ga0207646_10000205 | Ga0207646_1000020513 | 196 |
| 41 | 3300025922 | Ga0207646_10010984 | Ga0207646_100109843 | 196 |
| 42 | 3300025933 | Ga0207706_10100853 | Ga0207706_101008533 | 196 |
| 43 | 3300005437 | Ga0070710_10459535 | Ga0070710_104595352 | 197 |
| 44 | 3300025917 | Ga0207660_10248716 | Ga0207660_102487162 | 197 |
| 45 | 3300025929 | Ga0207664_10298187 | Ga0207664_102981872 | 198 |
| 46 | 3300025939 | Ga0207665_10042501 | Ga0207665_100425012 | 198 |
| 47 | 3300031239 | Ga0265328_10034994 | Ga0265328_100349943 | 202 |
| 48 | 3300031251 | Ga0265327_10000103 | Ga0265327_10000103117 | 202 |
| 49 | 3300046523 | Ga0495644_0184058 | Ga0495644_0184058_15_623 | 202 |
| 50 | 3300005295 | Ga0065707_10131735 | Ga0065707_101317351 | 203 |
| 51 | 3300005353 | Ga0070669_100024278 | Ga0070669_1000242782 | 203 |
| 52 | 3300005330 | Ga0070690_100001288 | Ga0070690_1000012882 | 204 |
| 53 | 3300005441 | Ga0070700_100002109 | Ga0070700_1000021097 | 204 |
| 54 | 3300005459 | Ga0068867_100324170 | Ga0068867_1003241702 | 204 |
| 55 | 3300009177 | Ga0105248_10067611 | Ga0105248_100676113 | 204 |
| 56 | 3300013297 | Ga0157378_10547140 | Ga0157378_105471402 | 204 |
| 57 | 3300025945 | Ga0207679_10546212 | Ga0207679_105462122 | 205 |
| 58 | 3300049578 | Ga0501042_0132790 | Ga0501042_0132790_801_1418 | 205 |
| 59 | 3300049593 | Ga0501077_0313194 | Ga0501077_0313194_186_803 | 205 |
| 60 | 3300046514 | Ga0495618_0009695 | Ga0495618_0009695_3969_4592 | 206 |
| 61 | 3300046517 | Ga0495630_0071387 | Ga0495630_0071387_855_1478 | 206 |
| 62 | 3300046642 | Ga0495634_0096187 | Ga0495634_0096187_1175_1798 | 206 |
| 63 | 3300046681 | Ga0495647_0306885 | Ga0495647_0306885_70_693 | 206 |
| 64 | 3300046690 | Ga0495624_0066093 | Ga0495624_0066093_297_920 | 206 |
| 65 | 3300047471 | Ga0495684_0541883 | Ga0495684_0541883_157_780 | 206 |
| 66 | 3300049576 | Ga0501040_0232550 | Ga0501040_0232550_274_894 | 206 |
| 67 | 3300049591 | Ga0501075_0372567 | Ga0501075_0372567_346_966 | 206 |
| 68 | 3300049741 | Ga0501079_0239124 | Ga0501079_0239124_497_1117 | 206 |
| 69 | 3300049824 | Ga0501045_0520730 | Ga0501045_0520730_57_677 | 206 |
| 70 | 3300002459 | JGI24751J29686_10000383 | JGI24751J29686_100003837 | 207 |
| 71 | 3300005328 | Ga0070676_10012261 | Ga0070676_100122612 | 207 |
| 72 | 3300005330 | Ga0070690_100098414 | Ga0070690_1000984142 | 207 |
| 73 | 3300005330 | Ga0070690_100392636 | Ga0070690_1003926362 | 207 |
| 74 | 3300005331 | Ga0070670_100006976 | Ga0070670_1000069767 | 207 |
| 75 | 3300005331 | Ga0070670_100113727 | Ga0070670_1001137272 | 207 |
| 76 | 3300005334 | Ga0068869_100034253 | Ga0068869_1000342533 | 207 |
| 77 | 3300005336 | Ga0070680_100059551 | Ga0070680_1000595513 | 207 |
| 78 | 3300005340 | Ga0070689_100072798 | Ga0070689_1000727983 | 207 |
| 79 | 3300005341 | Ga0070691_10161078 | Ga0070691_101610782 | 207 |
| 80 | 3300005343 | Ga0070687_100085288 | Ga0070687_1000852882 | 207 |
| 81 | 3300005344 | Ga0070661_100017181 | Ga0070661_1000171814 | 207 |
| 82 | 3300005345 | Ga0070692_10339662 | Ga0070692_103396622 | 207 |
| 83 | 3300005345 | Ga0070692_10441844 | Ga0070692_104418441 | 207 |
| 84 | 3300005354 | Ga0070675_100056146 | Ga0070675_1000561462 | 207 |
| 85 | 3300005355 | Ga0070671_100102180 | Ga0070671_1001021802 | 207 |
| 86 | 3300005356 | Ga0070674_100013151 | Ga0070674_1000131512 | 207 |
| 87 | 3300005356 | Ga0070674_100355509 | Ga0070674_1003555092 | 207 |
| 88 | 3300005365 | Ga0070688_100250424 | Ga0070688_1002504242 | 207 |
| 89 | 3300005366 | Ga0070659_100210417 | Ga0070659_1002104171 | 207 |
| 90 | 3300005406 | Ga0070703_10000030 | Ga0070703_1000003025 | 207 |
| 91 | 3300005406 | Ga0070703_10088814 | Ga0070703_100888141 | 207 |
| 92 | 3300005437 | Ga0070710_10270332 | Ga0070710_102703322 | 207 |
| 93 | 3300005438 | Ga0070701_10020700 | Ga0070701_100207002 | 207 |
| 94 | 3300005438 | Ga0070701_10187826 | Ga0070701_101878261 | 207 |
| 95 | 3300005439 | Ga0070711_100039385 | Ga0070711_1000393852 | 207 |
| 96 | 3300005441 | Ga0070700_100045991 | Ga0070700_1000459912 | 207 |
| 97 | 3300005441 | Ga0070700_100111757 | Ga0070700_1001117572 | 207 |
| 98 | 3300005441 | Ga0070700_100744844 | Ga0070700_1007448441 | 207 |
| 99 | 3300005441 | Ga0070700_100888041 | Ga0070700_1008880411 | 207 |
| 100 | 3300005444 | Ga0070694_100001859 | Ga0070694_10000185912 | 207 |
| 101 | 3300005444 | Ga0070694_100027034 | Ga0070694_1000270342 | 207 |
| 102 | 3300005444 | Ga0070694_100081550 | Ga0070694_1000815502 | 207 |
| 103 | 3300005444 | Ga0070694_100130381 | Ga0070694_1001303812 | 207 |
| 104 | 3300005444 | Ga0070694_100314745 | Ga0070694_1003147452 | 207 |
| 105 | 3300005444 | Ga0070694_100366241 | Ga0070694_1003662412 | 207 |
| 106 | 3300005445 | Ga0070708_100023416 | Ga0070708_1000234161 | 207 |
| 107 | 3300005445 | Ga0070708_100113844 | Ga0070708_1001138442 | 207 |
| 108 | 3300005455 | Ga0070663_100127142 | Ga0070663_1001271422 | 207 |
| 109 | 3300005456 | Ga0070678_100022202 | Ga0070678_1000222022 | 207 |
| 110 | 3300005456 | Ga0070678_100087874 | Ga0070678_1000878742 | 207 |
| 111 | 3300005457 | Ga0070662_100400150 | Ga0070662_1004001502 | 207 |
| 112 | 3300005459 | Ga0068867_100028632 | Ga0068867_1000286324 | 207 |
| 113 | 3300005459 | Ga0068867_100046360 | Ga0068867_1000463605 | 207 |
| 114 | 3300005459 | Ga0068867_100116032 | Ga0068867_1001160322 | 207 |
| 115 | 3300005466 | Ga0070685_10249010 | Ga0070685_102490102 | 207 |
| 116 | 3300005467 | Ga0070706_100206115 | Ga0070706_1002061152 | 207 |
| 117 | 3300005467 | Ga0070706_100380829 | Ga0070706_1003808292 | 207 |
| 118 | 3300005467 | Ga0070706_100673397 | Ga0070706_1006733972 | 207 |
| 119 | 3300005468 | Ga0070707_100105623 | Ga0070707_1001056231 | 207 |
| 120 | 3300005468 | Ga0070707_100243268 | Ga0070707_1002432682 | 207 |
| 121 | 3300005468 | Ga0070707_100364411 | Ga0070707_1003644112 | 207 |
| 122 | 3300005468 | Ga0070707_100540663 | Ga0070707_1005406632 | 207 |
| 123 | 3300005471 | Ga0070698_100064492 | Ga0070698_1000644922 | 207 |
| 124 | 3300005471 | Ga0070698_100285894 | Ga0070698_1002858942 | 207 |
| 125 | 3300005518 | Ga0070699_100018238 | Ga0070699_1000182383 | 207 |
| 126 | 3300005518 | Ga0070699_100053741 | Ga0070699_1000537412 | 207 |
| 127 | 3300005518 | Ga0070699_100068945 | Ga0070699_1000689453 | 207 |
| 128 | 3300005535 | Ga0070684_100006153 | Ga0070684_1000061537 | 207 |
| 129 | 3300005535 | Ga0070684_100389505 | Ga0070684_1003895052 | 207 |
| 130 | 3300005536 | Ga0070697_100049567 | Ga0070697_1000495672 | 207 |
| 131 | 3300005536 | Ga0070697_100070217 | Ga0070697_1000702173 | 207 |
| 132 | 3300005536 | Ga0070697_100126138 | Ga0070697_1001261381 | 207 |
| 133 | 3300005536 | Ga0070697_101041903 | Ga0070697_1010419031 | 207 |
| 134 | 3300005544 | Ga0070686_100002999 | Ga0070686_1000029995 | 207 |
| 135 | 3300005544 | Ga0070686_100284570 | Ga0070686_1002845701 | 207 |
| 136 | 3300005545 | Ga0070695_100046700 | Ga0070695_1000467002 | 207 |
| 137 | 3300005545 | Ga0070695_100314381 | Ga0070695_1003143812 | 207 |
| 138 | 3300005546 | Ga0070696_100004343 | Ga0070696_1000043432 | 207 |
| 139 | 3300005546 | Ga0070696_100024491 | Ga0070696_1000244915 | 207 |
| 140 | 3300005547 | Ga0070693_100030656 | Ga0070693_1000306562 | 207 |
| 141 | 3300005549 | Ga0070704_100003309 | Ga0070704_1000033099 | 207 |
| 142 | 3300005549 | Ga0070704_100050940 | Ga0070704_1000509403 | 207 |
| 143 | 3300005549 | Ga0070704_100221435 | Ga0070704_1002214352 | 207 |
| 144 | 3300005549 | Ga0070704_100249524 | Ga0070704_1002495242 | 207 |
| 145 | 3300005549 | Ga0070704_100555208 | Ga0070704_1005552082 | 207 |
| 146 | 3300005564 | Ga0070664_100002319 | Ga0070664_1000023196 | 207 |
| 147 | 3300005577 | Ga0068857_100022120 | Ga0068857_1000221206 | 207 |
| 148 | 3300005578 | Ga0068854_100393036 | Ga0068854_1003930362 | 207 |
| 149 | 3300005578 | Ga0068854_100543246 | Ga0068854_1005432462 | 207 |
| 150 | 3300005615 | Ga0070702_100025964 | Ga0070702_1000259642 | 207 |
| 151 | 3300005616 | Ga0068852_100115978 | Ga0068852_1001159783 | 207 |
| 152 | 3300005617 | Ga0068859_100289817 | Ga0068859_1002898172 | 207 |
| 153 | 3300005618 | Ga0068864_100041579 | Ga0068864_1000415792 | 207 |
| 154 | 3300005618 | Ga0068864_100064581 | Ga0068864_1000645813 | 207 |
| 155 | 3300005618 | Ga0068864_100074187 | Ga0068864_1000741873 | 207 |
| 156 | 3300005718 | Ga0068866_10021883 | Ga0068866_100218833 | 207 |
| 157 | 3300005718 | Ga0068866_10422290 | Ga0068866_104222901 | 207 |
| 158 | 3300005719 | Ga0068861_100341530 | Ga0068861_1003415302 | 207 |
| 159 | 3300005719 | Ga0068861_100449866 | Ga0068861_1004498662 | 207 |
| 160 | 3300005834 | Ga0068851_10055213 | Ga0068851_100552132 | 207 |
| 161 | 3300005840 | Ga0068870_10000226 | Ga0068870_1000022618 | 207 |
| 162 | 3300005840 | Ga0068870_10066093 | Ga0068870_100660932 | 207 |
| 163 | 3300005841 | Ga0068863_100028894 | Ga0068863_1000288946 | 207 |
| 164 | 3300005841 | Ga0068863_100149551 | Ga0068863_1001495513 | 207 |
| 165 | 3300005841 | Ga0068863_100426853 | Ga0068863_1004268532 | 207 |
| 166 | 3300005842 | Ga0068858_100771972 | Ga0068858_1007719722 | 207 |
| 167 | 3300005842 | Ga0068858_100933345 | Ga0068858_1009333452 | 207 |
| 168 | 3300005843 | Ga0068860_100158437 | Ga0068860_1001584373 | 207 |
| 169 | 3300005843 | Ga0068860_100760754 | Ga0068860_1007607542 | 207 |
| 170 | 3300005843 | Ga0068860_101487317 | Ga0068860_1014873171 | 207 |
| 171 | 3300005844 | Ga0068862_100053790 | Ga0068862_1000537903 | 207 |
| 172 | 3300005937 | Ga0081455_10005219 | Ga0081455_100052194 | 207 |
| 173 | 3300005937 | Ga0081455_10008629 | Ga0081455_100086292 | 207 |
| 174 | 3300005937 | Ga0081455_10099271 | Ga0081455_100992712 | 207 |
| 175 | 3300005937 | Ga0081455_10246985 | Ga0081455_102469852 | 207 |
| 176 | 3300005981 | Ga0081538_10026269 | Ga0081538_100262693 | 207 |
| 177 | 3300005985 | Ga0081539_10022550 | Ga0081539_100225505 | 207 |
| 178 | 3300005985 | Ga0081539_10040675 | Ga0081539_100406753 | 207 |
| 179 | 3300005985 | Ga0081539_10055955 | Ga0081539_100559552 | 207 |
| 180 | 3300006175 | Ga0070712_100008229 | Ga0070712_1000082296 | 207 |
| 181 | 3300006237 | Ga0097621_100015984 | Ga0097621_1000159844 | 207 |
| 182 | 3300006844 | Ga0075428_100076851 | Ga0075428_1000768515 | 207 |
| 183 | 3300006844 | Ga0075428_100135738 | Ga0075428_1001357383 | 207 |
| 184 | 3300006844 | Ga0075428_100392298 | Ga0075428_1003922983 | 207 |
| 185 | 3300006846 | Ga0075430_100000348 | Ga0075430_10000034814 | 207 |
| 186 | 3300006846 | Ga0075430_100141761 | Ga0075430_1001417612 | 207 |
| 187 | 3300006847 | Ga0075431_100000742 | Ga0075431_10000074215 | 207 |
| 188 | 3300006847 | Ga0075431_100047088 | Ga0075431_1000470883 | 207 |
| 189 | 3300006847 | Ga0075431_100079392 | Ga0075431_1000793922 | 207 |
| 190 | 3300006852 | Ga0075433_10000393 | Ga0075433_1000039315 | 207 |
| 191 | 3300006852 | Ga0075433_10011979 | Ga0075433_100119798 | 207 |
| 192 | 3300006871 | Ga0075434_100002976 | Ga0075434_10000297613 | 207 |
| 193 | 3300006871 | Ga0075434_100078593 | Ga0075434_1000785934 | 207 |
| 194 | 3300006871 | Ga0075434_100092307 | Ga0075434_1000923073 | 207 |
| 195 | 3300006871 | Ga0075434_100957745 | Ga0075434_1009577451 | 207 |
| 196 | 3300006880 | Ga0075429_100003403 | Ga0075429_1000034035 | 207 |
| 197 | 3300006880 | Ga0075429_100132861 | Ga0075429_1001328614 | 207 |
| 198 | 3300006880 | Ga0075429_100382752 | Ga0075429_1003827522 | 207 |
| 199 | 3300006881 | Ga0068865_100063173 | Ga0068865_1000631733 | 207 |
| 200 | 3300006881 | Ga0068865_100109198 | Ga0068865_1001091982 | 207 |
| 201 | 3300006881 | Ga0068865_100191352 | Ga0068865_1001913522 | 207 |
| 202 | 3300006881 | Ga0068865_100336611 | Ga0068865_1003366112 | 207 |
| 203 | 3300007076 | Ga0075435_100012895 | Ga0075435_1000128956 | 207 |
| 204 | 3300007076 | Ga0075435_100323498 | Ga0075435_1003234982 | 207 |
| 205 | 3300009011 | Ga0105251_10052177 | Ga0105251_100521772 | 207 |
| 206 | 3300009094 | Ga0111539_10047773 | Ga0111539_100477732 | 207 |
| 207 | 3300009094 | Ga0111539_10259866 | Ga0111539_102598662 | 207 |
| 208 | 3300009094 | Ga0111539_10444270 | Ga0111539_104442702 | 207 |
| 209 | 3300009098 | Ga0105245_10060419 | Ga0105245_100604193 | 207 |
| 210 | 3300009098 | Ga0105245_10072307 | Ga0105245_100723072 | 207 |
| 211 | 3300009098 | Ga0105245_10186639 | Ga0105245_101866392 | 207 |
| 212 | 3300009098 | Ga0105245_10569603 | Ga0105245_105696032 | 207 |
| 213 | 3300009147 | Ga0114129_10009240 | Ga0114129_1000924014 | 207 |
| 214 | 3300009147 | Ga0114129_10025791 | Ga0114129_100257915 | 207 |
| 215 | 3300009147 | Ga0114129_10048271 | Ga0114129_100482715 | 207 |
| 216 | 3300009147 | Ga0114129_10081207 | Ga0114129_100812074 | 207 |
| 217 | 3300009147 | Ga0114129_10257484 | Ga0114129_102574842 | 207 |
| 218 | 3300009147 | Ga0114129_10339857 | Ga0114129_103398572 | 207 |
| 219 | 3300009147 | Ga0114129_10542502 | Ga0114129_105425022 | 207 |
| 220 | 3300009148 | Ga0105243_10012242 | Ga0105243_100122425 | 207 |
| 221 | 3300009148 | Ga0105243_10052502 | Ga0105243_100525024 | 207 |
| 222 | 3300009148 | Ga0105243_10054694 | Ga0105243_100546942 | 207 |
| 223 | 3300009148 | Ga0105243_10058923 | Ga0105243_100589233 | 207 |
| 224 | 3300009148 | Ga0105243_10075060 | Ga0105243_100750603 | 207 |
| 225 | 3300009148 | Ga0105243_10120740 | Ga0105243_101207402 | 207 |
| 226 | 3300009176 | Ga0105242_10003933 | Ga0105242_100039332 | 207 |
| 227 | 3300009176 | Ga0105242_10015992 | Ga0105242_100159927 | 207 |
| 228 | 3300009176 | Ga0105242_10140887 | Ga0105242_101408872 | 207 |
| 229 | 3300009177 | Ga0105248_10217043 | Ga0105248_102170432 | 207 |
| 230 | 3300009177 | Ga0105248_10429992 | Ga0105248_104299922 | 207 |
| 231 | 3300009551 | Ga0105238_10067436 | Ga0105238_100674363 | 207 |
| 232 | 3300009553 | Ga0105249_10122412 | Ga0105249_101224124 | 207 |
| 233 | 3300009553 | Ga0105249_10297360 | Ga0105249_102973602 | 207 |
| 234 | 3300011119 | Ga0105246_10015599 | Ga0105246_100155993 | 207 |
| 235 | 3300011119 | Ga0105246_10038980 | Ga0105246_100389804 | 207 |
| 236 | 3300011119 | Ga0105246_10142783 | Ga0105246_101427832 | 207 |
| 237 | 3300013296 | Ga0157374_10036695 | Ga0157374_100366953 | 207 |
| 238 | 3300013297 | Ga0157378_10089576 | Ga0157378_100895762 | 207 |
| 239 | 3300013297 | Ga0157378_10383227 | Ga0157378_103832272 | 207 |
| 240 | 3300013297 | Ga0157378_10425472 | Ga0157378_104254722 | 207 |
| 241 | 3300013297 | Ga0157378_10425655 | Ga0157378_104256552 | 207 |
| 242 | 3300013297 | Ga0157378_10543036 | Ga0157378_105430362 | 207 |
| 243 | 3300013308 | Ga0157375_10032734 | Ga0157375_100327343 | 207 |
| 244 | 3300013308 | Ga0157375_10100613 | Ga0157375_101006132 | 207 |
| 245 | 3300013308 | Ga0157375_10286967 | Ga0157375_102869671 | 207 |
| 246 | 3300014325 | Ga0163163_10001408 | Ga0163163_100014087 | 207 |
| 247 | 3300014325 | Ga0163163_10088893 | Ga0163163_100888933 | 207 |
| 248 | 3300014325 | Ga0163163_10472374 | Ga0163163_104723742 | 207 |
| 249 | 3300014326 | Ga0157380_10402848 | Ga0157380_104028482 | 207 |
| 250 | 3300014326 | Ga0157380_10752859 | Ga0157380_107528592 | 207 |
| 251 | 3300014326 | Ga0157380_11036980 | Ga0157380_110369801 | 207 |
| 252 | 3300014326 | Ga0157380_11404527 | Ga0157380_114045272 | 207 |
| 253 | 3300014326 | Ga0157380_11666167 | Ga0157380_116661671 | 207 |
| 254 | 3300014745 | Ga0157377_10035761 | Ga0157377_100357613 | 207 |
| 255 | 3300014745 | Ga0157377_10118610 | Ga0157377_101186102 | 207 |
| 256 | 3300014968 | Ga0157379_10224139 | Ga0157379_102241392 | 207 |
| 257 | 3300014968 | Ga0157379_10395446 | Ga0157379_103954462 | 207 |
| 258 | 3300014968 | Ga0157379_10479367 | Ga0157379_104793672 | 207 |
| 259 | 3300014969 | Ga0157376_10428912 | Ga0157376_104289122 | 207 |
| 260 | 3300017792 | Ga0163161_10806803 | Ga0163161_108068031 | 207 |
| 261 | 3300025735 | Ga0207713_1044347 | Ga0207713_10443472 | 207 |
| 262 | 3300025885 | Ga0207653_10000010 | Ga0207653_1000001036 | 207 |
| 263 | 3300025885 | Ga0207653_10003356 | Ga0207653_100033564 | 207 |
| 264 | 3300025898 | Ga0207692_10002955 | Ga0207692_100029556 | 207 |
| 265 | 3300025901 | Ga0207688_10002728 | Ga0207688_100027282 | 207 |
| 266 | 3300025904 | Ga0207647_10035041 | Ga0207647_100350414 | 207 |
| 267 | 3300025907 | Ga0207645_10005796 | Ga0207645_100057967 | 207 |
| 268 | 3300025908 | Ga0207643_10000427 | Ga0207643_1000042718 | 207 |
| 269 | 3300025908 | Ga0207643_10034063 | Ga0207643_100340632 | 207 |
| 270 | 3300025908 | Ga0207643_10080644 | Ga0207643_100806443 | 207 |
| 271 | 3300025910 | Ga0207684_10000160 | Ga0207684_1000016082 | 207 |
| 272 | 3300025910 | Ga0207684_10320720 | Ga0207684_103207202 | 207 |
| 273 | 3300025910 | Ga0207684_10368617 | Ga0207684_103686172 | 207 |
| 274 | 3300025915 | Ga0207693_10000862 | Ga0207693_1000086213 | 207 |
| 275 | 3300025918 | Ga0207662_10157055 | Ga0207662_101570552 | 207 |
| 276 | 3300025922 | Ga0207646_10203228 | Ga0207646_102032282 | 207 |
| 277 | 3300025925 | Ga0207650_10008407 | Ga0207650_100084072 | 207 |
| 278 | 3300025926 | Ga0207659_10042950 | Ga0207659_100429502 | 207 |
| 279 | 3300025926 | Ga0207659_10317892 | Ga0207659_103178922 | 207 |
| 280 | 3300025927 | Ga0207687_10013352 | Ga0207687_100133527 | 207 |
| 281 | 3300025927 | Ga0207687_10612571 | Ga0207687_106125712 | 207 |
| 282 | 3300025932 | Ga0207690_10097096 | Ga0207690_100970962 | 207 |
| 283 | 3300025934 | Ga0207686_10025998 | Ga0207686_100259982 | 207 |
| 284 | 3300025935 | Ga0207709_10014252 | Ga0207709_100142522 | 207 |
| 285 | 3300025935 | Ga0207709_10014541 | Ga0207709_100145415 | 207 |
| 286 | 3300025935 | Ga0207709_10106518 | Ga0207709_101065182 | 207 |
| 287 | 3300025936 | Ga0207670_10239780 | Ga0207670_102397802 | 207 |
| 288 | 3300025937 | Ga0207669_10034223 | Ga0207669_100342233 | 207 |
| 289 | 3300025937 | Ga0207669_10769422 | Ga0207669_107694222 | 207 |
| 290 | 3300025938 | Ga0207704_10010705 | Ga0207704_100107054 | 207 |
| 291 | 3300025938 | Ga0207704_10186454 | Ga0207704_101864542 | 207 |
| 292 | 3300025938 | Ga0207704_10416558 | Ga0207704_104165582 | 207 |
| 293 | 3300025939 | Ga0207665_10034153 | Ga0207665_100341533 | 207 |
| 294 | 3300025941 | Ga0207711_10243534 | Ga0207711_102435342 | 207 |
| 295 | 3300025942 | Ga0207689_10007393 | Ga0207689_100073933 | 207 |
| 296 | 3300025945 | Ga0207679_10077038 | Ga0207679_100770383 | 207 |
| 297 | 3300025961 | Ga0207712_10370892 | Ga0207712_103708922 | 207 |
| 298 | 3300025961 | Ga0207712_10440936 | Ga0207712_104409362 | 207 |
| 299 | 3300025961 | Ga0207712_10563899 | Ga0207712_105638992 | 207 |
| 300 | 3300025981 | Ga0207640_10200093 | Ga0207640_102000932 | 207 |
| 301 | 3300026023 | Ga0207677_10226404 | Ga0207677_102264042 | 207 |
| 302 | 3300026035 | Ga0207703_10060330 | Ga0207703_100603303 | 207 |
| 303 | 3300026035 | Ga0207703_10536185 | Ga0207703_105361852 | 207 |
| 304 | 3300026067 | Ga0207678_10059567 | Ga0207678_100595675 | 207 |
| 305 | 3300026075 | Ga0207708_10004840 | Ga0207708_1000484010 | 207 |
| 306 | 3300026075 | Ga0207708_10017620 | Ga0207708_100176205 | 207 |
| 307 | 3300026075 | Ga0207708_10427804 | Ga0207708_104278041 | 207 |
| 308 | 3300026075 | Ga0207708_10648525 | Ga0207708_106485252 | 207 |
| 309 | 3300026088 | Ga0207641_11097373 | Ga0207641_110973731 | 207 |
| 310 | 3300026089 | Ga0207648_10004190 | Ga0207648_1000419011 | 207 |
| 311 | 3300026089 | Ga0207648_10148152 | Ga0207648_101481522 | 207 |
| 312 | 3300026089 | Ga0207648_10507757 | Ga0207648_105077572 | 207 |
| 313 | 3300026095 | Ga0207676_10006125 | Ga0207676_100061254 | 207 |
| 314 | 3300026095 | Ga0207676_10057138 | Ga0207676_100571383 | 207 |
| 315 | 3300026116 | Ga0207674_10001990 | Ga0207674_100019904 | 207 |
| 316 | 3300026118 | Ga0207675_100010000 | Ga0207675_1000100004 | 207 |
| 317 | 3300026118 | Ga0207675_100030824 | Ga0207675_1000308242 | 207 |
| 318 | 3300026118 | Ga0207675_100241999 | Ga0207675_1002419992 | 207 |
| 319 | 3300026121 | Ga0207683_10002897 | Ga0207683_100028972 | 207 |
| 320 | 3300026121 | Ga0207683_10161031 | Ga0207683_101610312 | 207 |
| 321 | 3300026142 | Ga0207698_10247089 | Ga0207698_102470892 | 207 |
| 322 | 3300027907 | Ga0207428_10003462 | Ga0207428_1000346211 | 207 |
| 323 | 3300027907 | Ga0207428_10034775 | Ga0207428_100347754 | 207 |
| 324 | 3300027907 | Ga0207428_10035985 | Ga0207428_100359852 | 207 |
| 325 | 3300027907 | Ga0207428_10255343 | Ga0207428_102553432 | 207 |
| 326 | 3300028381 | Ga0268264_10205674 | Ga0268264_102056742 | 207 |
| 327 | 3300028381 | Ga0268264_10473059 | Ga0268264_104730592 | 207 |
| 328 | 3300032002 | Ga0307416_100463594 | Ga0307416_1004635942 | 207 |
| 329 | 3300035083 | Ga0373926_0000125 | Ga0373926_0000125_12263_12886 | 207 |
| 330 | 3300035089 | Ga0373944_0000010 | Ga0373944_0000010_11216_11839 | 207 |
| 331 | 3300035091 | Ga0373951_0046218 | Ga0373951_0046218_225_848 | 207 |
| 332 | 3300035111 | Ga0373923_0085774 | Ga0373923_0085774_330_953 | 207 |
| 333 | 3300035112 | Ga0373932_0043476 | Ga0373932_0043476_391_1014 | 207 |
| 334 | 3300035113 | Ga0373936_0050102 | Ga0373936_0050102_959_1582 | 207 |
| 335 | 3300035114 | Ga0373939_0026025 | Ga0373939_0026025_332_955 | 207 |
| 336 | 3300035115 | Ga0373941_0062214 | Ga0373941_0062214_222_845 | 207 |
| 337 | 3300035116 | Ga0373945_0004388 | Ga0373945_0004388_2832_3455 | 207 |
| 338 | 3300035170 | Ga0373943_0003882 | Ga0373943_0003882_3349_3972 | 207 |
| 339 | 3300035171 | Ga0373946_0001954 | Ga0373946_0001954_6234_6857 | 207 |
| 340 | 3300035241 | Ga0373961_0108949 | Ga0373961_0108949_12_635 | 207 |
| 341 | 3300035410 | Ga0373924_0008899 | Ga0373924_0008899_1095_1718 | 207 |
| 342 | 3300035691 | Ga0373931_0117879 | Ga0373931_0117879_364_987 | 207 |
| 343 | 3300035692 | Ga0373935_0004975 | Ga0373935_0004975_6008_6631 | 207 |
| 344 | 3300035695 | Ga0373927_0030229 | Ga0373927_0030229_2345_2968 | 207 |
| 345 | 3300035725 | Ga0373947_0004480 | Ga0373947_0004480_3097_3720 | 207 |
| 346 | 3300035725 | Ga0373947_0007423 | Ga0373947_0007423_2869_3492 | 207 |
| 347 | 3300036401 | Ga0373937_0414446 | Ga0373937_0414446_277_900 | 207 |
| 348 | 3300037068 | Ga0373925_0010309 | Ga0373925_0010309_3718_4341 | 207 |
| 349 | 3300037068 | Ga0373925_0012869 | Ga0373925_0012869_959_1582 | 207 |
| 350 | 3300037312 | Ga0395899_0010262 | Ga0395899_0010262_3572_4195 | 207 |
| 351 | 3300037312 | Ga0395899_0042162 | Ga0395899_0042162_495_1118 | 207 |
| 352 | 3300037312 | Ga0395899_0059542 | Ga0395899_0059542_1657_2280 | 207 |
| 353 | 3300037418 | Ga0395900_0009135 | Ga0395900_0009135_3495_4118 | 207 |
| 354 | 3300037418 | Ga0395900_0037385 | Ga0395900_0037385_1445_2068 | 207 |
| 355 | 3300037418 | Ga0395900_0039519 | Ga0395900_0039519_620_1243 | 207 |
| 356 | 3300037418 | Ga0395900_0410046 | Ga0395900_0410046_254_877 | 207 |
| 357 | 3300037466 | Ga0395898_0145072 | Ga0395898_0145072_712_1335 | 207 |
| 358 | 3300037466 | Ga0395898_0171527 | Ga0395898_0171527_867_1490 | 207 |
| 359 | 3300037471 | Ga0395905_0008136 | Ga0395905_0008136_867_1490 | 207 |
| 360 | 3300037471 | Ga0395905_0035730 | Ga0395905_0035730_1149_1772 | 207 |
| 361 | 3300037471 | Ga0395905_0131466 | Ga0395905_0131466_1054_1677 | 207 |
| 362 | 3300037471 | Ga0395905_0334442 | Ga0395905_0334442_87_710 | 207 |
| 363 | 3300038443 | Ga0395901_0003279 | Ga0395901_0003279_9382_10005 | 207 |
| 364 | 3300038443 | Ga0395901_0015014 | Ga0395901_0015014_983_1606 | 207 |
| 365 | 3300038443 | Ga0395901_0031555 | Ga0395901_0031555_1253_1876 | 207 |
| 366 | 3300038443 | Ga0395901_0066764 | Ga0395901_0066764_1976_2599 | 207 |
| 367 | 3300038443 | Ga0395901_0342294 | Ga0395901_0342294_292_915 | 207 |
| 368 | 3300038443 | Ga0395901_0809112 | Ga0395901_0809112_75_698 | 207 |
| 369 | 3300042003 | Ga0439443_029644 | Ga0439443_029644_145_768 | 207 |
| 370 | 3300042005 | Ga0439448_0063639 | Ga0439448_0063639_338_961 | 207 |
| 371 | 3300042008 | Ga0439450_032341 | Ga0439450_032341_217_840 | 207 |
| 372 | 3300042532 | Ga0450893_0018496 | Ga0450893_0018496_264_887 | 207 |
| 373 | 3300042993 | Ga0439440_0033172 | Ga0439440_0033172_77_700 | 207 |
| 374 | 3300046453 | Ga0495627_016010 | Ga0495627_016010_1447_2070 | 207 |
| 375 | 3300046453 | Ga0495627_041781 | Ga0495627_041781_532_1155 | 207 |
| 376 | 3300046454 | Ga0495592_0172491 | Ga0495592_0172491_704_1330 | 207 |
| 377 | 3300046455 | Ga0495603_0004579 | Ga0495603_0004579_3983_4606 | 207 |
| 378 | 3300046455 | Ga0495603_0011637 | Ga0495603_0011637_895_1518 | 207 |
| 379 | 3300046455 | Ga0495603_0017730 | Ga0495603_0017730_3291_3914 | 207 |
| 380 | 3300046458 | Ga0495591_041878 | Ga0495591_041878_660_1283 | 207 |
| 381 | 3300046459 | Ga0495629_0001109 | Ga0495629_0001109_16040_16663 | 207 |
| 382 | 3300046459 | Ga0495629_0001444 | Ga0495629_0001444_6321_6944 | 207 |
| 383 | 3300046461 | Ga0495641_0003130 | Ga0495641_0003130_5244_5867 | 207 |
| 384 | 3300046461 | Ga0495641_0029947 | Ga0495641_0029947_1478_2101 | 207 |
| 385 | 3300046463 | Ga0495653_0057245 | Ga0495653_0057245_1233_1856 | 207 |
| 386 | 3300046472 | Ga0495580_0073210 | Ga0495580_0073210_1517_2140 | 207 |
| 387 | 3300046472 | Ga0495580_0131205 | Ga0495580_0131205_1013_1636 | 207 |
| 388 | 3300046473 | Ga0495582_0003894 | Ga0495582_0003894_1969_2592 | 207 |
| 389 | 3300046473 | Ga0495582_0256575 | Ga0495582_0256575_195_818 | 207 |
| 390 | 3300046474 | Ga0495605_0045120 | Ga0495605_0045120_1071_1694 | 207 |
| 391 | 3300046474 | Ga0495605_0122021 | Ga0495605_0122021_111_734 | 207 |
| 392 | 3300046475 | Ga0495639_0009337 | Ga0495639_0009337_572_1195 | 207 |
| 393 | 3300046475 | Ga0495639_0011606 | Ga0495639_0011606_356_979 | 207 |
| 394 | 3300046475 | Ga0495639_0184464 | Ga0495639_0184464_361_984 | 207 |
| 395 | 3300046475 | Ga0495639_0189208 | Ga0495639_0189208_51_674 | 207 |
| 396 | 3300046476 | Ga0495662_0002966 | Ga0495662_0002966_2439_3062 | 207 |
| 397 | 3300046491 | Ga0495584_0076420 | Ga0495584_0076420_107_730 | 207 |
| 398 | 3300046491 | Ga0495584_0136710 | Ga0495584_0136710_191_814 | 207 |
| 399 | 3300046491 | Ga0495584_0140733 | Ga0495584_0140733_276_899 | 207 |
| 400 | 3300046491 | Ga0495584_0229344 | Ga0495584_0229344_286_909 | 207 |
| 401 | 3300046492 | Ga0495585_0009316 | Ga0495585_0009316_2533_3156 | 207 |
| 402 | 3300046492 | Ga0495585_0035576 | Ga0495585_0035576_976_1599 | 207 |
| 403 | 3300046499 | Ga0495594_0010551 | Ga0495594_0010551_2928_3551 | 207 |
| 404 | 3300046499 | Ga0495594_0014179 | Ga0495594_0014179_252_875 | 207 |
| 405 | 3300046499 | Ga0495594_0064300 | Ga0495594_0064300_1179_1802 | 207 |
| 406 | 3300046499 | Ga0495594_0129451 | Ga0495594_0129451_541_1164 | 207 |
| 407 | 3300046500 | Ga0495596_0063124 | Ga0495596_0063124_737_1360 | 207 |
| 408 | 3300046500 | Ga0495596_0122329 | Ga0495596_0122329_163_786 | 207 |
| 409 | 3300046501 | Ga0495607_0112525 | Ga0495607_0112525_241_864 | 207 |
| 410 | 3300046501 | Ga0495607_0213883 | Ga0495607_0213883_93_716 | 207 |
| 411 | 3300046506 | Ga0495583_0066878 | Ga0495583_0066878_162_785 | 207 |
| 412 | 3300046514 | Ga0495618_0034958 | Ga0495618_0034958_2472_3098 | 207 |
| 413 | 3300046514 | Ga0495618_0107212 | Ga0495618_0107212_50_676 | 207 |
| 414 | 3300046517 | Ga0495630_0002369 | Ga0495630_0002369_3224_3847 | 207 |
| 415 | 3300046517 | Ga0495630_0328591 | Ga0495630_0328591_384_1010 | 207 |
| 416 | 3300046517 | Ga0495630_0576915 | Ga0495630_0576915_159_782 | 207 |
| 417 | 3300046518 | Ga0495631_0041846 | Ga0495631_0041846_785_1408 | 207 |
| 418 | 3300046523 | Ga0495644_0021649 | Ga0495644_0021649_1028_1651 | 207 |
| 419 | 3300046523 | Ga0495644_0062354 | Ga0495644_0062354_213_836 | 207 |
| 420 | 3300046523 | Ga0495644_0081274 | Ga0495644_0081274_202_825 | 207 |
| 421 | 3300046525 | Ga0495663_0004574 | Ga0495663_0004574_1428_2051 | 207 |
| 422 | 3300046525 | Ga0495663_0005838 | Ga0495663_0005838_2326_2949 | 207 |
| 423 | 3300046526 | Ga0495666_0000679 | Ga0495666_0000679_11360_11983 | 207 |
| 424 | 3300046528 | Ga0495642_0032426 | Ga0495642_0032426_685_1308 | 207 |
| 425 | 3300046531 | Ga0495665_0000073 | Ga0495665_0000073_35979_36602 | 207 |
| 426 | 3300046531 | Ga0495665_0008503 | Ga0495665_0008503_1624_2247 | 207 |
| 427 | 3300046531 | Ga0495665_0019239 | Ga0495665_0019239_2813_3436 | 207 |
| 428 | 3300046533 | Ga0495640_0006425 | Ga0495640_0006425_2649_3272 | 207 |
| 429 | 3300046533 | Ga0495640_0215386 | Ga0495640_0215386_121_744 | 207 |
| 430 | 3300046535 | Ga0495586_0006826 | Ga0495586_0006826_89_712 | 207 |
| 431 | 3300046535 | Ga0495586_0046367 | Ga0495586_0046367_1104_1727 | 207 |
| 432 | 3300046537 | Ga0495598_0001351 | Ga0495598_0001351_31_654 | 207 |
| 433 | 3300046538 | Ga0495609_0007774 | Ga0495609_0007774_3360_3983 | 207 |
| 434 | 3300046538 | Ga0495609_0140764 | Ga0495609_0140764_29_652 | 207 |
| 435 | 3300046539 | Ga0495621_0010224 | Ga0495621_0010224_1780_2403 | 207 |
| 436 | 3300046539 | Ga0495621_0026286 | Ga0495621_0026286_1120_1743 | 207 |
| 437 | 3300046539 | Ga0495621_0069082 | Ga0495621_0069082_296_919 | 207 |
| 438 | 3300046559 | Ga0495667_0143852 | Ga0495667_0143852_879_1502 | 207 |
| 439 | 3300046615 | Ga0495656_0000313 | Ga0495656_0000313_13667_14290 | 207 |
| 440 | 3300046615 | Ga0495656_0107347 | Ga0495656_0107347_126_749 | 207 |
| 441 | 3300046615 | Ga0495656_0114393 | Ga0495656_0114393_40_663 | 207 |
| 442 | 3300046615 | Ga0495656_0170423 | Ga0495656_0170423_204_827 | 207 |
| 443 | 3300046642 | Ga0495634_0004835 | Ga0495634_0004835_4397_5020 | 207 |
| 444 | 3300046648 | Ga0495611_0215325 | Ga0495611_0215325_18_641 | 207 |
| 445 | 3300046663 | Ga0495635_0001368 | Ga0495635_0001368_5154_5777 | 207 |
| 446 | 3300046664 | Ga0495659_0041581 | Ga0495659_0041581_789_1412 | 207 |
| 447 | 3300046664 | Ga0495659_0268435 | Ga0495659_0268435_76_699 | 207 |
| 448 | 3300046674 | Ga0495588_0000418 | Ga0495588_0000418_3224_3847 | 207 |
| 449 | 3300046674 | Ga0495588_0004957 | Ga0495588_0004957_4846_5469 | 207 |
| 450 | 3300046674 | Ga0495588_0163439 | Ga0495588_0163439_398_1021 | 207 |
| 451 | 3300046681 | Ga0495647_0000379 | Ga0495647_0000379_2695_3318 | 207 |
| 452 | 3300046681 | Ga0495647_0147060 | Ga0495647_0147060_370_993 | 207 |
| 453 | 3300046683 | Ga0495658_0001073 | Ga0495658_0001073_4067_4690 | 207 |
| 454 | 3300046683 | Ga0495658_0003070 | Ga0495658_0003070_3647_4270 | 207 |
| 455 | 3300046683 | Ga0495658_0494317 | Ga0495658_0494317_58_681 | 207 |
| 456 | 3300046684 | Ga0495669_0250769 | Ga0495669_0250769_144_767 | 207 |
| 457 | 3300046689 | Ga0495613_0001308 | Ga0495613_0001308_17961_18584 | 207 |
| 458 | 3300046689 | Ga0495613_0001902 | Ga0495613_0001902_14165_14788 | 207 |
| 459 | 3300046689 | Ga0495613_0011942 | Ga0495613_0011942_3780_4403 | 207 |
| 460 | 3300046690 | Ga0495624_0002222 | Ga0495624_0002222_2695_3318 | 207 |
| 461 | 3300046690 | Ga0495624_0100888 | Ga0495624_0100888_695_1318 | 207 |
| 462 | 3300046691 | Ga0495670_0012491 | Ga0495670_0012491_2257_2880 | 207 |
| 463 | 3300046691 | Ga0495670_0092866 | Ga0495670_0092866_611_1234 | 207 |
| 464 | 3300046691 | Ga0495670_0173707 | Ga0495670_0173707_489_1112 | 207 |
| 465 | 3300046692 | Ga0495671_0141060 | Ga0495671_0141060_102_725 | 207 |
| 466 | 3300046794 | Ga0495589_0110129 | Ga0495589_0110129_272_895 | 207 |
| 467 | 3300047315 | Ga0495581_0002452 | Ga0495581_0002452_9528_10151 | 207 |
| 468 | 3300047315 | Ga0495581_0016562 | Ga0495581_0016562_2345_2968 | 207 |
| 469 | 3300047315 | Ga0495581_0018904 | Ga0495581_0018904_1619_2242 | 207 |
| 470 | 3300047315 | Ga0495581_0019909 | Ga0495581_0019909_2940_3563 | 207 |
| 471 | 3300047318 | Ga0495636_0042980 | Ga0495636_0042980_810_1433 | 207 |
| 472 | 3300047319 | Ga0495674_0017706 | Ga0495674_0017706_2668_3291 | 207 |
| 473 | 3300047321 | Ga0495676_0048865 | Ga0495676_0048865_567_1190 | 207 |
| 474 | 3300047321 | Ga0495676_0334797 | Ga0495676_0334797_360_983 | 207 |
| 475 | 3300047322 | Ga0495680_0003484 | Ga0495680_0003484_3349_3972 | 207 |
| 476 | 3300047445 | Ga0495677_0037073 | Ga0495677_0037073_585_1208 | 207 |
| 477 | 3300047445 | Ga0495677_0266343 | Ga0495677_0266343_26_649 | 207 |
| 478 | 3300047471 | Ga0495684_0024980 | Ga0495684_0024980_1661_2284 | 207 |
| 479 | 3300047673 | Ga0495593_0001860 | Ga0495593_0001860_1316_1939 | 207 |
| 480 | 3300047673 | Ga0495593_0445248 | Ga0495593_0445248_13_636 | 207 |
| 481 | 3300048089 | Ga0495614_0012235 | Ga0495614_0012235_2822_3445 | 207 |
| 482 | 3300048089 | Ga0495614_0049634 | Ga0495614_0049634_469_1092 | 207 |
| 483 | 3300048090 | Ga0495615_0005517 | Ga0495615_0005517_955_1578 | 207 |
| 484 | 3300048903 | Ga0496100_0056226 | Ga0496100_0056226_108_731 | 207 |
| 485 | 3300048904 | Ga0496101_0097221 | Ga0496101_0097221_560_1183 | 207 |
| 486 | 3300048905 | Ga0496102_0089947 | Ga0496102_0089947_2107_2730 | 207 |
| 487 | 3300048905 | Ga0496102_0703442 | Ga0496102_0703442_265_888 | 207 |
| 488 | 3300048906 | Ga0496103_0037023 | Ga0496103_0037023_263_886 | 207 |
| 489 | 3300048907 | Ga0496104_0384635 | Ga0496104_0384635_561_1184 | 207 |
| 490 | 3300048909 | Ga0496106_0016777 | Ga0496106_0016777_4345_4968 | 207 |
| 491 | 3300048909 | Ga0496106_0260903 | Ga0496106_0260903_656_1279 | 207 |
| 492 | 3300048910 | Ga0496107_0077734 | Ga0496107_0077734_1566_2189 | 207 |
| 493 | 3300048911 | Ga0496108_0037155 | Ga0496108_0037155_3303_3926 | 207 |
| 494 | 3300048911 | Ga0496108_0402716 | Ga0496108_0402716_79_702 | 207 |
| 495 | 3300048912 | Ga0496109_0002327 | Ga0496109_0002327_10837_11460 | 207 |
| 496 | 3300048912 | Ga0496109_0205344 | Ga0496109_0205344_691_1314 | 207 |
| 497 | 3300048913 | Ga0496110_0049391 | Ga0496110_0049391_448_1071 | 207 |
| 498 | 3300048914 | Ga0496111_0027400 | Ga0496111_0027400_229_852 | 207 |
| 499 | 3300048915 | Ga0496112_0093846 | Ga0496112_0093846_676_1299 | 207 |
| 500 | 3300048916 | Ga0496113_0861776 | Ga0496113_0861776_28_651 | 207 |
| 501 | 3300048917 | Ga0496114_0036014 | Ga0496114_0036014_2130_2753 | 207 |
| 502 | 3300049568 | Ga0501031_0028597 | Ga0501031_0028597_2007_2630 | 207 |
| 503 | 3300049568 | Ga0501031_0062378 | Ga0501031_0062378_1361_1984 | 207 |
| 504 | 3300049568 | Ga0501031_0168156 | Ga0501031_0168156_246_869 | 207 |
| 505 | 3300049569 | Ga0501032_0021284 | Ga0501032_0021284_12_635 | 207 |
| 506 | 3300049570 | Ga0501033_0041979 | Ga0501033_0041979_1778_2401 | 207 |
| 507 | 3300049571 | Ga0501034_0018577 | Ga0501034_0018577_3562_4185 | 207 |
| 508 | 3300049572 | Ga0501036_0097950 | Ga0501036_0097950_1146_1769 | 207 |
| 509 | 3300049572 | Ga0501036_0119925 | Ga0501036_0119925_1085_1708 | 207 |
| 510 | 3300049572 | Ga0501036_1003360 | Ga0501036_1003360_35_658 | 207 |
| 511 | 3300049573 | Ga0501037_0008371 | Ga0501037_0008371_2496_3119 | 207 |
| 512 | 3300049574 | Ga0501038_0004634 | Ga0501038_0004634_9569_10192 | 207 |
| 513 | 3300049574 | Ga0501038_0019322 | Ga0501038_0019322_2056_2679 | 207 |
| 514 | 3300049574 | Ga0501038_0031058 | Ga0501038_0031058_3015_3638 | 207 |
| 515 | 3300049575 | Ga0501039_0023190 | Ga0501039_0023190_1302_1925 | 207 |
| 516 | 3300049575 | Ga0501039_0067357 | Ga0501039_0067357_1469_2092 | 207 |
| 517 | 3300049576 | Ga0501040_0021703 | Ga0501040_0021703_2411_3034 | 207 |
| 518 | 3300049576 | Ga0501040_0248134 | Ga0501040_0248134_41_664 | 207 |
| 519 | 3300049576 | Ga0501040_0424401 | Ga0501040_0424401_57_680 | 207 |
| 520 | 3300049577 | Ga0501041_0015190 | Ga0501041_0015190_737_1360 | 207 |
| 521 | 3300049577 | Ga0501041_0023676 | Ga0501041_0023676_764_1387 | 207 |
| 522 | 3300049577 | Ga0501041_0024222 | Ga0501041_0024222_1367_1990 | 207 |
| 523 | 3300049578 | Ga0501042_0006723 | Ga0501042_0006723_4715_5338 | 207 |
| 524 | 3300049578 | Ga0501042_0044553 | Ga0501042_0044553_179_802 | 207 |
| 525 | 3300049578 | Ga0501042_0053599 | Ga0501042_0053599_187_810 | 207 |
| 526 | 3300049579 | Ga0501043_0017270 | Ga0501043_0017270_3636_4259 | 207 |
| 527 | 3300049580 | Ga0501046_0096462 | Ga0501046_0096462_1614_2237 | 207 |
| 528 | 3300049581 | Ga0501047_0164420 | Ga0501047_0164420_955_1578 | 207 |
| 529 | 3300049582 | Ga0501048_0011919 | Ga0501048_0011919_2065_2688 | 207 |
| 530 | 3300049582 | Ga0501048_0015366 | Ga0501048_0015366_1208_1831 | 207 |
| 531 | 3300049582 | Ga0501048_0019749 | Ga0501048_0019749_737_1360 | 207 |
| 532 | 3300049583 | Ga0501067_0145652 | Ga0501067_0145652_499_1122 | 207 |
| 533 | 3300049583 | Ga0501067_0329401 | Ga0501067_0329401_32_655 | 207 |
| 534 | 3300049584 | Ga0501068_0074928 | Ga0501068_0074928_1027_1650 | 207 |
| 535 | 3300049585 | Ga0501069_0003125 | Ga0501069_0003125_3575_4198 | 207 |
| 536 | 3300049585 | Ga0501069_0089762 | Ga0501069_0089762_429_1052 | 207 |
| 537 | 3300049586 | Ga0501070_0016930 | Ga0501070_0016930_1948_2571 | 207 |
| 538 | 3300049586 | Ga0501070_0179207 | Ga0501070_0179207_300_923 | 207 |
| 539 | 3300049587 | Ga0501071_0053792 | Ga0501071_0053792_1208_1831 | 207 |
| 540 | 3300049588 | Ga0501072_0019158 | Ga0501072_0019158_1613_2236 | 207 |
| 541 | 3300049588 | Ga0501072_0033954 | Ga0501072_0033954_400_1023 | 207 |
| 542 | 3300049588 | Ga0501072_0555490 | Ga0501072_0555490_248_871 | 207 |
| 543 | 3300049589 | Ga0501073_0008093 | Ga0501073_0008093_3555_4178 | 207 |
| 544 | 3300049589 | Ga0501073_0031653 | Ga0501073_0031653_687_1310 | 207 |
| 545 | 3300049590 | Ga0501074_0005966 | Ga0501074_0005966_564_1187 | 207 |
| 546 | 3300049590 | Ga0501074_0072707 | Ga0501074_0072707_1545_2168 | 207 |
| 547 | 3300049591 | Ga0501075_0035250 | Ga0501075_0035250_2538_3161 | 207 |
| 548 | 3300049591 | Ga0501075_0064110 | Ga0501075_0064110_1909_2532 | 207 |
| 549 | 3300049591 | Ga0501075_0261120 | Ga0501075_0261120_614_1237 | 207 |
| 550 | 3300049592 | Ga0501076_0007561 | Ga0501076_0007561_1101_1724 | 207 |
| 551 | 3300049592 | Ga0501076_0008160 | Ga0501076_0008160_880_1503 | 207 |
| 552 | 3300049592 | Ga0501076_0018274 | Ga0501076_0018274_2075_2698 | 207 |
| 553 | 3300049592 | Ga0501076_0085229 | Ga0501076_0085229_1402_2025 | 207 |
| 554 | 3300049592 | Ga0501076_0279942 | Ga0501076_0279942_193_816 | 207 |
| 555 | 3300049593 | Ga0501077_0017837 | Ga0501077_0017837_1085_1708 | 207 |
| 556 | 3300049593 | Ga0501077_0024873 | Ga0501077_0024873_1101_1724 | 207 |
| 557 | 3300049593 | Ga0501077_0050264 | Ga0501077_0050264_256_879 | 207 |
| 558 | 3300049593 | Ga0501077_0134628 | Ga0501077_0134628_498_1121 | 207 |
| 559 | 3300049593 | Ga0501077_0330018 | Ga0501077_0330018_255_878 | 207 |
| 560 | 3300049593 | Ga0501077_0413150 | Ga0501077_0413150_64_687 | 207 |
| 561 | 3300049741 | Ga0501079_0033494 | Ga0501079_0033494_2229_2852 | 207 |
| 562 | 3300049741 | Ga0501079_0041286 | Ga0501079_0041286_1628_2251 | 207 |
| 563 | 3300049741 | Ga0501079_0092401 | Ga0501079_0092401_1467_2090 | 207 |
| 564 | 3300049741 | Ga0501079_0221402 | Ga0501079_0221402_544_1167 | 207 |
| 565 | 3300049741 | Ga0501079_0502354 | Ga0501079_0502354_314_937 | 207 |
| 566 | 3300049742 | Ga0501080_0013456 | Ga0501080_0013456_4622_5245 | 207 |
| 567 | 3300049742 | Ga0501080_0301864 | Ga0501080_0301864_778_1401 | 207 |
| 568 | 3300049742 | Ga0501080_0407070 | Ga0501080_0407070_585_1208 | 207 |
| 569 | 3300049743 | Ga0501081_0015424 | Ga0501081_0015424_3397_4020 | 207 |
| 570 | 3300049743 | Ga0501081_0147394 | Ga0501081_0147394_988_1611 | 207 |
| 571 | 3300049743 | Ga0501081_0170144 | Ga0501081_0170144_608_1231 | 207 |
| 572 | 3300049744 | Ga0501083_0016237 | Ga0501083_0016237_2181_2804 | 207 |
| 573 | 3300049744 | Ga0501083_0135835 | Ga0501083_0135835_570_1193 | 207 |
| 574 | 3300049822 | Ga0501035_0030944 | Ga0501035_0030944_2079_2702 | 207 |
| 575 | 3300049823 | Ga0501044_0007431 | Ga0501044_0007431_3646_4269 | 207 |
| 576 | 3300049823 | Ga0501044_0483341 | Ga0501044_0483341_89_712 | 207 |
| 577 | 3300049824 | Ga0501045_0012796 | Ga0501045_0012796_2792_3415 | 207 |
| 578 | 3300049824 | Ga0501045_0084957 | Ga0501045_0084957_1059_1682 | 207 |
| 579 | 3300049824 | Ga0501045_0100451 | Ga0501045_0100451_708_1331 | 207 |
| 580 | 3300050507 | nmdc:mga05p37_10596_c1 | nmdc:mga05p37_10596_c1_9765_10388 | 207 |
| 581 | 3300050507 | nmdc:mga05p37_134457_c1 | nmdc:mga05p37_134457_c1_2290_2913 | 207 |
| 582 | 3300050507 | nmdc:mga05p37_146257_c1 | nmdc:mga05p37_146257_c1_1003_1626 | 207 |
| 583 | 3300050507 | nmdc:mga05p37_277187_c1 | nmdc:mga05p37_277187_c1_855_1478 | 207 |
| 584 | 3300050507 | nmdc:mga05p37_42514_c1 | nmdc:mga05p37_42514_c1_2977_3600 | 207 |
| 585 | 3300050507 | nmdc:mga05p37_778473_c1 | nmdc:mga05p37_778473_c1_141_764 | 207 |
| 586 | 3300050507 | nmdc:mga05p37_78472_c1 | nmdc:mga05p37_78472_c1_3073_3696 | 207 |
| 587 | 3300050508 | nmdc:mga09592_237736_c1 | nmdc:mga09592_237736_c1_749_1372 | 207 |
| 588 | 3300050508 | nmdc:mga09592_2556_c1 | nmdc:mga09592_2556_c1_8152_8775 | 207 |
| 589 | 3300050508 | nmdc:mga09592_312257_c1 | nmdc:mga09592_312257_c1_226_849 | 207 |
| 590 | 3300050509 | nmdc:mga0qj67_401_c1 | nmdc:mga0qj67_401_c1_12148_12771 | 207 |
| 591 | 3300050510 | nmdc:mga06r32_114873_c1 | nmdc:mga06r32_114873_c1_132_755 | 207 |
| 592 | 3300050510 | nmdc:mga06r32_79363_c1 | nmdc:mga06r32_79363_c1_1998_2621 | 207 |
| 593 | 3300050510 | nmdc:mga06r32_85686_c1 | nmdc:mga06r32_85686_c1_1238_1861 | 207 |
| 594 | 3300050511 | nmdc:mga08y16_186831_c1 | nmdc:mga08y16_186831_c1_923_1546 | 207 |
| 595 | 3300050511 | nmdc:mga08y16_45503_c1 | nmdc:mga08y16_45503_c1_3893_4516 | 207 |
| 596 | 3300050511 | nmdc:mga08y16_807413_c1 | nmdc:mga08y16_807413_c1_177_800 | 207 |
| 597 | 3300050511 | nmdc:mga08y16_91690_c1 | nmdc:mga08y16_91690_c1_275_898 | 207 |
| 598 | 3300050512 | nmdc:mga0n895_130902_c1 | nmdc:mga0n895_130902_c1_757_1380 | 207 |
| 599 | 3300050512 | nmdc:mga0n895_20970_c1 | nmdc:mga0n895_20970_c1_804_1427 | 207 |
| 600 | 3300050512 | nmdc:mga0n895_307192_c1 | nmdc:mga0n895_307192_c1_86_709 | 207 |
| 601 | 3300050512 | nmdc:mga0n895_88528_c1 | nmdc:mga0n895_88528_c1_731_1354 | 207 |
| 602 | 3300050512 | nmdc:mga0n895_900543_c1 | nmdc:mga0n895_900543_c1_205_828 | 207 |
| 603 | 3300050513 | nmdc:mga0rr50_247114_c1 | nmdc:mga0rr50_247114_c1_562_1185 | 207 |
| 604 | 3300050515 | nmdc:mga0a205_15142_c1 | nmdc:mga0a205_15142_c1_4344_4967 | 207 |
| 605 | 3300050515 | nmdc:mga0a205_6301_c1 | nmdc:mga0a205_6301_c1_9171_9794 | 207 |
| 606 | 3300050515 | nmdc:mga0a205_75654_c1 | nmdc:mga0a205_75654_c1_2455_3078 | 207 |
| 607 | 3300050515 | nmdc:mga0a205_867225_c1 | nmdc:mga0a205_867225_c1_56_679 | 207 |
| 608 | 3300053077 | Ga0495601_0008228 | Ga0495601_0008228_5269_5895 | 207 |
| 609 | 3300053083 | Ga0495655_0047735 | Ga0495655_0047735_10_633 | 207 |
| 610 | 3300053083 | Ga0495655_0068421 | Ga0495655_0068421_309_932 | 207 |
| 611 | 3300053084 | Ga0495595_0015178 | Ga0495595_0015178_2466_3092 | 207 |
| 612 | 3300053085 | Ga0495619_0001824 | Ga0495619_0001824_10578_11201 | 207 |
| 613 | 3300053085 | Ga0495619_0018986 | Ga0495619_0018986_3147_3773 | 207 |
| 614 | 3300054114 | Ga0501084_0055716 | Ga0501084_0055716_1948_2571 | 207 |
| 615 | 3300054114 | Ga0501084_0158014 | Ga0501084_0158014_678_1301 | 207 |
| 616 | 3300054114 | Ga0501084_0198323 | Ga0501084_0198323_463_1086 | 207 |
| 617 | 3300054114 | Ga0501084_0694374 | Ga0501084_0694374_91_714 | 207 |
| 618 | 3300059424 | Ga0590075_012567 | Ga0590075_012567_582_1205 | 207 |
| 619 | 3300060353 | Ga0501082_0026533 | Ga0501082_0026533_737_1360 | 207 |
| 620 | 3300060353 | Ga0501082_0045693 | Ga0501082_0045693_1313_1936 | 207 |
| 621 | 3300060353 | Ga0501082_0089403 | Ga0501082_0089403_1962_2585 | 207 |
| 622 | 3300060353 | Ga0501082_0142473 | Ga0501082_0142473_1036_1659 | 207 |
| 623 | 3300060353 | Ga0501082_0151857 | Ga0501082_0151857_1063_1686 | 207 |
| 624 | 3300061734 | Ga0530510_0043036 | Ga0530510_0043036_1549_2172 | 207 |
| 625 | 3300061734 | Ga0530510_0091330 | Ga0530510_0091330_1085_1708 | 207 |
| 626 | 3300061734 | Ga0530510_0129539 | Ga0530510_0129539_422_1045 | 207 |
| 627 | 3300061734 | Ga0530510_0144600 | Ga0530510_0144600_566_1189 | 207 |
| 628 | 3300061734 | Ga0530510_0228934 | Ga0530510_0228934_233_856 | 207 |
| 629 | 3300037068 | Ga0373925_0070861 | Ga0373925_0070861_345_1007 | 211 |
| 630 | 3300037312 | Ga0395899_0002330 | Ga0395899_0002330_12767_13444 | 211 |
| 631 | 3300037418 | Ga0395900_0001049 | Ga0395900_0001049_11177_11854 | 211 |
| 632 | 3300037466 | Ga0395898_0003996 | Ga0395898_0003996_7134_7811 | 211 |
| 633 | 3300037471 | Ga0395905_0004519 | Ga0395905_0004519_7875_8552 | 211 |
| 634 | 3300046455 | Ga0495603_0004290 | Ga0495603_0004290_1962_2624 | 211 |
| 635 | 3300046473 | Ga0495582_0003569 | Ga0495582_0003569_8091_8753 | 211 |
| 636 | 3300046518 | Ga0495631_0252642 | Ga0495631_0252642_45_707 | 211 |
| 637 | 3300046615 | Ga0495656_0002836 | Ga0495656_0002836_2085_2747 | 211 |
| 638 | 3300046664 | Ga0495659_0204292 | Ga0495659_0204292_111_752 | 211 |
| 639 | 3300046794 | Ga0495589_0107191 | Ga0495589_0107191_662_1324 | 211 |
| 640 | 3300001976 | JGI24752J21851_1005789 | JGI24752J21851_10057893 | 212 |
| 641 | 3300005467 | Ga0070706_100345553 | Ga0070706_1003455532 | 212 |
| 642 | 3300046492 | Ga0495585_0045353 | Ga0495585_0045353_1193_1831 | 212 |
| 643 | 3300046538 | Ga0495609_0043568 | Ga0495609_0043568_506_1144 | 212 |
| 644 | 3300048913 | Ga0496110_0194859 | Ga0496110_0194859_153_791 | 212 |
| 645 | 3300048914 | Ga0496111_0038698 | Ga0496111_0038698_2176_2814 | 212 |
| 646 | 3300048916 | Ga0496113_0070208 | Ga0496113_0070208_1365_2003 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.924 | 47 | 193 |
| 1xdq-assembly3.cif.gz_C | structural and biochemical identification of a novel bacterial oxidoreductase | 0.9143 | 42 | 193 |
| 2ca4-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella mutant | 0.8961 | 41 | 184 |
| 1sox-assembly1.cif.gz_A | sulfite oxidase from chicken liver | 0.8952 | 33 | 188 |
| 2bih-assembly1.cif.gz_A-2 | crystal structure of the molybdenum-containing nitrate reducing fragment of pichia angusta assimilatory nitrate reductase | 0.8946 | 33 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xdyH00 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9183 | 42 | 193 | 3.90.420.10 |
| af_P11035_116_359_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9062 | 33 | 183 | 3.90.420.10 |
| 2biiB01 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8943 | 33 | 184 | 3.90.420.10 |
| af_Q54XJ8_10_262_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8905 | 33 | 188 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8892 | 46 | 174 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1F991-F1-model_v4 | Oxidoreductase | 0.9858 | 20 | 158 |
|
| AF-A0A6J7FQQ5-F1-model_v4 | Unannotated protein | 0.9799 | 19 | 203 |
|
| AF-A0A1Q7C5H5-F1-model_v4 | Sulfite oxidase-like oxidoreductase | 0.9797 | 19 | 200 |
|
| AF-A0A3L7QPB5-F1-model_v4 | Sulfite oxidase-like oxidoreductase | 0.9797 | 20 | 200 |
|
| AF-A0A3D5D7B0-F1-model_v4 | Sulfite oxidase-like oxidoreductase | 0.9795 | 20 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar