F472253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 360 | 1294 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300003758|Ga0055532_1007374|Ga0055532_10073742 |
| Length | 284 |
| Sequence | MRPRVPGTQKSRAAAPSRNAKAARKTGRRHPLATVALLAIGLGLTGGAYAAFTTTTASADTPQVQTASKSSVSQGEKLFQANCATCHGMDAQGTVNAPSLIGVGAAAVDFQVGTGRMPMQMQGPQAQEKPVQFSNEEVAALADYVASLAPGPSIPEQKYLDGKGDAANGAQLFRINCAMCHNVAGAGGALTEGKYAPPLTGVSAKHIYEAMVTGPQNMPVFNDLNISPQGKADIITYLKYIQNNPSPGGIELGSLGPVAEGLFLWIFGLGAIVALTVWITAKSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 74 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 128 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 131 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 145 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 149 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 150 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 151 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 184 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 185 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 186 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 187 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 188 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 189 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 225 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 226 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 231 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 232 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 233 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 234 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 235 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 236 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 237 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 238 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 239 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 240 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 243 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 244 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 247 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 248 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 249 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 250 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 251 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 252 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 253 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 254 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 255 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 256 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 257 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 258 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 259 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 260 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 261 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 262 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 263 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 264 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 265 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 266 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 267 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 268 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 269 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 270 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 271 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 272 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 273 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 274 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 275 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 276 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 277 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 278 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 279 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 280 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 281 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 282 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 283 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 284 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 285 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 286 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 287 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 288 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 289 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 290 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 291 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 292 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 293 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 294 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 295 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 296 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 297 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 298 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 299 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 300 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 301 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 302 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 303 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 304 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 305 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 306 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 307 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 308 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 309 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 310 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 311 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 312 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 313 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 314 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 315 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 316 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 317 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 318 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 319 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 320 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 321 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 322 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 323 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 324 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 325 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 326 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 327 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 328 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 329 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 330 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 331 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 332 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 333 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 334 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 335 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 336 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 337 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 338 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 339 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 340 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 341 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 342 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 343 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 344 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 345 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 346 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 347 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 348 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 349 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 350 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 351 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 352 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 353 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 354 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 355 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 356 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 357 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 358 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 359 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 360 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.44 |
| Metatranscriptomes | 2.94 |
| Isolates | 17.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.46 |
| Bulb | 0 |
| Endosphere | 11.75 |
| Nodule | 0 |
| Rhizoplane | 5.41 |
| Rhizosphere | 58.89 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055532_1007374 | 3300003758 | Bacteria | 1417 |
| 2 | JGI24740J21852_10008054 | 3300001979 | Bacteria | 4233 |
| 3 | JGI24735J21928_10001246 | 3300002067 | Bacteria | 9041 |
| 4 | JGI25162J39368_1005509 | 3300002737 | Bacteria | 2451 |
| 5 | JGI25154J39366_1002087 | 3300002738 | Bacteria | 5658 |
| 6 | JGI25164J39214_1000402 | 3300002772 | Bacteria | 24889 |
| 7 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 8 | Ga0006562J51391_1006933 | 3300003578 | Bacteria | 5677 |
| 9 | Ga0006562J51391_1019981 | 3300003578 | Bacteria | 1669 |
| 10 | Ga0006562J51391_1033231 | 3300003578 | Bacteria | 2010 |
| 11 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 12 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 13 | Ga0055525_1001044 | 3300003759 | Bacteria | 7187 |
| 14 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 15 | Ga0055529_1000019 | 3300003763 | Bacteria | 332786 |
| 16 | Ga0065714_10158447 | 3300005288 | Bacteria | 1062 |
| 17 | Ga0070658_10000090 | 3300005327 | Bacteria | 81871 |
| 18 | Ga0070658_10022190 | 3300005327 | Bacteria | 5093 |
| 19 | Ga0070658_10070677 | 3300005327 | Bacteria | 2858 |
| 20 | Ga0070658_10076165 | 3300005327 | Bacteria | 2752 |
| 21 | Ga0070658_10091022 | 3300005327 | Bacteria | 2514 |
| 22 | Ga0070666_10382779 | 3300005335 | Bacteria | 1010 |
| 23 | Ga0068868_100007759 | 3300005338 | Bacteria | 7659 |
| 24 | Ga0070660_100133719 | 3300005339 | Bacteria | 1986 |
| 25 | Ga0070668_100486275 | 3300005347 | Bacteria | 1067 |
| 26 | Ga0070675_100100920 | 3300005354 | Bacteria | 2430 |
| 27 | Ga0070671_100275704 | 3300005355 | Bacteria | 1430 |
| 28 | Ga0070659_100000366 | 3300005366 | Bacteria | 34220 |
| 29 | Ga0070659_100171619 | 3300005366 | Bacteria | 1777 |
| 30 | Ga0070667_100003912 | 3300005367 | Bacteria | 12649 |
| 31 | Ga0070710_10044198 | 3300005437 | Bacteria | 2471 |
| 32 | Ga0070710_10120455 | 3300005437 | Bacteria | 1588 |
| 33 | Ga0070708_100101597 | 3300005445 | Bacteria | 2634 |
| 34 | Ga0070685_10005499 | 3300005466 | Bacteria | 6420 |
| 35 | Ga0070706_100019402 | 3300005467 | Bacteria | 6271 |
| 36 | Ga0070707_100025370 | 3300005468 | Bacteria | 5622 |
| 37 | Ga0070707_100057127 | 3300005468 | Bacteria | 3744 |
| 38 | Ga0070707_100151205 | 3300005468 | Bacteria | 2260 |
| 39 | Ga0070699_100057532 | 3300005518 | Bacteria | 3368 |
| 40 | Ga0068853_100155362 | 3300005539 | Bacteria | 2061 |
| 41 | Ga0070665_100133320 | 3300005548 | Bacteria | 2486 |
| 42 | Ga0068855_100004431 | 3300005563 | Bacteria | 17153 |
| 43 | Ga0068857_100001886 | 3300005577 | Bacteria | 16895 |
| 44 | Ga0068857_100271612 | 3300005577 | Bacteria | 1558 |
| 45 | Ga0068856_100219122 | 3300005614 | Bacteria | 1918 |
| 46 | Ga0068856_100507080 | 3300005614 | Bacteria | 1227 |
| 47 | Ga0068852_100166555 | 3300005616 | Bacteria | 2062 |
| 48 | Ga0068852_100188659 | 3300005616 | Bacteria | 1943 |
| 49 | Ga0068861_100152300 | 3300005719 | Bacteria | 1899 |
| 50 | Ga0068861_100284773 | 3300005719 | Bacteria | 1425 |
| 51 | Ga0068851_10000020 | 3300005834 | Bacteria | 133551 |
| 52 | Ga0068863_100040998 | 3300005841 | Bacteria | 4402 |
| 53 | Ga0068863_100242043 | 3300005841 | Bacteria | 1741 |
| 54 | Ga0068858_100000233 | 3300005842 | Bacteria | 60097 |
| 55 | Ga0075365_10017575 | 3300006038 | Bacteria | 4379 |
| 56 | Ga0075365_10263022 | 3300006038 | Bacteria | 1213 |
| 57 | Ga0075368_10004737 | 3300006042 | Bacteria | 4629 |
| 58 | Ga0075364_10048122 | 3300006051 | Bacteria | 2778 |
| 59 | Ga0075364_10063109 | 3300006051 | Bacteria | 2432 |
| 60 | Ga0075364_10229071 | 3300006051 | Bacteria | 1262 |
| 61 | Ga0075364_10323955 | 3300006051 | Bacteria | 1049 |
| 62 | Ga0075367_10005074 | 3300006178 | Bacteria | 6500 |
| 63 | Ga0075369_10015926 | 3300006186 | Bacteria | 3025 |
| 64 | Ga0075370_10009068 | 3300006353 | Bacteria | 5145 |
| 65 | Ga0075370_10144562 | 3300006353 | Bacteria | 1391 |
| 66 | Ga0105244_10056462 | 3300009036 | Bacteria | 1987 |
| 67 | Ga0105240_10002356 | 3300009093 | Bacteria | 30453 |
| 68 | Ga0111539_10367523 | 3300009094 | Bacteria | 1674 |
| 69 | Ga0105245_10004100 | 3300009098 | Bacteria | 12935 |
| 70 | Ga0105245_10025054 | 3300009098 | Bacteria | 5245 |
| 71 | Ga0105247_10051465 | 3300009101 | Bacteria | 2536 |
| 72 | Ga0105247_10208780 | 3300009101 | Bacteria | 1316 |
| 73 | Ga0105243_10074592 | 3300009148 | Bacteria | 2752 |
| 74 | Ga0105243_10096103 | 3300009148 | Bacteria | 2450 |
| 75 | Ga0105241_10009358 | 3300009174 | Bacteria | 7201 |
| 76 | Ga0105248_10000714 | 3300009177 | Bacteria | 37567 |
| 77 | Ga0105248_10095008 | 3300009177 | Bacteria | 3356 |
| 78 | Ga0105237_10012072 | 3300009545 | Bacteria | 9124 |
| 79 | Ga0105237_10209342 | 3300009545 | Bacteria | 1950 |
| 80 | Ga0105237_10239404 | 3300009545 | Bacteria | 1816 |
| 81 | Ga0105238_10166277 | 3300009551 | Bacteria | 2182 |
| 82 | Ga0105238_10531507 | 3300009551 | Bacteria | 1179 |
| 83 | Ga0105239_10050863 | 3300010375 | Bacteria | 4544 |
| 84 | Ga0105246_10236366 | 3300011119 | Bacteria | 1442 |
| 85 | Ga0157371_10130247 | 3300013102 | Bacteria | 1790 |
| 86 | Ga0157370_10011227 | 3300013104 | Bacteria | 9392 |
| 87 | Ga0157370_10038884 | 3300013104 | Bacteria | 4601 |
| 88 | Ga0157369_10021407 | 3300013105 | Bacteria | 7233 |
| 89 | Ga0157369_10031237 | 3300013105 | Bacteria | 5867 |
| 90 | Ga0157369_10113027 | 3300013105 | Bacteria | 2885 |
| 91 | Ga0157369_10305140 | 3300013105 | Bacteria | 1656 |
| 92 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 93 | Ga0157374_10393727 | 3300013296 | Bacteria | 1381 |
| 94 | Ga0163162_10011086 | 3300013306 | Bacteria | 8782 |
| 95 | Ga0163162_10360031 | 3300013306 | Bacteria | 1588 |
| 96 | Ga0157372_10031466 | 3300013307 | Bacteria | 5809 |
| 97 | Ga0157372_10202614 | 3300013307 | Bacteria | 2299 |
| 98 | Ga0157372_10203822 | 3300013307 | Bacteria | 2292 |
| 99 | Ga0157372_10309238 | 3300013307 | Bacteria | 1839 |
| 100 | Ga0157372_10860525 | 3300013307 | Bacteria | 1052 |
| 101 | Ga0163163_10016022 | 3300014325 | Bacteria | 6950 |
| 102 | Ga0157380_10245759 | 3300014326 | Bacteria | 1616 |
| 103 | Ga0157377_10194864 | 3300014745 | Bacteria | 1283 |
| 104 | Ga0157379_10006941 | 3300014968 | Bacteria | 9795 |
| 105 | Ga0157376_10273357 | 3300014969 | Bacteria | 1588 |
| 106 | Ga0197907_11125962 | 3300020069 | Bacteria | 2812 |
| 107 | Ga0197907_11300642 | 3300020069 | Bacteria | 1712 |
| 108 | Ga0206356_11508020 | 3300020070 | Bacteria | 4288 |
| 109 | Ga0206349_1688277 | 3300020075 | Bacteria | 3332 |
| 110 | Ga0206355_1473399 | 3300020076 | Bacteria | 1215 |
| 111 | Ga0206352_10442088 | 3300020078 | Bacteria | 1762 |
| 112 | Ga0206354_11186439 | 3300020081 | Bacteria | 1755 |
| 113 | Ga0206354_11188215 | 3300020081 | Bacteria | 3375 |
| 114 | Ga0206353_10742709 | 3300020082 | Bacteria | 1843 |
| 115 | Ga0206353_11111984 | 3300020082 | Bacteria | 3046 |
| 116 | Ga0206353_11696962 | 3300020082 | Bacteria | 8101 |
| 117 | Ga0224712_10003247 | 3300022467 | Bacteria | 4186 |
| 118 | Ga0224712_10006014 | 3300022467 | Bacteria | 3429 |
| 119 | Ga0224712_10015458 | 3300022467 | Bacteria | 2484 |
| 120 | Ga0224712_10045271 | 3300022467 | Bacteria | 1683 |
| 121 | Ga0209566_100149 | 3300025225 | Bacteria | 81626 |
| 122 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 123 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 124 | Ga0209147_100849 | 3300025229 | Bacteria | 14329 |
| 125 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 126 | Ga0209563_103901 | 3300025230 | Bacteria | 2962 |
| 127 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 128 | Ga0209437_100216 | 3300025233 | Bacteria | 106353 |
| 129 | Ga0209258_101905 | 3300025242 | Bacteria | 6178 |
| 130 | Ga0209646_1000071 | 3300025246 | Bacteria | 228702 |
| 131 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 132 | Ga0209677_101181 | 3300025253 | Bacteria | 11978 |
| 133 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 134 | Ga0209148_1002856 | 3300025254 | Bacteria | 5308 |
| 135 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 136 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 137 | Ga0209455_1000811 | 3300025272 | Bacteria | 17057 |
| 138 | Ga0207656_10000012 | 3300025321 | Bacteria | 190545 |
| 139 | Ga0207655_1017656 | 3300025728 | Bacteria | 3837 |
| 140 | Ga0207692_10096257 | 3300025898 | Bacteria | 1616 |
| 141 | Ga0207647_10010718 | 3300025904 | Bacteria | 6457 |
| 142 | Ga0207643_10209166 | 3300025908 | Bacteria | 1190 |
| 143 | Ga0207643_10229181 | 3300025908 | Bacteria | 1139 |
| 144 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 145 | Ga0207705_10018609 | 3300025909 | Bacteria | 4966 |
| 146 | Ga0207705_10031366 | 3300025909 | Bacteria | 3793 |
| 147 | Ga0207705_10114097 | 3300025909 | Bacteria | 1998 |
| 148 | Ga0207684_10046534 | 3300025910 | Bacteria | 3681 |
| 149 | Ga0207684_10055330 | 3300025910 | Bacteria | 3366 |
| 150 | Ga0207684_10092693 | 3300025910 | Bacteria | 2575 |
| 151 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 152 | Ga0207695_10005466 | 3300025913 | Bacteria | 16830 |
| 153 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 154 | Ga0207671_10047724 | 3300025914 | Bacteria | 3169 |
| 155 | Ga0207660_10071151 | 3300025917 | Bacteria | 2530 |
| 156 | Ga0207662_10170876 | 3300025918 | Bacteria | 1394 |
| 157 | Ga0207657_10018899 | 3300025919 | Bacteria | 6561 |
| 158 | Ga0207657_10254821 | 3300025919 | Bacteria | 1398 |
| 159 | Ga0207649_10143594 | 3300025920 | Bacteria | 1636 |
| 160 | Ga0207652_10138855 | 3300025921 | Bacteria | 2172 |
| 161 | Ga0207646_10010011 | 3300025922 | Bacteria | 9309 |
| 162 | Ga0207646_10015579 | 3300025922 | Bacteria | 7176 |
| 163 | Ga0207646_10125443 | 3300025922 | Bacteria | 2308 |
| 164 | Ga0207694_10000433 | 3300025924 | Bacteria | 38856 |
| 165 | Ga0207687_10010597 | 3300025927 | Bacteria | 6026 |
| 166 | Ga0207687_10041380 | 3300025927 | Bacteria | 3164 |
| 167 | Ga0207690_10001456 | 3300025932 | Bacteria | 14803 |
| 168 | Ga0207690_10160280 | 3300025932 | Bacteria | 1676 |
| 169 | Ga0207709_10051138 | 3300025935 | Bacteria | 2531 |
| 170 | Ga0207709_10187475 | 3300025935 | Bacteria | 1466 |
| 171 | Ga0207709_10226261 | 3300025935 | Bacteria | 1352 |
| 172 | Ga0207691_10177924 | 3300025940 | Bacteria | 1860 |
| 173 | Ga0207711_10001344 | 3300025941 | Bacteria | 23198 |
| 174 | Ga0207711_10003878 | 3300025941 | Bacteria | 12868 |
| 175 | Ga0207667_10003435 | 3300025949 | Bacteria | 19553 |
| 176 | Ga0207667_10028110 | 3300025949 | Bacteria | 6110 |
| 177 | Ga0207667_10034482 | 3300025949 | Bacteria | 5434 |
| 178 | Ga0207667_10141355 | 3300025949 | Bacteria | 2478 |
| 179 | Ga0207668_10065840 | 3300025972 | Bacteria | 2566 |
| 180 | Ga0207658_10007898 | 3300025986 | Bacteria | 7247 |
| 181 | Ga0207677_10041301 | 3300026023 | Bacteria | 3049 |
| 182 | Ga0207703_10000044 | 3300026035 | Bacteria | 158471 |
| 183 | Ga0207703_10405855 | 3300026035 | Bacteria | 1265 |
| 184 | Ga0207639_10429874 | 3300026041 | Bacteria | 1195 |
| 185 | Ga0207678_10311108 | 3300026067 | Bacteria | 1354 |
| 186 | Ga0207641_10059147 | 3300026088 | Bacteria | 3263 |
| 187 | Ga0207641_10164418 | 3300026088 | Bacteria | 2020 |
| 188 | Ga0207674_10004435 | 3300026116 | Bacteria | 16874 |
| 189 | Ga0207674_10216336 | 3300026116 | Bacteria | 1864 |
| 190 | Ga0207674_10313232 | 3300026116 | Bacteria | 1519 |
| 191 | Ga0207675_100025236 | 3300026118 | Bacteria | 5532 |
| 192 | Ga0207675_100558345 | 3300026118 | Bacteria | 1145 |
| 193 | Ga0207698_10004859 | 3300026142 | Bacteria | 8236 |
| 194 | Ga0209813_10008542 | 3300027866 | Bacteria | 2592 |
| 195 | Ga0268266_10172760 | 3300028379 | Bacteria | 1962 |
| 196 | Ga0307515_10065688 | 3300028794 | Bacteria | 5043 |
| 197 | Ga0314311_1115621 | 3300030733 | Bacteria | 1197 |
| 198 | Ga0316179_1009441 | 3300030734 | Bacteria | 1942 |
| 199 | Ga0307513_10216642 | 3300031456 | Bacteria | 1740 |
| 200 | Ga0307514_10016061 | 3300031649 | Bacteria | 6169 |
| 201 | Ga0307413_10382705 | 3300031824 | Bacteria | 1097 |
| 202 | Ga0307410_10045839 | 3300031852 | Bacteria | 2914 |
| 203 | Ga0307410_10048629 | 3300031852 | Bacteria | 2842 |
| 204 | Ga0307410_10129657 | 3300031852 | Bacteria | 1851 |
| 205 | Ga0307406_10000235 | 3300031901 | Bacteria | 33683 |
| 206 | Ga0307406_10057164 | 3300031901 | Bacteria | 2501 |
| 207 | Ga0307406_10160943 | 3300031901 | Bacteria | 1613 |
| 208 | Ga0307406_10489345 | 3300031901 | Bacteria | 995 |
| 209 | Ga0307412_10034093 | 3300031911 | Bacteria | 3242 |
| 210 | Ga0307409_100045968 | 3300031995 | Bacteria | 3301 |
| 211 | Ga0307409_100060763 | 3300031995 | Bacteria | 2949 |
| 212 | Ga0307409_100146398 | 3300031995 | Bacteria | 2043 |
| 213 | Ga0307409_100195485 | 3300031995 | Bacteria | 1805 |
| 214 | Ga0307409_100216028 | 3300031995 | Bacteria | 1727 |
| 215 | Ga0307416_100040035 | 3300032002 | Bacteria | 3636 |
| 216 | Ga0307416_100056049 | 3300032002 | Bacteria | 3178 |
| 217 | Ga0307416_100672619 | 3300032002 | Bacteria | 1122 |
| 218 | Ga0307416_100783866 | 3300032002 | Bacteria | 1048 |
| 219 | Ga0307414_10022142 | 3300032004 | Bacteria | 4003 |
| 220 | Ga0307414_10208528 | 3300032004 | Bacteria | 1595 |
| 221 | Ga0307414_10547430 | 3300032004 | Bacteria | 1031 |
| 222 | Ga0307414_10763304 | 3300032004 | Bacteria | 880 |
| 223 | Ga0307411_10081730 | 3300032005 | Bacteria | 2226 |
| 224 | Ga0307415_100148252 | 3300032126 | Bacteria | 1802 |
| 225 | Ga0395899_0022953 | 3300037312 | Bacteria | 4727 |
| 226 | Ga0395899_0070509 | 3300037312 | Bacteria | 2558 |
| 227 | Ga0395900_0000774 | 3300037418 | Bacteria | 42584 |
| 228 | Ga0395900_0006765 | 3300037418 | Bacteria | 11898 |
| 229 | Ga0395900_0197058 | 3300037418 | Bacteria | 2040 |
| 230 | Ga0395898_0000015 | 3300037466 | Bacteria | 439819 |
| 231 | Ga0395898_0086750 | 3300037466 | Bacteria | 3016 |
| 232 | Ga0395898_0184773 | 3300037466 | Bacteria | 1992 |
| 233 | Ga0395901_0027940 | 3300038443 | Bacteria | 5801 |
| 234 | Ga0395901_0049595 | 3300038443 | Bacteria | 4362 |
| 235 | Ga0439465_0097340 | 3300041413 | Bacteria | 1013 |
| 236 | Ga0451791_0837996 | 3300041451 | Bacteria | 2179 |
| 237 | Ga0451797_0483182 | 3300041453 | Bacteria | 1130 |
| 238 | Ga0451802_0750017 | 3300041460 | Bacteria | 925 |
| 239 | Ga0451837_0363453 | 3300041494 | Bacteria | 967 |
| 240 | Ga0451841_0047102 | 3300041498 | Bacteria | 1465 |
| 241 | Ga0451853_3801612 | 3300041512 | Bacteria | 1128 |
| 242 | Ga0450900_003942 | 3300042136 | Bacteria | 1679 |
| 243 | Ga0466972_0013783 | 3300044658 | Bacteria | 4057 |
| 244 | Ga0466972_0050673 | 3300044658 | Bacteria | 2003 |
| 245 | Ga0466972_0067322 | 3300044658 | Bacteria | 1711 |
| 246 | Ga0466972_0089529 | 3300044658 | Bacteria | 1460 |
| 247 | Ga0466965_0000049 | 3300044683 | Bacteria | 41316 |
| 248 | Ga0466965_0007873 | 3300044683 | Bacteria | 4913 |
| 249 | Ga0466965_0013587 | 3300044683 | Bacteria | 3844 |
| 250 | Ga0466965_0039830 | 3300044683 | Bacteria | 2310 |
| 251 | Ga0466965_0045130 | 3300044683 | Bacteria | 2179 |
| 252 | Ga0466965_0195055 | 3300044683 | Bacteria | 1072 |
| 253 | Ga0466965_0222987 | 3300044683 | Bacteria | 1005 |
| 254 | Ga0466961_0024014 | 3300044693 | Bacteria | 3922 |
| 255 | Ga0466961_0027770 | 3300044693 | Bacteria | 3640 |
| 256 | Ga0466964_0012477 | 3300044706 | Bacteria | 3215 |
| 257 | Ga0466971_0024843 | 3300044719 | Bacteria | 2674 |
| 258 | Ga0466968_0001253 | 3300044735 | Bacteria | 9028 |
| 259 | Ga0466968_0031845 | 3300044735 | Bacteria | 2190 |
| 260 | Ga0466968_0083071 | 3300044735 | Bacteria | 1410 |
| 261 | Ga0466970_0000004 | 3300044765 | Bacteria | 108620 |
| 262 | Ga0466970_0004242 | 3300044765 | Bacteria | 7054 |
| 263 | Ga0466970_0007086 | 3300044765 | Bacteria | 5608 |
| 264 | Ga0466970_0007409 | 3300044765 | Bacteria | 5497 |
| 265 | Ga0466970_0017425 | 3300044765 | Bacteria | 3711 |
| 266 | Ga0466970_0024528 | 3300044765 | Bacteria | 3154 |
| 267 | Ga0466970_0027715 | 3300044765 | Bacteria | 2973 |
| 268 | Ga0466970_0048621 | 3300044765 | Bacteria | 2261 |
| 269 | Ga0466970_0049233 | 3300044765 | Bacteria | 2247 |
| 270 | Ga0466970_0067272 | 3300044765 | Bacteria | 1924 |
| 271 | Ga0466957_0017532 | 3300044842 | Bacteria | 4196 |
| 272 | Ga0466957_0126418 | 3300044842 | Bacteria | 1634 |
| 273 | Ga0466960_0006777 | 3300044901 | Bacteria | 4613 |
| 274 | Ga0466960_0031038 | 3300044901 | Bacteria | 2463 |
| 275 | Ga0466960_0120674 | 3300044901 | Bacteria | 1373 |
| 276 | Ga0466960_0190010 | 3300044901 | Bacteria | 1117 |
| 277 | Ga0466958_0008749 | 3300045836 | Bacteria | 5620 |
| 278 | Ga0495590_0000109 | 3300046457 | Bacteria | 50065 |
| 279 | Ga0495638_0162889 | 3300046460 | Bacteria | 1285 |
| 280 | Ga0495654_0033080 | 3300046530 | Bacteria | 2618 |
| 281 | Ga0495609_0013502 | 3300046538 | Bacteria | 3855 |
| 282 | Ga0495625_0060683 | 3300046660 | Bacteria | 2679 |
| 283 | Ga0495686_0145880 | 3300047472 | Bacteria | 1393 |
| 284 | Ga0496100_0014695 | 3300048903 | Bacteria | 4553 |
| 285 | Ga0496100_0032634 | 3300048903 | Bacteria | 3249 |
| 286 | Ga0496100_0211424 | 3300048903 | Bacteria | 1419 |
| 287 | Ga0496101_0069903 | 3300048904 | Bacteria | 2569 |
| 288 | Ga0496102_0070307 | 3300048905 | Bacteria | 3214 |
| 289 | Ga0496102_0093765 | 3300048905 | Bacteria | 2781 |
| 290 | Ga0496103_0040021 | 3300048906 | Bacteria | 2881 |
| 291 | Ga0496103_0055950 | 3300048906 | Bacteria | 2448 |
| 292 | Ga0496104_0054964 | 3300048907 | Bacteria | 3763 |
| 293 | Ga0496104_0153567 | 3300048907 | Bacteria | 2209 |
| 294 | Ga0496105_0026904 | 3300048908 | Bacteria | 4694 |
| 295 | Ga0496105_0054164 | 3300048908 | Bacteria | 3312 |
| 296 | Ga0496106_0062189 | 3300048909 | Bacteria | 2834 |
| 297 | Ga0496107_0014832 | 3300048910 | Bacteria | 5455 |
| 298 | Ga0496108_0094399 | 3300048911 | Bacteria | 2546 |
| 299 | Ga0496109_0166893 | 3300048912 | Bacteria | 2064 |
| 300 | Ga0496109_0179762 | 3300048912 | Bacteria | 1986 |
| 301 | Ga0496109_0260847 | 3300048912 | Bacteria | 1632 |
| 302 | Ga0496110_0112196 | 3300048913 | Bacteria | 2451 |
| 303 | Ga0496110_0128713 | 3300048913 | Bacteria | 2285 |
| 304 | Ga0496111_0006270 | 3300048914 | Bacteria | 7711 |
| 305 | Ga0496113_0078866 | 3300048916 | Bacteria | 2520 |
| 306 | Ga0496113_0161694 | 3300048916 | Bacteria | 1770 |
| 307 | Ga0496113_0402284 | 3300048916 | Bacteria | 1099 |
| 308 | Ga0496114_0013770 | 3300048917 | Bacteria | 6481 |
| 309 | Ga0496114_0020705 | 3300048917 | Bacteria | 5339 |
| 310 | Ga0496114_0072502 | 3300048917 | Bacteria | 2897 |
| 311 | Ga0496114_0102901 | 3300048917 | Bacteria | 2440 |
| 312 | Ga0496115_0022524 | 3300048918 | Bacteria | 4882 |
| 313 | Ga0496115_0042030 | 3300048918 | Bacteria | 3640 |
| 314 | Ga0496115_0079583 | 3300048918 | Bacteria | 2667 |
| 315 | Ga0496115_0200849 | 3300048918 | Bacteria | 1647 |
| 316 | Ga0496116_0003139 | 3300048919 | Bacteria | 16570 |
| 317 | Ga0496116_0054133 | 3300048919 | Bacteria | 2646 |
| 318 | Ga0496117_0000232 | 3300048920 | Bacteria | 105479 |
| 319 | Ga0496117_0000737 | 3300048920 | Bacteria | 51396 |
| 320 | Ga0496117_0004041 | 3300048920 | Bacteria | 16494 |
| 321 | Ga0496117_0005578 | 3300048920 | Bacteria | 13171 |
| 322 | Ga0496117_0005793 | 3300048920 | Bacteria | 12820 |
| 323 | Ga0496117_0007542 | 3300048920 | Bacteria | 10601 |
| 324 | Ga0496117_0029392 | 3300048920 | Bacteria | 4238 |
| 325 | Ga0496117_0122767 | 3300048920 | Bacteria | 1592 |
| 326 | Ga0496118_0000605 | 3300048921 | Bacteria | 59079 |
| 327 | Ga0496118_0002736 | 3300048921 | Bacteria | 23202 |
| 328 | Ga0496118_0003338 | 3300048921 | Bacteria | 20307 |
| 329 | Ga0496118_0004186 | 3300048921 | Bacteria | 17357 |
| 330 | Ga0496118_0052256 | 3300048921 | Bacteria | 3119 |
| 331 | Ga0496118_0063147 | 3300048921 | Bacteria | 2727 |
| 332 | Ga0496118_0105327 | 3300048921 | Bacteria | 1891 |
| 333 | Ga0496118_0296780 | 3300048921 | Bacteria | 890 |
| 334 | Ga0496119_0000341 | 3300048922 | Bacteria | 65282 |
| 335 | Ga0496119_0002020 | 3300048922 | Bacteria | 22984 |
| 336 | Ga0496119_0002098 | 3300048922 | Bacteria | 22484 |
| 337 | Ga0496119_0003222 | 3300048922 | Bacteria | 17077 |
| 338 | Ga0496119_0006922 | 3300048922 | Bacteria | 10343 |
| 339 | Ga0496119_0009424 | 3300048922 | Bacteria | 8383 |
| 340 | Ga0496119_0020558 | 3300048922 | Bacteria | 4812 |
| 341 | Ga0496119_0022129 | 3300048922 | Bacteria | 4565 |
| 342 | Ga0496119_0053891 | 3300048922 | Bacteria | 2453 |
| 343 | Ga0496119_0055305 | 3300048922 | Bacteria | 2411 |
| 344 | Ga0496119_0240361 | 3300048922 | Bacteria | 917 |
| 345 | Ga0496119_0250809 | 3300048922 | Bacteria | 892 |
| 346 | Ga0496120_0000456 | 3300048923 | Bacteria | 64535 |
| 347 | Ga0496120_0001183 | 3300048923 | Bacteria | 33176 |
| 348 | Ga0496120_0031385 | 3300048923 | Bacteria | 3218 |
| 349 | Ga0496120_0033960 | 3300048923 | Bacteria | 3060 |
| 350 | Ga0496120_0041571 | 3300048923 | Bacteria | 2691 |
| 351 | Ga0496120_0057518 | 3300048923 | Bacteria | 2188 |
| 352 | Ga0496120_0058400 | 3300048923 | Bacteria | 2167 |
| 353 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 354 | Ga0496121_0064938 | 3300048924 | Bacteria | 2973 |
| 355 | Ga0496121_0110041 | 3300048924 | Bacteria | 2103 |
| 356 | Ga0496122_0000030 | 3300048925 | Bacteria | 331586 |
| 357 | Ga0496122_0000120 | 3300048925 | Bacteria | 182539 |
| 358 | Ga0496122_0005995 | 3300048925 | Bacteria | 14196 |
| 359 | Ga0496122_0007503 | 3300048925 | Bacteria | 12099 |
| 360 | Ga0496122_0032104 | 3300048925 | Bacteria | 4349 |
| 361 | Ga0496122_0034773 | 3300048925 | Bacteria | 4115 |
| 362 | Ga0496122_0069611 | 3300048925 | Bacteria | 2519 |
| 363 | Ga0496122_0070228 | 3300048925 | Bacteria | 2504 |
| 364 | Ga0496123_0000024 | 3300048926 | Bacteria | 331587 |
| 365 | Ga0496123_0000051 | 3300048926 | Bacteria | 237095 |
| 366 | Ga0496123_0002368 | 3300048926 | Bacteria | 23643 |
| 367 | Ga0496123_0002701 | 3300048926 | Bacteria | 21334 |
| 368 | Ga0496123_0009280 | 3300048926 | Bacteria | 8880 |
| 369 | Ga0496123_0038834 | 3300048926 | Bacteria | 3340 |
| 370 | Ga0496123_0053387 | 3300048926 | Bacteria | 2671 |
| 371 | Ga0496124_0000363 | 3300048927 | Bacteria | 82857 |
| 372 | Ga0496124_0002437 | 3300048927 | Bacteria | 24376 |
| 373 | Ga0496124_0005016 | 3300048927 | Bacteria | 15139 |
| 374 | Ga0496124_0005922 | 3300048927 | Bacteria | 13525 |
| 375 | Ga0496124_0120420 | 3300048927 | Bacteria | 2098 |
| 376 | Ga0496124_0147008 | 3300048927 | Bacteria | 1853 |
| 377 | Ga0496125_0000097 | 3300048928 | Bacteria | 204607 |
| 378 | Ga0496125_0001405 | 3300048928 | Bacteria | 35141 |
| 379 | Ga0496125_0002686 | 3300048928 | Bacteria | 22659 |
| 380 | Ga0496125_0018821 | 3300048928 | Bacteria | 6540 |
| 381 | Ga0496125_0049251 | 3300048928 | Bacteria | 3503 |
| 382 | Ga0496125_0220907 | 3300048928 | Bacteria | 1221 |
| 383 | Ga0496126_0001194 | 3300048929 | Bacteria | 42334 |
| 384 | Ga0496126_0002527 | 3300048929 | Bacteria | 24495 |
| 385 | Ga0496126_0012898 | 3300048929 | Bacteria | 8534 |
| 386 | Ga0496126_0020398 | 3300048929 | Bacteria | 6499 |
| 387 | Ga0496126_0025034 | 3300048929 | Bacteria | 5751 |
| 388 | Ga0496126_0035675 | 3300048929 | Bacteria | 4658 |
| 389 | Ga0496126_0043490 | 3300048929 | Bacteria | 4143 |
| 390 | Ga0496126_0075463 | 3300048929 | Bacteria | 2992 |
| 391 | Ga0496126_0212335 | 3300048929 | Bacteria | 1629 |
| 392 | Ga0496126_0267941 | 3300048929 | Bacteria | 1418 |
| 393 | Ga0496126_0405216 | 3300048929 | Bacteria | 1105 |
| 394 | Ga0501031_0000454 | 3300049568 | Bacteria | 23726 |
| 395 | Ga0501031_0014045 | 3300049568 | Bacteria | 5212 |
| 396 | Ga0501031_0267153 | 3300049568 | Bacteria | 1111 |
| 397 | Ga0501032_0018756 | 3300049569 | Bacteria | 4842 |
| 398 | Ga0501032_0032274 | 3300049569 | Bacteria | 3588 |
| 399 | Ga0501032_0213185 | 3300049569 | Bacteria | 1258 |
| 400 | Ga0501032_0304133 | 3300049569 | Bacteria | 1031 |
| 401 | Ga0501033_0011741 | 3300049570 | Bacteria | 6698 |
| 402 | Ga0501033_0028007 | 3300049570 | Bacteria | 4234 |
| 403 | Ga0501033_0113416 | 3300049570 | Bacteria | 1971 |
| 404 | Ga0501033_0134828 | 3300049570 | Bacteria | 1787 |
| 405 | Ga0501033_0155564 | 3300049570 | Bacteria | 1647 |
| 406 | Ga0501033_0293698 | 3300049570 | Bacteria | 1145 |
| 407 | Ga0501034_0000227 | 3300049571 | Bacteria | 106244 |
| 408 | Ga0501034_0007058 | 3300049571 | Bacteria | 11983 |
| 409 | Ga0501034_0018450 | 3300049571 | Bacteria | 7155 |
| 410 | Ga0501034_0025911 | 3300049571 | Bacteria | 5973 |
| 411 | Ga0501034_0036437 | 3300049571 | Bacteria | 4983 |
| 412 | Ga0501034_0038369 | 3300049571 | Bacteria | 4850 |
| 413 | Ga0501034_0067417 | 3300049571 | Bacteria | 3591 |
| 414 | Ga0501034_0068832 | 3300049571 | Bacteria | 3550 |
| 415 | Ga0501034_0077168 | 3300049571 | Bacteria | 3337 |
| 416 | Ga0501034_0235466 | 3300049571 | Bacteria | 1779 |
| 417 | Ga0501034_0619172 | 3300049571 | Bacteria | 986 |
| 418 | Ga0501036_0045835 | 3300049572 | Bacteria | 3703 |
| 419 | Ga0501036_0074956 | 3300049572 | Bacteria | 2861 |
| 420 | Ga0501036_0088330 | 3300049572 | Bacteria | 2619 |
| 421 | Ga0501036_0472520 | 3300049572 | Bacteria | 1044 |
| 422 | Ga0501037_0000536 | 3300049573 | Bacteria | 30298 |
| 423 | Ga0501037_0022052 | 3300049573 | Bacteria | 4714 |
| 424 | Ga0501037_0075830 | 3300049573 | Bacteria | 2442 |
| 425 | Ga0501038_0005424 | 3300049574 | Bacteria | 11852 |
| 426 | Ga0501038_0021735 | 3300049574 | Bacteria | 5756 |
| 427 | Ga0501038_0047429 | 3300049574 | Bacteria | 3721 |
| 428 | Ga0501038_0206603 | 3300049574 | Bacteria | 1573 |
| 429 | Ga0501038_0258698 | 3300049574 | Bacteria | 1376 |
| 430 | Ga0501039_0026758 | 3300049575 | Bacteria | 4432 |
| 431 | Ga0501039_0064719 | 3300049575 | Bacteria | 2835 |
| 432 | Ga0501039_0078754 | 3300049575 | Bacteria | 2564 |
| 433 | Ga0501039_0364033 | 3300049575 | Bacteria | 1136 |
| 434 | Ga0501040_0274130 | 3300049576 | Bacteria | 1205 |
| 435 | Ga0501041_0363077 | 3300049577 | Bacteria | 916 |
| 436 | Ga0501042_0003632 | 3300049578 | Bacteria | 9730 |
| 437 | Ga0501043_0002454 | 3300049579 | Bacteria | 15682 |
| 438 | Ga0501043_0029285 | 3300049579 | Bacteria | 4325 |
| 439 | Ga0501043_0104286 | 3300049579 | Bacteria | 2228 |
| 440 | Ga0501043_0321223 | 3300049579 | Bacteria | 1180 |
| 441 | Ga0501046_0033391 | 3300049580 | Bacteria | 4157 |
| 442 | Ga0501046_0115627 | 3300049580 | Bacteria | 2045 |
| 443 | Ga0501046_0183692 | 3300049580 | Bacteria | 1562 |
| 444 | Ga0501046_0529680 | 3300049580 | Bacteria | 841 |
| 445 | Ga0501047_0014035 | 3300049581 | Bacteria | 7612 |
| 446 | Ga0501047_0014129 | 3300049581 | Bacteria | 7587 |
| 447 | Ga0501047_0055159 | 3300049581 | Bacteria | 3843 |
| 448 | Ga0501047_0068104 | 3300049581 | Bacteria | 3429 |
| 449 | Ga0501047_0090472 | 3300049581 | Bacteria | 2937 |
| 450 | Ga0501047_0228375 | 3300049581 | Bacteria | 1715 |
| 451 | Ga0501048_0030390 | 3300049582 | Bacteria | 3908 |
| 452 | Ga0501068_0046523 | 3300049584 | Bacteria | 2617 |
| 453 | Ga0501070_0000167 | 3300049586 | Bacteria | 60680 |
| 454 | Ga0501070_0002705 | 3300049586 | Bacteria | 15477 |
| 455 | Ga0501070_0010791 | 3300049586 | Bacteria | 7718 |
| 456 | Ga0501070_0049972 | 3300049586 | Bacteria | 3472 |
| 457 | Ga0501070_0055423 | 3300049586 | Bacteria | 3285 |
| 458 | Ga0501070_0124206 | 3300049586 | Bacteria | 2133 |
| 459 | Ga0501070_0195505 | 3300049586 | Bacteria | 1661 |
| 460 | Ga0501070_0341028 | 3300049586 | Bacteria | 1217 |
| 461 | Ga0501071_0238642 | 3300049587 | Bacteria | 1370 |
| 462 | Ga0501072_0026621 | 3300049588 | Bacteria | 4509 |
| 463 | Ga0501072_0116858 | 3300049588 | Bacteria | 2125 |
| 464 | Ga0501073_0009587 | 3300049589 | Bacteria | 7141 |
| 465 | Ga0501073_0112185 | 3300049589 | Bacteria | 1891 |
| 466 | Ga0501074_0010738 | 3300049590 | Bacteria | 6654 |
| 467 | Ga0501076_0250295 | 3300049592 | Bacteria | 1450 |
| 468 | Ga0501079_0521382 | 3300049741 | Bacteria | 934 |
| 469 | Ga0501080_0000084 | 3300049742 | Bacteria | 62784 |
| 470 | Ga0501080_0193318 | 3300049742 | Bacteria | 1869 |
| 471 | Ga0501080_0731200 | 3300049742 | Bacteria | 871 |
| 472 | Ga0501083_0000027 | 3300049744 | Bacteria | 117605 |
| 473 | Ga0501083_0024223 | 3300049744 | Bacteria | 4207 |
| 474 | Ga0501083_0062547 | 3300049744 | Bacteria | 2483 |
| 475 | Ga0501035_0020396 | 3300049822 | Bacteria | 6085 |
| 476 | Ga0501035_0023927 | 3300049822 | Bacteria | 5605 |
| 477 | Ga0501035_0091587 | 3300049822 | Bacteria | 2675 |
| 478 | Ga0501035_0252001 | 3300049822 | Bacteria | 1499 |
| 479 | Ga0501035_0568902 | 3300049822 | Bacteria | 926 |
| 480 | Ga0501044_0004023 | 3300049823 | Bacteria | 16480 |
| 481 | Ga0501044_0004313 | 3300049823 | Bacteria | 15948 |
| 482 | Ga0501044_0046051 | 3300049823 | Bacteria | 4517 |
| 483 | Ga0501044_0056141 | 3300049823 | Bacteria | 4043 |
| 484 | Ga0501044_0082435 | 3300049823 | Bacteria | 3254 |
| 485 | Ga0501044_0130389 | 3300049823 | Bacteria | 2508 |
| 486 | Ga0501044_0144912 | 3300049823 | Bacteria | 2361 |
| 487 | Ga0501044_0309587 | 3300049823 | Bacteria | 1506 |
| 488 | Ga0501045_0047611 | 3300049824 | Bacteria | 3123 |
| 489 | nmdc:mga00v17_10485_c1 | 3300050491 | Bacteria | 5061 |
| 490 | nmdc:mga00v17_12805_c1 | 3300050491 | Bacteria | 4636 |
| 491 | nmdc:mga00v17_221202_c1 | 3300050491 | Bacteria | 1226 |
| 492 | nmdc:mga00v17_34683_c1 | 3300050491 | Bacteria | 2999 |
| 493 | nmdc:mga0yw44_11968_c1 | 3300050492 | Bacteria | 4504 |
| 494 | nmdc:mga0yw44_176629_c1 | 3300050492 | Bacteria | 1404 |
| 495 | nmdc:mga0yw44_26395_c1 | 3300050492 | Bacteria | 3317 |
| 496 | nmdc:mga06z11_4650_c1 | 3300050494 | Bacteria | 5414 |
| 497 | nmdc:mga04h51_1398_c1 | 3300050495 | Bacteria | 5576 |
| 498 | nmdc:mga07m45_4789_c1 | 3300050496 | Bacteria | 6658 |
| 499 | nmdc:mga08y16_344289_c1 | 3300050511 | Bacteria | 1532 |
| 500 | Ga0500635_0000028 | 3300053080 | Bacteria | 104398 |
| 501 | Ga0500635_0008122 | 3300053080 | Bacteria | 2869 |
| 502 | Ga0495619_0042496 | 3300053085 | Bacteria | 2977 |
| 503 | Ga0500643_000082 | 3300053087 | Bacteria | 101189 |
| 504 | Ga0500651_0005308 | 3300053093 | Bacteria | 7344 |
| 505 | Ga0500650_0003657 | 3300053098 | Bacteria | 5406 |
| 506 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 507 | Ga0500556_0000393 | 3300053104 | Bacteria | 32091 |
| 508 | Ga0500556_0047463 | 3300053104 | Bacteria | 1541 |
| 509 | Ga0500562_000999 | 3300053108 | Bacteria | 6907 |
| 510 | Ga0500593_000123 | 3300053117 | Bacteria | 30512 |
| 511 | Ga0500593_020216 | 3300053117 | Bacteria | 2920 |
| 512 | Ga0500559_0000102 | 3300053136 | Bacteria | 66427 |
| 513 | Ga0500559_0000731 | 3300053136 | Bacteria | 21590 |
| 514 | Ga0500568_0000014 | 3300053139 | Bacteria | 223550 |
| 515 | Ga0500568_0000016 | 3300053139 | Bacteria | 217194 |
| 516 | Ga0500568_0006564 | 3300053139 | Bacteria | 5822 |
| 517 | Ga0500573_0000059 | 3300053140 | Bacteria | 71066 |
| 518 | Ga0500573_0000382 | 3300053140 | Bacteria | 18743 |
| 519 | Ga0500573_0004289 | 3300053140 | Bacteria | 7481 |
| 520 | Ga0500573_0099138 | 3300053140 | Bacteria | 1641 |
| 521 | Ga0500573_0110546 | 3300053140 | Bacteria | 1538 |
| 522 | Ga0500573_0204173 | 3300053140 | Bacteria | 1047 |
| 523 | Ga0500588_0005022 | 3300053146 | Bacteria | 2910 |
| 524 | Ga0500590_044920 | 3300053148 | Bacteria | 2263 |
| 525 | Ga0500616_0000088 | 3300053153 | Bacteria | 191662 |
| 526 | Ga0500616_0000125 | 3300053153 | Bacteria | 135146 |
| 527 | Ga0500616_0000433 | 3300053153 | Bacteria | 55659 |
| 528 | Ga0500620_000051 | 3300053155 | Bacteria | 21187 |
| 529 | Ga0500645_006814 | 3300053730 | Bacteria | 4038 |
| 530 | Ga0587091_000145 | 3300059511 | Bacteria | 4494 |
| 531 | Ga0501082_0335578 | 3300060353 | Bacteria | 1317 |
| 532 | Ga0466962_0011991 | 3300061719 | Bacteria | 4169 |
| 533 | Ga0466962_0133348 | 3300061719 | Bacteria | 1201 |
| 534 | 2555229871 | 2554235227 | Bacteria | 3637389 |
| 535 | 2587862688 | 2585428094 | Bacteria | 3604039 |
| 536 | 2588108217 | 2585428157 | Bacteria | 3018951 |
| 537 | 2643733373 | 2643221542 | Bacteria | 3563959 |
| 538 | 2643753591 | 2643221546 | Bacteria | 2910897 |
| 539 | 2643767593 | 2643221549 | Bacteria | 4042819 |
| 540 | 2643848084 | 2643221566 | Bacteria | 3460379 |
| 541 | 2643875342 | 2643221572 | Bacteria | 3614809 |
| 542 | 2643885116 | 2643221575 | Bacteria | 4022601 |
| 543 | 2643995618 | 2643221597 | Bacteria | 3347721 |
| 544 | 2644097109 | 2643221616 | Bacteria | 4066575 |
| 545 | 2644110898 | 2643221619 | Bacteria | 4158469 |
| 546 | 2644169947 | 2643221630 | Bacteria | 3601215 |
| 547 | 2644183634 | 2643221632 | Bacteria | 3406696 |
| 548 | 2644199395 | 2643221635 | Bacteria | 2632343 |
| 549 | 2644279575 | 2643221649 | Bacteria | 3867359 |
| 550 | 2644382398 | 2643221669 | Bacteria | 3611286 |
| 551 | 2644503595 | 2643221690 | Bacteria | 4654705 |
| 552 | 2644525875 | 2643221694 | Bacteria | 4392972 |
| 553 | 2644665736 | 2643221721 | Bacteria | 4486924 |
| 554 | 2644669934 | 2643221722 | Bacteria | 4247614 |
| 555 | 2644680534 | 2643221724 | Bacteria | 3593515 |
| 556 | 2655032572 | 2654587600 | Bacteria | 3911798 |
| 557 | 2723642144 | 2721755702 | Bacteria | 4373124 |
| 558 | 2730229993 | 2728369380 | Bacteria | 3620317 |
| 559 | 2738697360 | 2738541272 | Bacteria | 6848551 |
| 560 | 2739326746 | 2738543027 | Bacteria | 6409078 |
| 561 | 2739602328 | 2739367653 | Bacteria | 2780952 |
| 562 | 2739606062 | 2739367654 | Bacteria | 6049412 |
| 563 | 2747952395 | 2747842429 | Bacteria | 3914386 |
| 564 | 2753302067 | 2751185788 | Bacteria | 4541048 |
| 565 | 2758227257 | 2757320536 | Bacteria | 3629334 |
| 566 | 2760307111 | 2758568522 | Bacteria | 5953541 |
| 567 | 2760624425 | 2758568621 | Bacteria | 5967089 |
| 568 | 2774381660 | 2773857758 | Bacteria | 3592392 |
| 569 | 2774384708 | 2773857759 | Bacteria | 2963774 |
| 570 | 2774399816 | 2773857763 | Bacteria | 4180068 |
| 571 | 2808631433 | 2808606306 | Bacteria | 3608896 |
| 572 | 2808885410 | 2808606368 | Bacteria | 3174172 |
| 573 | 2808902212 | 2808606372 | Bacteria | 4649509 |
| 574 | 2809029294 | 2808606394 | Bacteria | 6248540 |
| 575 | 2809227161 | 2808606447 | Bacteria | 3572005 |
| 576 | 2812322843 | 2811994872 | Bacteria | 4121241 |
| 577 | 2817509187 | 2816332305 | Bacteria | 2697803 |
| 578 | 2821269722 | 2821268502 | Bacteria | 3750023 |
| 579 | 2833710668 | 2833709550 | Bacteria | 4008291 |
| 580 | 2844842722 | 2844841374 | Bacteria | 3917147 |
| 581 | 2844855367 | 2844852863 | Bacteria | 3849151 |
| 582 | 2852645352 | 2852643534 | Bacteria | 3013378 |
| 583 | 2852648696 | 2852646457 | Bacteria | 3408613 |
| 584 | 2852679489 | 2852677369 | Bacteria | 3768884 |
| 585 | 2857721691 | 2857720070 | Bacteria | 3189373 |
| 586 | 2857724196 | 2857723135 | Bacteria | 4217853 |
| 587 | 2857728384 | 2857727296 | Bacteria | 2745552 |
| 588 | 2857732526 | 2857729791 | Bacteria | 4040535 |
| 589 | 2857735516 | 2857733635 | Bacteria | 3532004 |
| 590 | 2857737471 | 2857737099 | Bacteria | 3104305 |
| 591 | 2862996433 | 2862993130 | Bacteria | 3860849 |
| 592 | 2870623347 | 2870622029 | Bacteria | 3643329 |
| 593 | 2870630087 | 2870628048 | Bacteria | 3696012 |
| 594 | 2884765699 | 2884763398 | Bacteria | 4091164 |
| 595 | 2884995720 | 2884994152 | Bacteria | 4492978 |
| 596 | 2887446390 | 2887443736 | Bacteria | 4426037 |
| 597 | 2893684648 | 2893684298 | Bacteria | 2897960 |
| 598 | 2895661432 | 2895660088 | Bacteria | 3782833 |
| 599 | 2897563516 | 2897561785 | Bacteria | 3256946 |
| 600 | 2904433731 | 2904430863 | Bacteria | 3486923 |
| 601 | 2904503032 | 2904501621 | Bacteria | 3401437 |
| 602 | 2904512684 | 2904509784 | Bacteria | 3520416 |
| 603 | 2906800223 | 2906799679 | Bacteria | 4031749 |
| 604 | 2908675791 | 2908674828 | Bacteria | 3382763 |
| 605 | 2908681318 | 2908678064 | Bacteria | 3482747 |
| 606 | 2909074837 | 2909074476 | Bacteria | 3436050 |
| 607 | 2919041270 | 2919039151 | Bacteria | 3391018 |
| 608 | 2919045772 | 2919042368 | Bacteria | 3905917 |
| 609 | 2919058428 | 2919055335 | Bacteria | 3875751 |
| 610 | 2919071482 | 2919069694 | Bacteria | 3622919 |
| 611 | 2919398318 | 2919395869 | Bacteria | 3704152 |
| 612 | 2919446098 | 2919443155 | Bacteria | 4072969 |
| 613 | 2919524811 | 2919523602 | Bacteria | 3788128 |
| 614 | 2920881813 | 2920879853 | Bacteria | 4216831 |
| 615 | 2928092348 | 2928090899 | Bacteria | 3158267 |
| 616 | 2928106830 | 2928104781 | Bacteria | 3877447 |
| 617 | 2928122868 | 2928121344 | Bacteria | 3972376 |
| 618 | 2928156278 | 2928153084 | Bacteria | 4020257 |
| 619 | 2928502370 | 2928500415 | Bacteria | 3384541 |
| 620 | 2932434871 | 2932431166 | Bacteria | 4215299 |
| 621 | 2935411513 | 2935409751 | Bacteria | 4179611 |
| 622 | 2935894687 | 2935890801 | Bacteria | 4593001 |
| 623 | 2939657781 | 2939657138 | Bacteria | 3740283 |
| 624 | 2939660961 | 2939660829 | Bacteria | 3784848 |
| 625 | 2945968119 | 2945968032 | Bacteria | 4111363 |
| 626 | 2946044613 | 2946041624 | Bacteria | 4191385 |
| 627 | 2946080616 | 2946080515 | Bacteria | 4310960 |
| 628 | 2964326815 | 2964326757 | Bacteria | 3290868 |
| 629 | 2966923314 | 2966921586 | Bacteria | 3092803 |
| 630 | 2966924735 | 2966924647 | Bacteria | 3268643 |
| 631 | 2974297702 | 2974294766 | Bacteria | 3767688 |
| 632 | 2974326063 | 2974324384 | Bacteria | 3750535 |
| 633 | 2977231026 | 2977228692 | Bacteria | 3450105 |
| 634 | 2977239820 | 2977236895 | Bacteria | 3569373 |
| 635 | 2977253710 | 2977251589 | Bacteria | 2952848 |
| 636 | 2977266263 | 2977264416 | Bacteria | 3750737 |
| 637 | 2984545907 | 2984542743 | Bacteria | 3569378 |
| 638 | 2984554207 | 2984551494 | Bacteria | 3877562 |
| 639 | 2984580887 | 2984580707 | Bacteria | 3351387 |
| 640 | 8004184857 | 8004182704 | Bacteria | 3391155 |
| 641 | 8004214071 | 8004212874 | Bacteria | 2861420 |
| 642 | 8016257873 | 8016254467 | Bacteria | 3797036 |
| 643 | 8045830896 | 8045830549 | Bacteria | 4444727 |
| 644 | 8046356304 | 8046352972 | Bacteria | 3613806 |
| 645 | 8056037709 | 8056037122 | Bacteria | 3854319 |
| 646 | 8056583714 | 8056579771 | Bacteria | 5840325 |
| 647 | 8057348970 | 8057345674 | Bacteria | 4160394 |
| 648 | Ga0055532_1007374 | |||
| 649 | JGI24740J21852_10008054 | |||
| 650 | JGI24735J21928_10001246 | |||
| 651 | JGI25162J39368_1005509 | |||
| 652 | JGI25154J39366_1002087 | |||
| 653 | JGI25164J39214_1000402 | |||
| 654 | JGI25165J46597_1000004 | |||
| 655 | Ga0006562J51391_1006933 | |||
| 656 | Ga0006562J51391_1019981 | |||
| 657 | Ga0006562J51391_1033231 | |||
| 658 | Ga0055539_1000008 | |||
| 659 | Ga0055533_1000001 | |||
| 660 | Ga0055525_1001044 | |||
| 661 | Ga0055527_1000001 | |||
| 662 | Ga0055529_1000019 | |||
| 663 | Ga0065714_10158447 | |||
| 664 | Ga0070658_10000090 | |||
| 665 | Ga0070658_10022190 | |||
| 666 | Ga0070658_10070677 | |||
| 667 | Ga0070658_10076165 | |||
| 668 | Ga0070658_10091022 | |||
| 669 | Ga0070666_10382779 | |||
| 670 | Ga0068868_100007759 | |||
| 671 | Ga0070660_100133719 | |||
| 672 | Ga0070668_100486275 | |||
| 673 | Ga0070675_100100920 | |||
| 674 | Ga0070671_100275704 | |||
| 675 | Ga0070659_100000366 | |||
| 676 | Ga0070659_100171619 | |||
| 677 | Ga0070667_100003912 | |||
| 678 | Ga0070710_10044198 | |||
| 679 | Ga0070710_10120455 | |||
| 680 | Ga0070708_100101597 | |||
| 681 | Ga0070685_10005499 | |||
| 682 | Ga0070706_100019402 | |||
| 683 | Ga0070707_100025370 | |||
| 684 | Ga0070707_100057127 | |||
| 685 | Ga0070707_100151205 | |||
| 686 | Ga0070699_100057532 | |||
| 687 | Ga0068853_100155362 | |||
| 688 | Ga0070665_100133320 | |||
| 689 | Ga0068855_100004431 | |||
| 690 | Ga0068857_100001886 | |||
| 691 | Ga0068857_100271612 | |||
| 692 | Ga0068856_100219122 | |||
| 693 | Ga0068856_100507080 | |||
| 694 | Ga0068852_100166555 | |||
| 695 | Ga0068852_100188659 | |||
| 696 | Ga0068861_100152300 | |||
| 697 | Ga0068861_100284773 | |||
| 698 | Ga0068851_10000020 | |||
| 699 | Ga0068863_100040998 | |||
| 700 | Ga0068863_100242043 | |||
| 701 | Ga0068858_100000233 | |||
| 702 | Ga0075365_10017575 | |||
| 703 | Ga0075365_10263022 | |||
| 704 | Ga0075368_10004737 | |||
| 705 | Ga0075364_10048122 | |||
| 706 | Ga0075364_10063109 | |||
| 707 | Ga0075364_10229071 | |||
| 708 | Ga0075364_10323955 | |||
| 709 | Ga0075367_10005074 | |||
| 710 | Ga0075369_10015926 | |||
| 711 | Ga0075370_10009068 | |||
| 712 | Ga0075370_10144562 | |||
| 713 | Ga0105244_10056462 | |||
| 714 | Ga0105240_10002356 | |||
| 715 | Ga0111539_10367523 | |||
| 716 | Ga0105245_10004100 | |||
| 717 | Ga0105245_10025054 | |||
| 718 | Ga0105247_10051465 | |||
| 719 | Ga0105247_10208780 | |||
| 720 | Ga0105243_10074592 | |||
| 721 | Ga0105243_10096103 | |||
| 722 | Ga0105241_10009358 | |||
| 723 | Ga0105248_10000714 | |||
| 724 | Ga0105248_10095008 | |||
| 725 | Ga0105237_10012072 | |||
| 726 | Ga0105237_10209342 | |||
| 727 | Ga0105237_10239404 | |||
| 728 | Ga0105238_10166277 | |||
| 729 | Ga0105238_10531507 | |||
| 730 | Ga0105239_10050863 | |||
| 731 | Ga0105246_10236366 | |||
| 732 | Ga0157371_10130247 | |||
| 733 | Ga0157370_10011227 | |||
| 734 | Ga0157370_10038884 | |||
| 735 | Ga0157369_10021407 | |||
| 736 | Ga0157369_10031237 | |||
| 737 | Ga0157369_10113027 | |||
| 738 | Ga0157369_10305140 | |||
| 739 | Ga0171462_1003 | |||
| 740 | Ga0157374_10393727 | |||
| 741 | Ga0163162_10011086 | |||
| 742 | Ga0163162_10360031 | |||
| 743 | Ga0157372_10031466 | |||
| 744 | Ga0157372_10202614 | |||
| 745 | Ga0157372_10203822 | |||
| 746 | Ga0157372_10309238 | |||
| 747 | Ga0157372_10860525 | |||
| 748 | Ga0163163_10016022 | |||
| 749 | Ga0157380_10245759 | |||
| 750 | Ga0157377_10194864 | |||
| 751 | Ga0157379_10006941 | |||
| 752 | Ga0157376_10273357 | |||
| 753 | Ga0197907_11125962 | |||
| 754 | Ga0197907_11300642 | |||
| 755 | Ga0206356_11508020 | |||
| 756 | Ga0206349_1688277 | |||
| 757 | Ga0206355_1473399 | |||
| 758 | Ga0206352_10442088 | |||
| 759 | Ga0206354_11186439 | |||
| 760 | Ga0206354_11188215 | |||
| 761 | Ga0206353_10742709 | |||
| 762 | Ga0206353_11111984 | |||
| 763 | Ga0206353_11696962 | |||
| 764 | Ga0224712_10003247 | |||
| 765 | Ga0224712_10006014 | |||
| 766 | Ga0224712_10015458 | |||
| 767 | Ga0224712_10045271 | |||
| 768 | Ga0209566_100149 | |||
| 769 | Ga0209674_100001 | |||
| 770 | Ga0209672_100006 | |||
| 771 | Ga0209147_100849 | |||
| 772 | Ga0209563_100001 | |||
| 773 | Ga0209563_103901 | |||
| 774 | Ga0207427_100010 | |||
| 775 | Ga0209437_100216 | |||
| 776 | Ga0209258_101905 | |||
| 777 | Ga0209646_1000071 | |||
| 778 | Ga0209677_100001 | |||
| 779 | Ga0209677_101181 | |||
| 780 | Ga0209148_1000015 | |||
| 781 | Ga0209148_1002856 | |||
| 782 | Ga0209233_1000001 | |||
| 783 | Ga0209455_1000013 | |||
| 784 | Ga0209455_1000811 | |||
| 785 | Ga0207656_10000012 | |||
| 786 | Ga0207655_1017656 | |||
| 787 | Ga0207692_10096257 | |||
| 788 | Ga0207647_10010718 | |||
| 789 | Ga0207643_10209166 | |||
| 790 | Ga0207643_10229181 | |||
| 791 | Ga0207705_10000006 | |||
| 792 | Ga0207705_10018609 | |||
| 793 | Ga0207705_10031366 | |||
| 794 | Ga0207705_10114097 | |||
| 795 | Ga0207684_10046534 | |||
| 796 | Ga0207684_10055330 | |||
| 797 | Ga0207684_10092693 | |||
| 798 | Ga0207654_10000003 | |||
| 799 | Ga0207695_10005466 | |||
| 800 | Ga0207671_10000002 | |||
| 801 | Ga0207671_10047724 | |||
| 802 | Ga0207660_10071151 | |||
| 803 | Ga0207662_10170876 | |||
| 804 | Ga0207657_10018899 | |||
| 805 | Ga0207657_10254821 | |||
| 806 | Ga0207649_10143594 | |||
| 807 | Ga0207652_10138855 | |||
| 808 | Ga0207646_10010011 | |||
| 809 | Ga0207646_10015579 | |||
| 810 | Ga0207646_10125443 | |||
| 811 | Ga0207694_10000433 | |||
| 812 | Ga0207687_10010597 | |||
| 813 | Ga0207687_10041380 | |||
| 814 | Ga0207690_10001456 | |||
| 815 | Ga0207690_10160280 | |||
| 816 | Ga0207709_10051138 | |||
| 817 | Ga0207709_10187475 | |||
| 818 | Ga0207709_10226261 | |||
| 819 | Ga0207691_10177924 | |||
| 820 | Ga0207711_10001344 | |||
| 821 | Ga0207711_10003878 | |||
| 822 | Ga0207667_10003435 | |||
| 823 | Ga0207667_10028110 | |||
| 824 | Ga0207667_10034482 | |||
| 825 | Ga0207667_10141355 | |||
| 826 | Ga0207668_10065840 | |||
| 827 | Ga0207658_10007898 | |||
| 828 | Ga0207677_10041301 | |||
| 829 | Ga0207703_10000044 | |||
| 830 | Ga0207703_10405855 | |||
| 831 | Ga0207639_10429874 | |||
| 832 | Ga0207678_10311108 | |||
| 833 | Ga0207641_10059147 | |||
| 834 | Ga0207641_10164418 | |||
| 835 | Ga0207674_10004435 | |||
| 836 | Ga0207674_10216336 | |||
| 837 | Ga0207674_10313232 | |||
| 838 | Ga0207675_100025236 | |||
| 839 | Ga0207675_100558345 | |||
| 840 | Ga0207698_10004859 | |||
| 841 | Ga0209813_10008542 | |||
| 842 | Ga0268266_10172760 | |||
| 843 | Ga0307515_10065688 | |||
| 844 | Ga0314311_1115621 | |||
| 845 | Ga0316179_1009441 | |||
| 846 | Ga0307513_10216642 | |||
| 847 | Ga0307514_10016061 | |||
| 848 | Ga0307413_10382705 | |||
| 849 | Ga0307410_10045839 | |||
| 850 | Ga0307410_10048629 | |||
| 851 | Ga0307410_10129657 | |||
| 852 | Ga0307406_10000235 | |||
| 853 | Ga0307406_10057164 | |||
| 854 | Ga0307406_10160943 | |||
| 855 | Ga0307406_10489345 | |||
| 856 | Ga0307412_10034093 | |||
| 857 | Ga0307409_100045968 | |||
| 858 | Ga0307409_100060763 | |||
| 859 | Ga0307409_100146398 | |||
| 860 | Ga0307409_100195485 | |||
| 861 | Ga0307409_100216028 | |||
| 862 | Ga0307416_100040035 | |||
| 863 | Ga0307416_100056049 | |||
| 864 | Ga0307416_100672619 | |||
| 865 | Ga0307416_100783866 | |||
| 866 | Ga0307414_10022142 | |||
| 867 | Ga0307414_10208528 | |||
| 868 | Ga0307414_10547430 | |||
| 869 | Ga0307414_10763304 | |||
| 870 | Ga0307411_10081730 | |||
| 871 | Ga0307415_100148252 | |||
| 872 | Ga0395899_0022953 | |||
| 873 | Ga0395899_0070509 | |||
| 874 | Ga0395900_0000774 | |||
| 875 | Ga0395900_0006765 | |||
| 876 | Ga0395900_0197058 | |||
| 877 | Ga0395898_0000015 | |||
| 878 | Ga0395898_0086750 | |||
| 879 | Ga0395898_0184773 | |||
| 880 | Ga0395901_0027940 | |||
| 881 | Ga0395901_0049595 | |||
| 882 | Ga0439465_0097340 | |||
| 883 | Ga0451791_0837996 | |||
| 884 | Ga0451797_0483182 | |||
| 885 | Ga0451802_0750017 | |||
| 886 | Ga0451837_0363453 | |||
| 887 | Ga0451841_0047102 | |||
| 888 | Ga0451853_3801612 | |||
| 889 | Ga0450900_003942 | |||
| 890 | Ga0466972_0013783 | |||
| 891 | Ga0466972_0050673 | |||
| 892 | Ga0466972_0067322 | |||
| 893 | Ga0466972_0089529 | |||
| 894 | Ga0466965_0000049 | |||
| 895 | Ga0466965_0007873 | |||
| 896 | Ga0466965_0013587 | |||
| 897 | Ga0466965_0039830 | |||
| 898 | Ga0466965_0045130 | |||
| 899 | Ga0466965_0195055 | |||
| 900 | Ga0466965_0222987 | |||
| 901 | Ga0466961_0024014 | |||
| 902 | Ga0466961_0027770 | |||
| 903 | Ga0466964_0012477 | |||
| 904 | Ga0466971_0024843 | |||
| 905 | Ga0466968_0001253 | |||
| 906 | Ga0466968_0031845 | |||
| 907 | Ga0466968_0083071 | |||
| 908 | Ga0466970_0000004 | |||
| 909 | Ga0466970_0004242 | |||
| 910 | Ga0466970_0007086 | |||
| 911 | Ga0466970_0007409 | |||
| 912 | Ga0466970_0017425 | |||
| 913 | Ga0466970_0024528 | |||
| 914 | Ga0466970_0027715 | |||
| 915 | Ga0466970_0048621 | |||
| 916 | Ga0466970_0049233 | |||
| 917 | Ga0466970_0067272 | |||
| 918 | Ga0466957_0017532 | |||
| 919 | Ga0466957_0126418 | |||
| 920 | Ga0466960_0006777 | |||
| 921 | Ga0466960_0031038 | |||
| 922 | Ga0466960_0120674 | |||
| 923 | Ga0466960_0190010 | |||
| 924 | Ga0466958_0008749 | |||
| 925 | Ga0495590_0000109 | |||
| 926 | Ga0495638_0162889 | |||
| 927 | Ga0495654_0033080 | |||
| 928 | Ga0495609_0013502 | |||
| 929 | Ga0495625_0060683 | |||
| 930 | Ga0495686_0145880 | |||
| 931 | Ga0496100_0014695 | |||
| 932 | Ga0496100_0032634 | |||
| 933 | Ga0496100_0211424 | |||
| 934 | Ga0496101_0069903 | |||
| 935 | Ga0496102_0070307 | |||
| 936 | Ga0496102_0093765 | |||
| 937 | Ga0496103_0040021 | |||
| 938 | Ga0496103_0055950 | |||
| 939 | Ga0496104_0054964 | |||
| 940 | Ga0496104_0153567 | |||
| 941 | Ga0496105_0026904 | |||
| 942 | Ga0496105_0054164 | |||
| 943 | Ga0496106_0062189 | |||
| 944 | Ga0496107_0014832 | |||
| 945 | Ga0496108_0094399 | |||
| 946 | Ga0496109_0166893 | |||
| 947 | Ga0496109_0179762 | |||
| 948 | Ga0496109_0260847 | |||
| 949 | Ga0496110_0112196 | |||
| 950 | Ga0496110_0128713 | |||
| 951 | Ga0496111_0006270 | |||
| 952 | Ga0496113_0078866 | |||
| 953 | Ga0496113_0161694 | |||
| 954 | Ga0496113_0402284 | |||
| 955 | Ga0496114_0013770 | |||
| 956 | Ga0496114_0020705 | |||
| 957 | Ga0496114_0072502 | |||
| 958 | Ga0496114_0102901 | |||
| 959 | Ga0496115_0022524 | |||
| 960 | Ga0496115_0042030 | |||
| 961 | Ga0496115_0079583 | |||
| 962 | Ga0496115_0200849 | |||
| 963 | Ga0496116_0003139 | |||
| 964 | Ga0496116_0054133 | |||
| 965 | Ga0496117_0000232 | |||
| 966 | Ga0496117_0000737 | |||
| 967 | Ga0496117_0004041 | |||
| 968 | Ga0496117_0005578 | |||
| 969 | Ga0496117_0005793 | |||
| 970 | Ga0496117_0007542 | |||
| 971 | Ga0496117_0029392 | |||
| 972 | Ga0496117_0122767 | |||
| 973 | Ga0496118_0000605 | |||
| 974 | Ga0496118_0002736 | |||
| 975 | Ga0496118_0003338 | |||
| 976 | Ga0496118_0004186 | |||
| 977 | Ga0496118_0052256 | |||
| 978 | Ga0496118_0063147 | |||
| 979 | Ga0496118_0105327 | |||
| 980 | Ga0496118_0296780 | |||
| 981 | Ga0496119_0000341 | |||
| 982 | Ga0496119_0002020 | |||
| 983 | Ga0496119_0002098 | |||
| 984 | Ga0496119_0003222 | |||
| 985 | Ga0496119_0006922 | |||
| 986 | Ga0496119_0009424 | |||
| 987 | Ga0496119_0020558 | |||
| 988 | Ga0496119_0022129 | |||
| 989 | Ga0496119_0053891 | |||
| 990 | Ga0496119_0055305 | |||
| 991 | Ga0496119_0240361 | |||
| 992 | Ga0496119_0250809 | |||
| 993 | Ga0496120_0000456 | |||
| 994 | Ga0496120_0001183 | |||
| 995 | Ga0496120_0031385 | |||
| 996 | Ga0496120_0033960 | |||
| 997 | Ga0496120_0041571 | |||
| 998 | Ga0496120_0057518 | |||
| 999 | Ga0496120_0058400 | |||
| 1000 | Ga0496121_0000040 | |||
| 1001 | Ga0496121_0064938 | |||
| 1002 | Ga0496121_0110041 | |||
| 1003 | Ga0496122_0000030 | |||
| 1004 | Ga0496122_0000120 | |||
| 1005 | Ga0496122_0005995 | |||
| 1006 | Ga0496122_0007503 | |||
| 1007 | Ga0496122_0032104 | |||
| 1008 | Ga0496122_0034773 | |||
| 1009 | Ga0496122_0069611 | |||
| 1010 | Ga0496122_0070228 | |||
| 1011 | Ga0496123_0000024 | |||
| 1012 | Ga0496123_0000051 | |||
| 1013 | Ga0496123_0002368 | |||
| 1014 | Ga0496123_0002701 | |||
| 1015 | Ga0496123_0009280 | |||
| 1016 | Ga0496123_0038834 | |||
| 1017 | Ga0496123_0053387 | |||
| 1018 | Ga0496124_0000363 | |||
| 1019 | Ga0496124_0002437 | |||
| 1020 | Ga0496124_0005016 | |||
| 1021 | Ga0496124_0005922 | |||
| 1022 | Ga0496124_0120420 | |||
| 1023 | Ga0496124_0147008 | |||
| 1024 | Ga0496125_0000097 | |||
| 1025 | Ga0496125_0001405 | |||
| 1026 | Ga0496125_0002686 | |||
| 1027 | Ga0496125_0018821 | |||
| 1028 | Ga0496125_0049251 | |||
| 1029 | Ga0496125_0220907 | |||
| 1030 | Ga0496126_0001194 | |||
| 1031 | Ga0496126_0002527 | |||
| 1032 | Ga0496126_0012898 | |||
| 1033 | Ga0496126_0020398 | |||
| 1034 | Ga0496126_0025034 | |||
| 1035 | Ga0496126_0035675 | |||
| 1036 | Ga0496126_0043490 | |||
| 1037 | Ga0496126_0075463 | |||
| 1038 | Ga0496126_0212335 | |||
| 1039 | Ga0496126_0267941 | |||
| 1040 | Ga0496126_0405216 | |||
| 1041 | Ga0501031_0000454 | |||
| 1042 | Ga0501031_0014045 | |||
| 1043 | Ga0501031_0267153 | |||
| 1044 | Ga0501032_0018756 | |||
| 1045 | Ga0501032_0032274 | |||
| 1046 | Ga0501032_0213185 | |||
| 1047 | Ga0501032_0304133 | |||
| 1048 | Ga0501033_0011741 | |||
| 1049 | Ga0501033_0028007 | |||
| 1050 | Ga0501033_0113416 | |||
| 1051 | Ga0501033_0134828 | |||
| 1052 | Ga0501033_0155564 | |||
| 1053 | Ga0501033_0293698 | |||
| 1054 | Ga0501034_0000227 | |||
| 1055 | Ga0501034_0007058 | |||
| 1056 | Ga0501034_0018450 | |||
| 1057 | Ga0501034_0025911 | |||
| 1058 | Ga0501034_0036437 | |||
| 1059 | Ga0501034_0038369 | |||
| 1060 | Ga0501034_0067417 | |||
| 1061 | Ga0501034_0068832 | |||
| 1062 | Ga0501034_0077168 | |||
| 1063 | Ga0501034_0235466 | |||
| 1064 | Ga0501034_0619172 | |||
| 1065 | Ga0501036_0045835 | |||
| 1066 | Ga0501036_0074956 | |||
| 1067 | Ga0501036_0088330 | |||
| 1068 | Ga0501036_0472520 | |||
| 1069 | Ga0501037_0000536 | |||
| 1070 | Ga0501037_0022052 | |||
| 1071 | Ga0501037_0075830 | |||
| 1072 | Ga0501038_0005424 | |||
| 1073 | Ga0501038_0021735 | |||
| 1074 | Ga0501038_0047429 | |||
| 1075 | Ga0501038_0206603 | |||
| 1076 | Ga0501038_0258698 | |||
| 1077 | Ga0501039_0026758 | |||
| 1078 | Ga0501039_0064719 | |||
| 1079 | Ga0501039_0078754 | |||
| 1080 | Ga0501039_0364033 | |||
| 1081 | Ga0501040_0274130 | |||
| 1082 | Ga0501041_0363077 | |||
| 1083 | Ga0501042_0003632 | |||
| 1084 | Ga0501043_0002454 | |||
| 1085 | Ga0501043_0029285 | |||
| 1086 | Ga0501043_0104286 | |||
| 1087 | Ga0501043_0321223 | |||
| 1088 | Ga0501046_0033391 | |||
| 1089 | Ga0501046_0115627 | |||
| 1090 | Ga0501046_0183692 | |||
| 1091 | Ga0501046_0529680 | |||
| 1092 | Ga0501047_0014035 | |||
| 1093 | Ga0501047_0014129 | |||
| 1094 | Ga0501047_0055159 | |||
| 1095 | Ga0501047_0068104 | |||
| 1096 | Ga0501047_0090472 | |||
| 1097 | Ga0501047_0228375 | |||
| 1098 | Ga0501048_0030390 | |||
| 1099 | Ga0501068_0046523 | |||
| 1100 | Ga0501070_0000167 | |||
| 1101 | Ga0501070_0002705 | |||
| 1102 | Ga0501070_0010791 | |||
| 1103 | Ga0501070_0049972 | |||
| 1104 | Ga0501070_0055423 | |||
| 1105 | Ga0501070_0124206 | |||
| 1106 | Ga0501070_0195505 | |||
| 1107 | Ga0501070_0341028 | |||
| 1108 | Ga0501071_0238642 | |||
| 1109 | Ga0501072_0026621 | |||
| 1110 | Ga0501072_0116858 | |||
| 1111 | Ga0501073_0009587 | |||
| 1112 | Ga0501073_0112185 | |||
| 1113 | Ga0501074_0010738 | |||
| 1114 | Ga0501076_0250295 | |||
| 1115 | Ga0501079_0521382 | |||
| 1116 | Ga0501080_0000084 | |||
| 1117 | Ga0501080_0193318 | |||
| 1118 | Ga0501080_0731200 | |||
| 1119 | Ga0501083_0000027 | |||
| 1120 | Ga0501083_0024223 | |||
| 1121 | Ga0501083_0062547 | |||
| 1122 | Ga0501035_0020396 | |||
| 1123 | Ga0501035_0023927 | |||
| 1124 | Ga0501035_0091587 | |||
| 1125 | Ga0501035_0252001 | |||
| 1126 | Ga0501035_0568902 | |||
| 1127 | Ga0501044_0004023 | |||
| 1128 | Ga0501044_0004313 | |||
| 1129 | Ga0501044_0046051 | |||
| 1130 | Ga0501044_0056141 | |||
| 1131 | Ga0501044_0082435 | |||
| 1132 | Ga0501044_0130389 | |||
| 1133 | Ga0501044_0144912 | |||
| 1134 | Ga0501044_0309587 | |||
| 1135 | Ga0501045_0047611 | |||
| 1136 | nmdc:mga00v17_10485_c1 | |||
| 1137 | nmdc:mga00v17_12805_c1 | |||
| 1138 | nmdc:mga00v17_221202_c1 | |||
| 1139 | nmdc:mga00v17_34683_c1 | |||
| 1140 | nmdc:mga0yw44_11968_c1 | |||
| 1141 | nmdc:mga0yw44_176629_c1 | |||
| 1142 | nmdc:mga0yw44_26395_c1 | |||
| 1143 | nmdc:mga06z11_4650_c1 | |||
| 1144 | nmdc:mga04h51_1398_c1 | |||
| 1145 | nmdc:mga07m45_4789_c1 | |||
| 1146 | nmdc:mga08y16_344289_c1 | |||
| 1147 | Ga0500635_0000028 | |||
| 1148 | Ga0500635_0008122 | |||
| 1149 | Ga0495619_0042496 | |||
| 1150 | Ga0500643_000082 | |||
| 1151 | Ga0500651_0005308 | |||
| 1152 | Ga0500650_0003657 | |||
| 1153 | Ga0500556_0000001 | |||
| 1154 | Ga0500556_0000393 | |||
| 1155 | Ga0500556_0047463 | |||
| 1156 | Ga0500562_000999 | |||
| 1157 | Ga0500593_000123 | |||
| 1158 | Ga0500593_020216 | |||
| 1159 | Ga0500559_0000102 | |||
| 1160 | Ga0500559_0000731 | |||
| 1161 | Ga0500568_0000014 | |||
| 1162 | Ga0500568_0000016 | |||
| 1163 | Ga0500568_0006564 | |||
| 1164 | Ga0500573_0000059 | |||
| 1165 | Ga0500573_0000382 | |||
| 1166 | Ga0500573_0004289 | |||
| 1167 | Ga0500573_0099138 | |||
| 1168 | Ga0500573_0110546 | |||
| 1169 | Ga0500573_0204173 | |||
| 1170 | Ga0500588_0005022 | |||
| 1171 | Ga0500590_044920 | |||
| 1172 | Ga0500616_0000088 | |||
| 1173 | Ga0500616_0000125 | |||
| 1174 | Ga0500616_0000433 | |||
| 1175 | Ga0500620_000051 | |||
| 1176 | Ga0500645_006814 | |||
| 1177 | Ga0587091_000145 | |||
| 1178 | Ga0501082_0335578 | |||
| 1179 | Ga0466962_0011991 | |||
| 1180 | Ga0466962_0133348 | |||
| 1181 | 2555229871 | |||
| 1182 | 2587862688 | |||
| 1183 | 2588108217 | |||
| 1184 | 2643733373 | |||
| 1185 | 2643753591 | |||
| 1186 | 2643767593 | |||
| 1187 | 2643848084 | |||
| 1188 | 2643875342 | |||
| 1189 | 2643885116 | |||
| 1190 | 2643995618 | |||
| 1191 | 2644097109 | |||
| 1192 | 2644110898 | |||
| 1193 | 2644169947 | |||
| 1194 | 2644183634 | |||
| 1195 | 2644199395 | |||
| 1196 | 2644279575 | |||
| 1197 | 2644382398 | |||
| 1198 | 2644503595 | |||
| 1199 | 2644525875 | |||
| 1200 | 2644665736 | |||
| 1201 | 2644669934 | |||
| 1202 | 2644680534 | |||
| 1203 | 2655032572 | |||
| 1204 | 2723642144 | |||
| 1205 | 2730229993 | |||
| 1206 | 2738697360 | |||
| 1207 | 2739326746 | |||
| 1208 | 2739602328 | |||
| 1209 | 2739606062 | |||
| 1210 | 2747952395 | |||
| 1211 | 2753302067 | |||
| 1212 | 2758227257 | |||
| 1213 | 2760307111 | |||
| 1214 | 2760624425 | |||
| 1215 | 2774381660 | |||
| 1216 | 2774384708 | |||
| 1217 | 2774399816 | |||
| 1218 | 2808631433 | |||
| 1219 | 2808885410 | |||
| 1220 | 2808902212 | |||
| 1221 | 2809029294 | |||
| 1222 | 2809227161 | |||
| 1223 | 2812322843 | |||
| 1224 | 2817509187 | |||
| 1225 | 2821269722 | |||
| 1226 | 2833710668 | |||
| 1227 | 2844842722 | |||
| 1228 | 2844855367 | |||
| 1229 | 2852645352 | |||
| 1230 | 2852648696 | |||
| 1231 | 2852679489 | |||
| 1232 | 2857721691 | |||
| 1233 | 2857724196 | |||
| 1234 | 2857728384 | |||
| 1235 | 2857732526 | |||
| 1236 | 2857735516 | |||
| 1237 | 2857737471 | |||
| 1238 | 2862996433 | |||
| 1239 | 2870623347 | |||
| 1240 | 2870630087 | |||
| 1241 | 2884765699 | |||
| 1242 | 2884995720 | |||
| 1243 | 2887446390 | |||
| 1244 | 2893684648 | |||
| 1245 | 2895661432 | |||
| 1246 | 2897563516 | |||
| 1247 | 2904433731 | |||
| 1248 | 2904503032 | |||
| 1249 | 2904512684 | |||
| 1250 | 2906800223 | |||
| 1251 | 2908675791 | |||
| 1252 | 2908681318 | |||
| 1253 | 2909074837 | |||
| 1254 | 2919041270 | |||
| 1255 | 2919045772 | |||
| 1256 | 2919058428 | |||
| 1257 | 2919071482 | |||
| 1258 | 2919398318 | |||
| 1259 | 2919446098 | |||
| 1260 | 2919524811 | |||
| 1261 | 2920881813 | |||
| 1262 | 2928092348 | |||
| 1263 | 2928106830 | |||
| 1264 | 2928122868 | |||
| 1265 | 2928156278 | |||
| 1266 | 2928502370 | |||
| 1267 | 2932434871 | |||
| 1268 | 2935411513 | |||
| 1269 | 2935894687 | |||
| 1270 | 2939657781 | |||
| 1271 | 2939660961 | |||
| 1272 | 2945968119 | |||
| 1273 | 2946044613 | |||
| 1274 | 2946080616 | |||
| 1275 | 2964326815 | |||
| 1276 | 2966923314 | |||
| 1277 | 2966924735 | |||
| 1278 | 2974297702 | |||
| 1279 | 2974326063 | |||
| 1280 | 2977231026 | |||
| 1281 | 2977239820 | |||
| 1282 | 2977253710 | |||
| 1283 | 2977266263 | |||
| 1284 | 2984545907 | |||
| 1285 | 2984554207 | |||
| 1286 | 2984580887 | |||
| 1287 | 8004184857 | |||
| 1288 | 8004214071 | |||
| 1289 | 8016257873 | |||
| 1290 | 8045830896 | |||
| 1291 | 8046356304 | |||
| 1292 | 8056037709 | |||
| 1293 | 8056583714 | |||
| 1294 | 8057348970 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qhm-assembly1.cif.gz_C | cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) | 0.7929 | 53 | 260 |
| 7e1x-assembly1.cif.gz_O | cryo-em structure of hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv in presence of tb47 | 0.7922 | 53 | 260 |
| 6adq-assembly1.cif.gz_C | respiratory complex ciii2civ2sod2 from mycobacterium smegmatis | 0.7915 | 53 | 260 |
| 8hcr-assembly1.cif.gz_O | cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci | 0.7733 | 53 | 260 |
| 8hcr-assembly1.cif.gz_C | cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci | 0.7668 | 53 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP35_148_241_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.9091 | 142 | 225 | 1.10.760.10 |
| af_P9WP35_148_241_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.8093 | 142 | 225 | 1.10.760.10 |
| 3mk7M03 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.799 | 56 | 81 | 1.10.760.10 |
| 1cnoH00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7233 | 50 | 131 | 1.10.760.10 |
| 2xtsD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7223 | 52 | 129 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6I075-F1-model_v4 | Cystathionine beta-lyase | 0.8889 | 53 | 212 |
GO:0009055
GO:0016829 GO:0020037 GO:0046872 |
| AF-A0A6N9Y0U2-F1-model_v4 | deleted | 0.8774 | 124 | 199 |
|
| AF-A0A4R4KTG3-F1-model_v4 | C-type cytochrome | 0.8628 | 60 | 200 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A3D3BQT2-F1-model_v4 | Cystathionine beta-lyase | 0.8597 | 53 | 169 |
GO:0009055
GO:0016829 GO:0020037 GO:0046872 |
| AF-A0A7V9EYU8-F1-model_v4 | Cytochrome c | 0.8514 | 53 | 133 |
GO:0009055
GO:0020037 GO:0046872 |