F472253

General Info

Members Datasets Scaffolds Average Seq Length
647 360 1294 261

Family's Representative Sequence

Representative Sequence 3300003758|Ga0055532_1007374|Ga0055532_10073742
Length 284
Sequence MRPRVPGTQKSRAAAPSRNAKAARKTGRRHPLATVALLAIGLGLTGGAYAAFTTTTASADTPQVQTASKSSVSQGEKLFQANCATCHGMDAQGTVNAPSLIGVGAAAVDFQVGTGRMPMQMQGPQAQEKPVQFSNEEVAALADYVASLAPGPSIPEQKYLDGKGDAANGAQLFRINCAMCHNVAGAGGALTEGKYAPPLTGVSAKHIYEAMVTGPQNMPVFNDLNISPQGKADIITYLKYIQNNPSPGGIELGSLGPVAEGLFLWIFGLGAIVALTVWITAKSN

Samples

Sample ID Description Type Environment
1 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
128 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
225 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
240 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
248 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
249 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
250 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
251 2643221546 Microbacterium sp. Root53 Isolate Unclassified
252 2643221549 Agromyces sp. Root1464 Isolate Unclassified
253 2643221566 Microbacterium sp. Root166 Isolate Unclassified
254 2643221572 Leifsonia sp. Root60 Isolate Unclassified
255 2643221575 Microbacterium sp. Root61 Isolate Unclassified
256 2643221597 Microbacterium sp. Root180 Isolate Unclassified
257 2643221616 Leifsonia sp. Root227 Isolate Unclassified
258 2643221619 Agromyces sp. Root81 Isolate Unclassified
259 2643221630 Microbacterium sp. Root322 Isolate Unclassified
260 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
261 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
262 2643221649 Leifsonia sp. Root4 Isolate Unclassified
263 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
264 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
265 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
266 2643221721 Oerskovia sp. Root918 Isolate Unclassified
267 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
268 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
269 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
270 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
271 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
272 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
273 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
274 2739367653 Kocuria sp. OV113 Isolate Unclassified
275 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
276 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
277 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
278 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
279 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
280 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
281 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
282 2773857759 Microbacterium sp. 1294 Isolate Unclassified
283 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
284 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
285 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
286 2808606372 Agromyces sp. 23-23 Isolate Unclassified
287 2808606394 Promicromonospora sp. C35 Isolate Unclassified
288 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
289 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
290 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
291 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
292 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
293 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
294 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
295 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
296 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
297 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
298 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
299 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
300 2857727296 Kocuria sp. R-72562 Isolate Unclassified
301 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
302 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
303 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
304 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
305 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
306 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
307 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
308 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
309 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
310 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
311 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
312 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
313 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
314 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
315 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
316 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
317 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
318 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
319 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
320 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
321 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
322 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
323 2919069694 Microbacterium sp. 1154 Isolate Unclassified
324 2919395869 Microbacterium resistens 2980 Isolate Unclassified
325 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
326 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
327 2920879853 Kocuria salina CV6 Isolate Unclassified
328 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
329 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
330 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
331 2928153084 Leifsonia sp. 563 Isolate Unclassified
332 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
333 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
334 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
335 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
336 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
337 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
338 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
339 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
340 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
341 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
342 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
343 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
344 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
345 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
346 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
347 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
348 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
349 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
350 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
351 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
352 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
353 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
354 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
355 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
356 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
357 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
358 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
359 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
360 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.44
Metatranscriptomes 2.94
Isolates 17.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.46
Bulb 0
Endosphere 11.75
Nodule 0
Rhizoplane 5.41
Rhizosphere 58.89
Stem 0
Stem Tuber 0.15
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055532_1007374 3300003758 Bacteria 1417
2 JGI24740J21852_10008054 3300001979 Bacteria 4233
3 JGI24735J21928_10001246 3300002067 Bacteria 9041
4 JGI25162J39368_1005509 3300002737 Bacteria 2451
5 JGI25154J39366_1002087 3300002738 Bacteria 5658
6 JGI25164J39214_1000402 3300002772 Bacteria 24889
7 JGI25165J46597_1000004 3300003214 Bacteria 667510
8 Ga0006562J51391_1006933 3300003578 Bacteria 5677
9 Ga0006562J51391_1019981 3300003578 Bacteria 1669
10 Ga0006562J51391_1033231 3300003578 Bacteria 2010
11 Ga0055539_1000008 3300003752 Bacteria 537665
12 Ga0055533_1000001 3300003756 Bacteria 1863437
13 Ga0055525_1001044 3300003759 Bacteria 7187
14 Ga0055527_1000001 3300003760 Bacteria 850044
15 Ga0055529_1000019 3300003763 Bacteria 332786
16 Ga0065714_10158447 3300005288 Bacteria 1062
17 Ga0070658_10000090 3300005327 Bacteria 81871
18 Ga0070658_10022190 3300005327 Bacteria 5093
19 Ga0070658_10070677 3300005327 Bacteria 2858
20 Ga0070658_10076165 3300005327 Bacteria 2752
21 Ga0070658_10091022 3300005327 Bacteria 2514
22 Ga0070666_10382779 3300005335 Bacteria 1010
23 Ga0068868_100007759 3300005338 Bacteria 7659
24 Ga0070660_100133719 3300005339 Bacteria 1986
25 Ga0070668_100486275 3300005347 Bacteria 1067
26 Ga0070675_100100920 3300005354 Bacteria 2430
27 Ga0070671_100275704 3300005355 Bacteria 1430
28 Ga0070659_100000366 3300005366 Bacteria 34220
29 Ga0070659_100171619 3300005366 Bacteria 1777
30 Ga0070667_100003912 3300005367 Bacteria 12649
31 Ga0070710_10044198 3300005437 Bacteria 2471
32 Ga0070710_10120455 3300005437 Bacteria 1588
33 Ga0070708_100101597 3300005445 Bacteria 2634
34 Ga0070685_10005499 3300005466 Bacteria 6420
35 Ga0070706_100019402 3300005467 Bacteria 6271
36 Ga0070707_100025370 3300005468 Bacteria 5622
37 Ga0070707_100057127 3300005468 Bacteria 3744
38 Ga0070707_100151205 3300005468 Bacteria 2260
39 Ga0070699_100057532 3300005518 Bacteria 3368
40 Ga0068853_100155362 3300005539 Bacteria 2061
41 Ga0070665_100133320 3300005548 Bacteria 2486
42 Ga0068855_100004431 3300005563 Bacteria 17153
43 Ga0068857_100001886 3300005577 Bacteria 16895
44 Ga0068857_100271612 3300005577 Bacteria 1558
45 Ga0068856_100219122 3300005614 Bacteria 1918
46 Ga0068856_100507080 3300005614 Bacteria 1227
47 Ga0068852_100166555 3300005616 Bacteria 2062
48 Ga0068852_100188659 3300005616 Bacteria 1943
49 Ga0068861_100152300 3300005719 Bacteria 1899
50 Ga0068861_100284773 3300005719 Bacteria 1425
51 Ga0068851_10000020 3300005834 Bacteria 133551
52 Ga0068863_100040998 3300005841 Bacteria 4402
53 Ga0068863_100242043 3300005841 Bacteria 1741
54 Ga0068858_100000233 3300005842 Bacteria 60097
55 Ga0075365_10017575 3300006038 Bacteria 4379
56 Ga0075365_10263022 3300006038 Bacteria 1213
57 Ga0075368_10004737 3300006042 Bacteria 4629
58 Ga0075364_10048122 3300006051 Bacteria 2778
59 Ga0075364_10063109 3300006051 Bacteria 2432
60 Ga0075364_10229071 3300006051 Bacteria 1262
61 Ga0075364_10323955 3300006051 Bacteria 1049
62 Ga0075367_10005074 3300006178 Bacteria 6500
63 Ga0075369_10015926 3300006186 Bacteria 3025
64 Ga0075370_10009068 3300006353 Bacteria 5145
65 Ga0075370_10144562 3300006353 Bacteria 1391
66 Ga0105244_10056462 3300009036 Bacteria 1987
67 Ga0105240_10002356 3300009093 Bacteria 30453
68 Ga0111539_10367523 3300009094 Bacteria 1674
69 Ga0105245_10004100 3300009098 Bacteria 12935
70 Ga0105245_10025054 3300009098 Bacteria 5245
71 Ga0105247_10051465 3300009101 Bacteria 2536
72 Ga0105247_10208780 3300009101 Bacteria 1316
73 Ga0105243_10074592 3300009148 Bacteria 2752
74 Ga0105243_10096103 3300009148 Bacteria 2450
75 Ga0105241_10009358 3300009174 Bacteria 7201
76 Ga0105248_10000714 3300009177 Bacteria 37567
77 Ga0105248_10095008 3300009177 Bacteria 3356
78 Ga0105237_10012072 3300009545 Bacteria 9124
79 Ga0105237_10209342 3300009545 Bacteria 1950
80 Ga0105237_10239404 3300009545 Bacteria 1816
81 Ga0105238_10166277 3300009551 Bacteria 2182
82 Ga0105238_10531507 3300009551 Bacteria 1179
83 Ga0105239_10050863 3300010375 Bacteria 4544
84 Ga0105246_10236366 3300011119 Bacteria 1442
85 Ga0157371_10130247 3300013102 Bacteria 1790
86 Ga0157370_10011227 3300013104 Bacteria 9392
87 Ga0157370_10038884 3300013104 Bacteria 4601
88 Ga0157369_10021407 3300013105 Bacteria 7233
89 Ga0157369_10031237 3300013105 Bacteria 5867
90 Ga0157369_10113027 3300013105 Bacteria 2885
91 Ga0157369_10305140 3300013105 Bacteria 1656
92 Ga0171462_1003 3300013250 Bacteria 853796
93 Ga0157374_10393727 3300013296 Bacteria 1381
94 Ga0163162_10011086 3300013306 Bacteria 8782
95 Ga0163162_10360031 3300013306 Bacteria 1588
96 Ga0157372_10031466 3300013307 Bacteria 5809
97 Ga0157372_10202614 3300013307 Bacteria 2299
98 Ga0157372_10203822 3300013307 Bacteria 2292
99 Ga0157372_10309238 3300013307 Bacteria 1839
100 Ga0157372_10860525 3300013307 Bacteria 1052
101 Ga0163163_10016022 3300014325 Bacteria 6950
102 Ga0157380_10245759 3300014326 Bacteria 1616
103 Ga0157377_10194864 3300014745 Bacteria 1283
104 Ga0157379_10006941 3300014968 Bacteria 9795
105 Ga0157376_10273357 3300014969 Bacteria 1588
106 Ga0197907_11125962 3300020069 Bacteria 2812
107 Ga0197907_11300642 3300020069 Bacteria 1712
108 Ga0206356_11508020 3300020070 Bacteria 4288
109 Ga0206349_1688277 3300020075 Bacteria 3332
110 Ga0206355_1473399 3300020076 Bacteria 1215
111 Ga0206352_10442088 3300020078 Bacteria 1762
112 Ga0206354_11186439 3300020081 Bacteria 1755
113 Ga0206354_11188215 3300020081 Bacteria 3375
114 Ga0206353_10742709 3300020082 Bacteria 1843
115 Ga0206353_11111984 3300020082 Bacteria 3046
116 Ga0206353_11696962 3300020082 Bacteria 8101
117 Ga0224712_10003247 3300022467 Bacteria 4186
118 Ga0224712_10006014 3300022467 Bacteria 3429
119 Ga0224712_10015458 3300022467 Bacteria 2484
120 Ga0224712_10045271 3300022467 Bacteria 1683
121 Ga0209566_100149 3300025225 Bacteria 81626
122 Ga0209674_100001 3300025226 Bacteria 4013750
123 Ga0209672_100006 3300025228 Bacteria 1004497
124 Ga0209147_100849 3300025229 Bacteria 14329
125 Ga0209563_100001 3300025230 Bacteria 4013775
126 Ga0209563_103901 3300025230 Bacteria 2962
127 Ga0207427_100010 3300025231 Bacteria 648610
128 Ga0209437_100216 3300025233 Bacteria 106353
129 Ga0209258_101905 3300025242 Bacteria 6178
130 Ga0209646_1000071 3300025246 Bacteria 228702
131 Ga0209677_100001 3300025253 Bacteria 4013787
132 Ga0209677_101181 3300025253 Bacteria 11978
133 Ga0209148_1000015 3300025254 Bacteria 850103
134 Ga0209148_1002856 3300025254 Bacteria 5308
135 Ga0209233_1000001 3300025261 Bacteria 2992747
136 Ga0209455_1000013 3300025272 Bacteria 850103
137 Ga0209455_1000811 3300025272 Bacteria 17057
138 Ga0207656_10000012 3300025321 Bacteria 190545
139 Ga0207655_1017656 3300025728 Bacteria 3837
140 Ga0207692_10096257 3300025898 Bacteria 1616
141 Ga0207647_10010718 3300025904 Bacteria 6457
142 Ga0207643_10209166 3300025908 Bacteria 1190
143 Ga0207643_10229181 3300025908 Bacteria 1139
144 Ga0207705_10000006 3300025909 Bacteria 657147
145 Ga0207705_10018609 3300025909 Bacteria 4966
146 Ga0207705_10031366 3300025909 Bacteria 3793
147 Ga0207705_10114097 3300025909 Bacteria 1998
148 Ga0207684_10046534 3300025910 Bacteria 3681
149 Ga0207684_10055330 3300025910 Bacteria 3366
150 Ga0207684_10092693 3300025910 Bacteria 2575
151 Ga0207654_10000003 3300025911 Bacteria 1030378
152 Ga0207695_10005466 3300025913 Bacteria 16830
153 Ga0207671_10000002 3300025914 Bacteria 1144816
154 Ga0207671_10047724 3300025914 Bacteria 3169
155 Ga0207660_10071151 3300025917 Bacteria 2530
156 Ga0207662_10170876 3300025918 Bacteria 1394
157 Ga0207657_10018899 3300025919 Bacteria 6561
158 Ga0207657_10254821 3300025919 Bacteria 1398
159 Ga0207649_10143594 3300025920 Bacteria 1636
160 Ga0207652_10138855 3300025921 Bacteria 2172
161 Ga0207646_10010011 3300025922 Bacteria 9309
162 Ga0207646_10015579 3300025922 Bacteria 7176
163 Ga0207646_10125443 3300025922 Bacteria 2308
164 Ga0207694_10000433 3300025924 Bacteria 38856
165 Ga0207687_10010597 3300025927 Bacteria 6026
166 Ga0207687_10041380 3300025927 Bacteria 3164
167 Ga0207690_10001456 3300025932 Bacteria 14803
168 Ga0207690_10160280 3300025932 Bacteria 1676
169 Ga0207709_10051138 3300025935 Bacteria 2531
170 Ga0207709_10187475 3300025935 Bacteria 1466
171 Ga0207709_10226261 3300025935 Bacteria 1352
172 Ga0207691_10177924 3300025940 Bacteria 1860
173 Ga0207711_10001344 3300025941 Bacteria 23198
174 Ga0207711_10003878 3300025941 Bacteria 12868
175 Ga0207667_10003435 3300025949 Bacteria 19553
176 Ga0207667_10028110 3300025949 Bacteria 6110
177 Ga0207667_10034482 3300025949 Bacteria 5434
178 Ga0207667_10141355 3300025949 Bacteria 2478
179 Ga0207668_10065840 3300025972 Bacteria 2566
180 Ga0207658_10007898 3300025986 Bacteria 7247
181 Ga0207677_10041301 3300026023 Bacteria 3049
182 Ga0207703_10000044 3300026035 Bacteria 158471
183 Ga0207703_10405855 3300026035 Bacteria 1265
184 Ga0207639_10429874 3300026041 Bacteria 1195
185 Ga0207678_10311108 3300026067 Bacteria 1354
186 Ga0207641_10059147 3300026088 Bacteria 3263
187 Ga0207641_10164418 3300026088 Bacteria 2020
188 Ga0207674_10004435 3300026116 Bacteria 16874
189 Ga0207674_10216336 3300026116 Bacteria 1864
190 Ga0207674_10313232 3300026116 Bacteria 1519
191 Ga0207675_100025236 3300026118 Bacteria 5532
192 Ga0207675_100558345 3300026118 Bacteria 1145
193 Ga0207698_10004859 3300026142 Bacteria 8236
194 Ga0209813_10008542 3300027866 Bacteria 2592
195 Ga0268266_10172760 3300028379 Bacteria 1962
196 Ga0307515_10065688 3300028794 Bacteria 5043
197 Ga0314311_1115621 3300030733 Bacteria 1197
198 Ga0316179_1009441 3300030734 Bacteria 1942
199 Ga0307513_10216642 3300031456 Bacteria 1740
200 Ga0307514_10016061 3300031649 Bacteria 6169
201 Ga0307413_10382705 3300031824 Bacteria 1097
202 Ga0307410_10045839 3300031852 Bacteria 2914
203 Ga0307410_10048629 3300031852 Bacteria 2842
204 Ga0307410_10129657 3300031852 Bacteria 1851
205 Ga0307406_10000235 3300031901 Bacteria 33683
206 Ga0307406_10057164 3300031901 Bacteria 2501
207 Ga0307406_10160943 3300031901 Bacteria 1613
208 Ga0307406_10489345 3300031901 Bacteria 995
209 Ga0307412_10034093 3300031911 Bacteria 3242
210 Ga0307409_100045968 3300031995 Bacteria 3301
211 Ga0307409_100060763 3300031995 Bacteria 2949
212 Ga0307409_100146398 3300031995 Bacteria 2043
213 Ga0307409_100195485 3300031995 Bacteria 1805
214 Ga0307409_100216028 3300031995 Bacteria 1727
215 Ga0307416_100040035 3300032002 Bacteria 3636
216 Ga0307416_100056049 3300032002 Bacteria 3178
217 Ga0307416_100672619 3300032002 Bacteria 1122
218 Ga0307416_100783866 3300032002 Bacteria 1048
219 Ga0307414_10022142 3300032004 Bacteria 4003
220 Ga0307414_10208528 3300032004 Bacteria 1595
221 Ga0307414_10547430 3300032004 Bacteria 1031
222 Ga0307414_10763304 3300032004 Bacteria 880
223 Ga0307411_10081730 3300032005 Bacteria 2226
224 Ga0307415_100148252 3300032126 Bacteria 1802
225 Ga0395899_0022953 3300037312 Bacteria 4727
226 Ga0395899_0070509 3300037312 Bacteria 2558
227 Ga0395900_0000774 3300037418 Bacteria 42584
228 Ga0395900_0006765 3300037418 Bacteria 11898
229 Ga0395900_0197058 3300037418 Bacteria 2040
230 Ga0395898_0000015 3300037466 Bacteria 439819
231 Ga0395898_0086750 3300037466 Bacteria 3016
232 Ga0395898_0184773 3300037466 Bacteria 1992
233 Ga0395901_0027940 3300038443 Bacteria 5801
234 Ga0395901_0049595 3300038443 Bacteria 4362
235 Ga0439465_0097340 3300041413 Bacteria 1013
236 Ga0451791_0837996 3300041451 Bacteria 2179
237 Ga0451797_0483182 3300041453 Bacteria 1130
238 Ga0451802_0750017 3300041460 Bacteria 925
239 Ga0451837_0363453 3300041494 Bacteria 967
240 Ga0451841_0047102 3300041498 Bacteria 1465
241 Ga0451853_3801612 3300041512 Bacteria 1128
242 Ga0450900_003942 3300042136 Bacteria 1679
243 Ga0466972_0013783 3300044658 Bacteria 4057
244 Ga0466972_0050673 3300044658 Bacteria 2003
245 Ga0466972_0067322 3300044658 Bacteria 1711
246 Ga0466972_0089529 3300044658 Bacteria 1460
247 Ga0466965_0000049 3300044683 Bacteria 41316
248 Ga0466965_0007873 3300044683 Bacteria 4913
249 Ga0466965_0013587 3300044683 Bacteria 3844
250 Ga0466965_0039830 3300044683 Bacteria 2310
251 Ga0466965_0045130 3300044683 Bacteria 2179
252 Ga0466965_0195055 3300044683 Bacteria 1072
253 Ga0466965_0222987 3300044683 Bacteria 1005
254 Ga0466961_0024014 3300044693 Bacteria 3922
255 Ga0466961_0027770 3300044693 Bacteria 3640
256 Ga0466964_0012477 3300044706 Bacteria 3215
257 Ga0466971_0024843 3300044719 Bacteria 2674
258 Ga0466968_0001253 3300044735 Bacteria 9028
259 Ga0466968_0031845 3300044735 Bacteria 2190
260 Ga0466968_0083071 3300044735 Bacteria 1410
261 Ga0466970_0000004 3300044765 Bacteria 108620
262 Ga0466970_0004242 3300044765 Bacteria 7054
263 Ga0466970_0007086 3300044765 Bacteria 5608
264 Ga0466970_0007409 3300044765 Bacteria 5497
265 Ga0466970_0017425 3300044765 Bacteria 3711
266 Ga0466970_0024528 3300044765 Bacteria 3154
267 Ga0466970_0027715 3300044765 Bacteria 2973
268 Ga0466970_0048621 3300044765 Bacteria 2261
269 Ga0466970_0049233 3300044765 Bacteria 2247
270 Ga0466970_0067272 3300044765 Bacteria 1924
271 Ga0466957_0017532 3300044842 Bacteria 4196
272 Ga0466957_0126418 3300044842 Bacteria 1634
273 Ga0466960_0006777 3300044901 Bacteria 4613
274 Ga0466960_0031038 3300044901 Bacteria 2463
275 Ga0466960_0120674 3300044901 Bacteria 1373
276 Ga0466960_0190010 3300044901 Bacteria 1117
277 Ga0466958_0008749 3300045836 Bacteria 5620
278 Ga0495590_0000109 3300046457 Bacteria 50065
279 Ga0495638_0162889 3300046460 Bacteria 1285
280 Ga0495654_0033080 3300046530 Bacteria 2618
281 Ga0495609_0013502 3300046538 Bacteria 3855
282 Ga0495625_0060683 3300046660 Bacteria 2679
283 Ga0495686_0145880 3300047472 Bacteria 1393
284 Ga0496100_0014695 3300048903 Bacteria 4553
285 Ga0496100_0032634 3300048903 Bacteria 3249
286 Ga0496100_0211424 3300048903 Bacteria 1419
287 Ga0496101_0069903 3300048904 Bacteria 2569
288 Ga0496102_0070307 3300048905 Bacteria 3214
289 Ga0496102_0093765 3300048905 Bacteria 2781
290 Ga0496103_0040021 3300048906 Bacteria 2881
291 Ga0496103_0055950 3300048906 Bacteria 2448
292 Ga0496104_0054964 3300048907 Bacteria 3763
293 Ga0496104_0153567 3300048907 Bacteria 2209
294 Ga0496105_0026904 3300048908 Bacteria 4694
295 Ga0496105_0054164 3300048908 Bacteria 3312
296 Ga0496106_0062189 3300048909 Bacteria 2834
297 Ga0496107_0014832 3300048910 Bacteria 5455
298 Ga0496108_0094399 3300048911 Bacteria 2546
299 Ga0496109_0166893 3300048912 Bacteria 2064
300 Ga0496109_0179762 3300048912 Bacteria 1986
301 Ga0496109_0260847 3300048912 Bacteria 1632
302 Ga0496110_0112196 3300048913 Bacteria 2451
303 Ga0496110_0128713 3300048913 Bacteria 2285
304 Ga0496111_0006270 3300048914 Bacteria 7711
305 Ga0496113_0078866 3300048916 Bacteria 2520
306 Ga0496113_0161694 3300048916 Bacteria 1770
307 Ga0496113_0402284 3300048916 Bacteria 1099
308 Ga0496114_0013770 3300048917 Bacteria 6481
309 Ga0496114_0020705 3300048917 Bacteria 5339
310 Ga0496114_0072502 3300048917 Bacteria 2897
311 Ga0496114_0102901 3300048917 Bacteria 2440
312 Ga0496115_0022524 3300048918 Bacteria 4882
313 Ga0496115_0042030 3300048918 Bacteria 3640
314 Ga0496115_0079583 3300048918 Bacteria 2667
315 Ga0496115_0200849 3300048918 Bacteria 1647
316 Ga0496116_0003139 3300048919 Bacteria 16570
317 Ga0496116_0054133 3300048919 Bacteria 2646
318 Ga0496117_0000232 3300048920 Bacteria 105479
319 Ga0496117_0000737 3300048920 Bacteria 51396
320 Ga0496117_0004041 3300048920 Bacteria 16494
321 Ga0496117_0005578 3300048920 Bacteria 13171
322 Ga0496117_0005793 3300048920 Bacteria 12820
323 Ga0496117_0007542 3300048920 Bacteria 10601
324 Ga0496117_0029392 3300048920 Bacteria 4238
325 Ga0496117_0122767 3300048920 Bacteria 1592
326 Ga0496118_0000605 3300048921 Bacteria 59079
327 Ga0496118_0002736 3300048921 Bacteria 23202
328 Ga0496118_0003338 3300048921 Bacteria 20307
329 Ga0496118_0004186 3300048921 Bacteria 17357
330 Ga0496118_0052256 3300048921 Bacteria 3119
331 Ga0496118_0063147 3300048921 Bacteria 2727
332 Ga0496118_0105327 3300048921 Bacteria 1891
333 Ga0496118_0296780 3300048921 Bacteria 890
334 Ga0496119_0000341 3300048922 Bacteria 65282
335 Ga0496119_0002020 3300048922 Bacteria 22984
336 Ga0496119_0002098 3300048922 Bacteria 22484
337 Ga0496119_0003222 3300048922 Bacteria 17077
338 Ga0496119_0006922 3300048922 Bacteria 10343
339 Ga0496119_0009424 3300048922 Bacteria 8383
340 Ga0496119_0020558 3300048922 Bacteria 4812
341 Ga0496119_0022129 3300048922 Bacteria 4565
342 Ga0496119_0053891 3300048922 Bacteria 2453
343 Ga0496119_0055305 3300048922 Bacteria 2411
344 Ga0496119_0240361 3300048922 Bacteria 917
345 Ga0496119_0250809 3300048922 Bacteria 892
346 Ga0496120_0000456 3300048923 Bacteria 64535
347 Ga0496120_0001183 3300048923 Bacteria 33176
348 Ga0496120_0031385 3300048923 Bacteria 3218
349 Ga0496120_0033960 3300048923 Bacteria 3060
350 Ga0496120_0041571 3300048923 Bacteria 2691
351 Ga0496120_0057518 3300048923 Bacteria 2188
352 Ga0496120_0058400 3300048923 Bacteria 2167
353 Ga0496121_0000040 3300048924 Bacteria 348494
354 Ga0496121_0064938 3300048924 Bacteria 2973
355 Ga0496121_0110041 3300048924 Bacteria 2103
356 Ga0496122_0000030 3300048925 Bacteria 331586
357 Ga0496122_0000120 3300048925 Bacteria 182539
358 Ga0496122_0005995 3300048925 Bacteria 14196
359 Ga0496122_0007503 3300048925 Bacteria 12099
360 Ga0496122_0032104 3300048925 Bacteria 4349
361 Ga0496122_0034773 3300048925 Bacteria 4115
362 Ga0496122_0069611 3300048925 Bacteria 2519
363 Ga0496122_0070228 3300048925 Bacteria 2504
364 Ga0496123_0000024 3300048926 Bacteria 331587
365 Ga0496123_0000051 3300048926 Bacteria 237095
366 Ga0496123_0002368 3300048926 Bacteria 23643
367 Ga0496123_0002701 3300048926 Bacteria 21334
368 Ga0496123_0009280 3300048926 Bacteria 8880
369 Ga0496123_0038834 3300048926 Bacteria 3340
370 Ga0496123_0053387 3300048926 Bacteria 2671
371 Ga0496124_0000363 3300048927 Bacteria 82857
372 Ga0496124_0002437 3300048927 Bacteria 24376
373 Ga0496124_0005016 3300048927 Bacteria 15139
374 Ga0496124_0005922 3300048927 Bacteria 13525
375 Ga0496124_0120420 3300048927 Bacteria 2098
376 Ga0496124_0147008 3300048927 Bacteria 1853
377 Ga0496125_0000097 3300048928 Bacteria 204607
378 Ga0496125_0001405 3300048928 Bacteria 35141
379 Ga0496125_0002686 3300048928 Bacteria 22659
380 Ga0496125_0018821 3300048928 Bacteria 6540
381 Ga0496125_0049251 3300048928 Bacteria 3503
382 Ga0496125_0220907 3300048928 Bacteria 1221
383 Ga0496126_0001194 3300048929 Bacteria 42334
384 Ga0496126_0002527 3300048929 Bacteria 24495
385 Ga0496126_0012898 3300048929 Bacteria 8534
386 Ga0496126_0020398 3300048929 Bacteria 6499
387 Ga0496126_0025034 3300048929 Bacteria 5751
388 Ga0496126_0035675 3300048929 Bacteria 4658
389 Ga0496126_0043490 3300048929 Bacteria 4143
390 Ga0496126_0075463 3300048929 Bacteria 2992
391 Ga0496126_0212335 3300048929 Bacteria 1629
392 Ga0496126_0267941 3300048929 Bacteria 1418
393 Ga0496126_0405216 3300048929 Bacteria 1105
394 Ga0501031_0000454 3300049568 Bacteria 23726
395 Ga0501031_0014045 3300049568 Bacteria 5212
396 Ga0501031_0267153 3300049568 Bacteria 1111
397 Ga0501032_0018756 3300049569 Bacteria 4842
398 Ga0501032_0032274 3300049569 Bacteria 3588
399 Ga0501032_0213185 3300049569 Bacteria 1258
400 Ga0501032_0304133 3300049569 Bacteria 1031
401 Ga0501033_0011741 3300049570 Bacteria 6698
402 Ga0501033_0028007 3300049570 Bacteria 4234
403 Ga0501033_0113416 3300049570 Bacteria 1971
404 Ga0501033_0134828 3300049570 Bacteria 1787
405 Ga0501033_0155564 3300049570 Bacteria 1647
406 Ga0501033_0293698 3300049570 Bacteria 1145
407 Ga0501034_0000227 3300049571 Bacteria 106244
408 Ga0501034_0007058 3300049571 Bacteria 11983
409 Ga0501034_0018450 3300049571 Bacteria 7155
410 Ga0501034_0025911 3300049571 Bacteria 5973
411 Ga0501034_0036437 3300049571 Bacteria 4983
412 Ga0501034_0038369 3300049571 Bacteria 4850
413 Ga0501034_0067417 3300049571 Bacteria 3591
414 Ga0501034_0068832 3300049571 Bacteria 3550
415 Ga0501034_0077168 3300049571 Bacteria 3337
416 Ga0501034_0235466 3300049571 Bacteria 1779
417 Ga0501034_0619172 3300049571 Bacteria 986
418 Ga0501036_0045835 3300049572 Bacteria 3703
419 Ga0501036_0074956 3300049572 Bacteria 2861
420 Ga0501036_0088330 3300049572 Bacteria 2619
421 Ga0501036_0472520 3300049572 Bacteria 1044
422 Ga0501037_0000536 3300049573 Bacteria 30298
423 Ga0501037_0022052 3300049573 Bacteria 4714
424 Ga0501037_0075830 3300049573 Bacteria 2442
425 Ga0501038_0005424 3300049574 Bacteria 11852
426 Ga0501038_0021735 3300049574 Bacteria 5756
427 Ga0501038_0047429 3300049574 Bacteria 3721
428 Ga0501038_0206603 3300049574 Bacteria 1573
429 Ga0501038_0258698 3300049574 Bacteria 1376
430 Ga0501039_0026758 3300049575 Bacteria 4432
431 Ga0501039_0064719 3300049575 Bacteria 2835
432 Ga0501039_0078754 3300049575 Bacteria 2564
433 Ga0501039_0364033 3300049575 Bacteria 1136
434 Ga0501040_0274130 3300049576 Bacteria 1205
435 Ga0501041_0363077 3300049577 Bacteria 916
436 Ga0501042_0003632 3300049578 Bacteria 9730
437 Ga0501043_0002454 3300049579 Bacteria 15682
438 Ga0501043_0029285 3300049579 Bacteria 4325
439 Ga0501043_0104286 3300049579 Bacteria 2228
440 Ga0501043_0321223 3300049579 Bacteria 1180
441 Ga0501046_0033391 3300049580 Bacteria 4157
442 Ga0501046_0115627 3300049580 Bacteria 2045
443 Ga0501046_0183692 3300049580 Bacteria 1562
444 Ga0501046_0529680 3300049580 Bacteria 841
445 Ga0501047_0014035 3300049581 Bacteria 7612
446 Ga0501047_0014129 3300049581 Bacteria 7587
447 Ga0501047_0055159 3300049581 Bacteria 3843
448 Ga0501047_0068104 3300049581 Bacteria 3429
449 Ga0501047_0090472 3300049581 Bacteria 2937
450 Ga0501047_0228375 3300049581 Bacteria 1715
451 Ga0501048_0030390 3300049582 Bacteria 3908
452 Ga0501068_0046523 3300049584 Bacteria 2617
453 Ga0501070_0000167 3300049586 Bacteria 60680
454 Ga0501070_0002705 3300049586 Bacteria 15477
455 Ga0501070_0010791 3300049586 Bacteria 7718
456 Ga0501070_0049972 3300049586 Bacteria 3472
457 Ga0501070_0055423 3300049586 Bacteria 3285
458 Ga0501070_0124206 3300049586 Bacteria 2133
459 Ga0501070_0195505 3300049586 Bacteria 1661
460 Ga0501070_0341028 3300049586 Bacteria 1217
461 Ga0501071_0238642 3300049587 Bacteria 1370
462 Ga0501072_0026621 3300049588 Bacteria 4509
463 Ga0501072_0116858 3300049588 Bacteria 2125
464 Ga0501073_0009587 3300049589 Bacteria 7141
465 Ga0501073_0112185 3300049589 Bacteria 1891
466 Ga0501074_0010738 3300049590 Bacteria 6654
467 Ga0501076_0250295 3300049592 Bacteria 1450
468 Ga0501079_0521382 3300049741 Bacteria 934
469 Ga0501080_0000084 3300049742 Bacteria 62784
470 Ga0501080_0193318 3300049742 Bacteria 1869
471 Ga0501080_0731200 3300049742 Bacteria 871
472 Ga0501083_0000027 3300049744 Bacteria 117605
473 Ga0501083_0024223 3300049744 Bacteria 4207
474 Ga0501083_0062547 3300049744 Bacteria 2483
475 Ga0501035_0020396 3300049822 Bacteria 6085
476 Ga0501035_0023927 3300049822 Bacteria 5605
477 Ga0501035_0091587 3300049822 Bacteria 2675
478 Ga0501035_0252001 3300049822 Bacteria 1499
479 Ga0501035_0568902 3300049822 Bacteria 926
480 Ga0501044_0004023 3300049823 Bacteria 16480
481 Ga0501044_0004313 3300049823 Bacteria 15948
482 Ga0501044_0046051 3300049823 Bacteria 4517
483 Ga0501044_0056141 3300049823 Bacteria 4043
484 Ga0501044_0082435 3300049823 Bacteria 3254
485 Ga0501044_0130389 3300049823 Bacteria 2508
486 Ga0501044_0144912 3300049823 Bacteria 2361
487 Ga0501044_0309587 3300049823 Bacteria 1506
488 Ga0501045_0047611 3300049824 Bacteria 3123
489 nmdc:mga00v17_10485_c1 3300050491 Bacteria 5061
490 nmdc:mga00v17_12805_c1 3300050491 Bacteria 4636
491 nmdc:mga00v17_221202_c1 3300050491 Bacteria 1226
492 nmdc:mga00v17_34683_c1 3300050491 Bacteria 2999
493 nmdc:mga0yw44_11968_c1 3300050492 Bacteria 4504
494 nmdc:mga0yw44_176629_c1 3300050492 Bacteria 1404
495 nmdc:mga0yw44_26395_c1 3300050492 Bacteria 3317
496 nmdc:mga06z11_4650_c1 3300050494 Bacteria 5414
497 nmdc:mga04h51_1398_c1 3300050495 Bacteria 5576
498 nmdc:mga07m45_4789_c1 3300050496 Bacteria 6658
499 nmdc:mga08y16_344289_c1 3300050511 Bacteria 1532
500 Ga0500635_0000028 3300053080 Bacteria 104398
501 Ga0500635_0008122 3300053080 Bacteria 2869
502 Ga0495619_0042496 3300053085 Bacteria 2977
503 Ga0500643_000082 3300053087 Bacteria 101189
504 Ga0500651_0005308 3300053093 Bacteria 7344
505 Ga0500650_0003657 3300053098 Bacteria 5406
506 Ga0500556_0000001 3300053104 Bacteria 1135060
507 Ga0500556_0000393 3300053104 Bacteria 32091
508 Ga0500556_0047463 3300053104 Bacteria 1541
509 Ga0500562_000999 3300053108 Bacteria 6907
510 Ga0500593_000123 3300053117 Bacteria 30512
511 Ga0500593_020216 3300053117 Bacteria 2920
512 Ga0500559_0000102 3300053136 Bacteria 66427
513 Ga0500559_0000731 3300053136 Bacteria 21590
514 Ga0500568_0000014 3300053139 Bacteria 223550
515 Ga0500568_0000016 3300053139 Bacteria 217194
516 Ga0500568_0006564 3300053139 Bacteria 5822
517 Ga0500573_0000059 3300053140 Bacteria 71066
518 Ga0500573_0000382 3300053140 Bacteria 18743
519 Ga0500573_0004289 3300053140 Bacteria 7481
520 Ga0500573_0099138 3300053140 Bacteria 1641
521 Ga0500573_0110546 3300053140 Bacteria 1538
522 Ga0500573_0204173 3300053140 Bacteria 1047
523 Ga0500588_0005022 3300053146 Bacteria 2910
524 Ga0500590_044920 3300053148 Bacteria 2263
525 Ga0500616_0000088 3300053153 Bacteria 191662
526 Ga0500616_0000125 3300053153 Bacteria 135146
527 Ga0500616_0000433 3300053153 Bacteria 55659
528 Ga0500620_000051 3300053155 Bacteria 21187
529 Ga0500645_006814 3300053730 Bacteria 4038
530 Ga0587091_000145 3300059511 Bacteria 4494
531 Ga0501082_0335578 3300060353 Bacteria 1317
532 Ga0466962_0011991 3300061719 Bacteria 4169
533 Ga0466962_0133348 3300061719 Bacteria 1201
534 2555229871 2554235227 Bacteria 3637389
535 2587862688 2585428094 Bacteria 3604039
536 2588108217 2585428157 Bacteria 3018951
537 2643733373 2643221542 Bacteria 3563959
538 2643753591 2643221546 Bacteria 2910897
539 2643767593 2643221549 Bacteria 4042819
540 2643848084 2643221566 Bacteria 3460379
541 2643875342 2643221572 Bacteria 3614809
542 2643885116 2643221575 Bacteria 4022601
543 2643995618 2643221597 Bacteria 3347721
544 2644097109 2643221616 Bacteria 4066575
545 2644110898 2643221619 Bacteria 4158469
546 2644169947 2643221630 Bacteria 3601215
547 2644183634 2643221632 Bacteria 3406696
548 2644199395 2643221635 Bacteria 2632343
549 2644279575 2643221649 Bacteria 3867359
550 2644382398 2643221669 Bacteria 3611286
551 2644503595 2643221690 Bacteria 4654705
552 2644525875 2643221694 Bacteria 4392972
553 2644665736 2643221721 Bacteria 4486924
554 2644669934 2643221722 Bacteria 4247614
555 2644680534 2643221724 Bacteria 3593515
556 2655032572 2654587600 Bacteria 3911798
557 2723642144 2721755702 Bacteria 4373124
558 2730229993 2728369380 Bacteria 3620317
559 2738697360 2738541272 Bacteria 6848551
560 2739326746 2738543027 Bacteria 6409078
561 2739602328 2739367653 Bacteria 2780952
562 2739606062 2739367654 Bacteria 6049412
563 2747952395 2747842429 Bacteria 3914386
564 2753302067 2751185788 Bacteria 4541048
565 2758227257 2757320536 Bacteria 3629334
566 2760307111 2758568522 Bacteria 5953541
567 2760624425 2758568621 Bacteria 5967089
568 2774381660 2773857758 Bacteria 3592392
569 2774384708 2773857759 Bacteria 2963774
570 2774399816 2773857763 Bacteria 4180068
571 2808631433 2808606306 Bacteria 3608896
572 2808885410 2808606368 Bacteria 3174172
573 2808902212 2808606372 Bacteria 4649509
574 2809029294 2808606394 Bacteria 6248540
575 2809227161 2808606447 Bacteria 3572005
576 2812322843 2811994872 Bacteria 4121241
577 2817509187 2816332305 Bacteria 2697803
578 2821269722 2821268502 Bacteria 3750023
579 2833710668 2833709550 Bacteria 4008291
580 2844842722 2844841374 Bacteria 3917147
581 2844855367 2844852863 Bacteria 3849151
582 2852645352 2852643534 Bacteria 3013378
583 2852648696 2852646457 Bacteria 3408613
584 2852679489 2852677369 Bacteria 3768884
585 2857721691 2857720070 Bacteria 3189373
586 2857724196 2857723135 Bacteria 4217853
587 2857728384 2857727296 Bacteria 2745552
588 2857732526 2857729791 Bacteria 4040535
589 2857735516 2857733635 Bacteria 3532004
590 2857737471 2857737099 Bacteria 3104305
591 2862996433 2862993130 Bacteria 3860849
592 2870623347 2870622029 Bacteria 3643329
593 2870630087 2870628048 Bacteria 3696012
594 2884765699 2884763398 Bacteria 4091164
595 2884995720 2884994152 Bacteria 4492978
596 2887446390 2887443736 Bacteria 4426037
597 2893684648 2893684298 Bacteria 2897960
598 2895661432 2895660088 Bacteria 3782833
599 2897563516 2897561785 Bacteria 3256946
600 2904433731 2904430863 Bacteria 3486923
601 2904503032 2904501621 Bacteria 3401437
602 2904512684 2904509784 Bacteria 3520416
603 2906800223 2906799679 Bacteria 4031749
604 2908675791 2908674828 Bacteria 3382763
605 2908681318 2908678064 Bacteria 3482747
606 2909074837 2909074476 Bacteria 3436050
607 2919041270 2919039151 Bacteria 3391018
608 2919045772 2919042368 Bacteria 3905917
609 2919058428 2919055335 Bacteria 3875751
610 2919071482 2919069694 Bacteria 3622919
611 2919398318 2919395869 Bacteria 3704152
612 2919446098 2919443155 Bacteria 4072969
613 2919524811 2919523602 Bacteria 3788128
614 2920881813 2920879853 Bacteria 4216831
615 2928092348 2928090899 Bacteria 3158267
616 2928106830 2928104781 Bacteria 3877447
617 2928122868 2928121344 Bacteria 3972376
618 2928156278 2928153084 Bacteria 4020257
619 2928502370 2928500415 Bacteria 3384541
620 2932434871 2932431166 Bacteria 4215299
621 2935411513 2935409751 Bacteria 4179611
622 2935894687 2935890801 Bacteria 4593001
623 2939657781 2939657138 Bacteria 3740283
624 2939660961 2939660829 Bacteria 3784848
625 2945968119 2945968032 Bacteria 4111363
626 2946044613 2946041624 Bacteria 4191385
627 2946080616 2946080515 Bacteria 4310960
628 2964326815 2964326757 Bacteria 3290868
629 2966923314 2966921586 Bacteria 3092803
630 2966924735 2966924647 Bacteria 3268643
631 2974297702 2974294766 Bacteria 3767688
632 2974326063 2974324384 Bacteria 3750535
633 2977231026 2977228692 Bacteria 3450105
634 2977239820 2977236895 Bacteria 3569373
635 2977253710 2977251589 Bacteria 2952848
636 2977266263 2977264416 Bacteria 3750737
637 2984545907 2984542743 Bacteria 3569378
638 2984554207 2984551494 Bacteria 3877562
639 2984580887 2984580707 Bacteria 3351387
640 8004184857 8004182704 Bacteria 3391155
641 8004214071 8004212874 Bacteria 2861420
642 8016257873 8016254467 Bacteria 3797036
643 8045830896 8045830549 Bacteria 4444727
644 8046356304 8046352972 Bacteria 3613806
645 8056037709 8056037122 Bacteria 3854319
646 8056583714 8056579771 Bacteria 5840325
647 8057348970 8057345674 Bacteria 4160394
648 Ga0055532_1007374
649 JGI24740J21852_10008054
650 JGI24735J21928_10001246
651 JGI25162J39368_1005509
652 JGI25154J39366_1002087
653 JGI25164J39214_1000402
654 JGI25165J46597_1000004
655 Ga0006562J51391_1006933
656 Ga0006562J51391_1019981
657 Ga0006562J51391_1033231
658 Ga0055539_1000008
659 Ga0055533_1000001
660 Ga0055525_1001044
661 Ga0055527_1000001
662 Ga0055529_1000019
663 Ga0065714_10158447
664 Ga0070658_10000090
665 Ga0070658_10022190
666 Ga0070658_10070677
667 Ga0070658_10076165
668 Ga0070658_10091022
669 Ga0070666_10382779
670 Ga0068868_100007759
671 Ga0070660_100133719
672 Ga0070668_100486275
673 Ga0070675_100100920
674 Ga0070671_100275704
675 Ga0070659_100000366
676 Ga0070659_100171619
677 Ga0070667_100003912
678 Ga0070710_10044198
679 Ga0070710_10120455
680 Ga0070708_100101597
681 Ga0070685_10005499
682 Ga0070706_100019402
683 Ga0070707_100025370
684 Ga0070707_100057127
685 Ga0070707_100151205
686 Ga0070699_100057532
687 Ga0068853_100155362
688 Ga0070665_100133320
689 Ga0068855_100004431
690 Ga0068857_100001886
691 Ga0068857_100271612
692 Ga0068856_100219122
693 Ga0068856_100507080
694 Ga0068852_100166555
695 Ga0068852_100188659
696 Ga0068861_100152300
697 Ga0068861_100284773
698 Ga0068851_10000020
699 Ga0068863_100040998
700 Ga0068863_100242043
701 Ga0068858_100000233
702 Ga0075365_10017575
703 Ga0075365_10263022
704 Ga0075368_10004737
705 Ga0075364_10048122
706 Ga0075364_10063109
707 Ga0075364_10229071
708 Ga0075364_10323955
709 Ga0075367_10005074
710 Ga0075369_10015926
711 Ga0075370_10009068
712 Ga0075370_10144562
713 Ga0105244_10056462
714 Ga0105240_10002356
715 Ga0111539_10367523
716 Ga0105245_10004100
717 Ga0105245_10025054
718 Ga0105247_10051465
719 Ga0105247_10208780
720 Ga0105243_10074592
721 Ga0105243_10096103
722 Ga0105241_10009358
723 Ga0105248_10000714
724 Ga0105248_10095008
725 Ga0105237_10012072
726 Ga0105237_10209342
727 Ga0105237_10239404
728 Ga0105238_10166277
729 Ga0105238_10531507
730 Ga0105239_10050863
731 Ga0105246_10236366
732 Ga0157371_10130247
733 Ga0157370_10011227
734 Ga0157370_10038884
735 Ga0157369_10021407
736 Ga0157369_10031237
737 Ga0157369_10113027
738 Ga0157369_10305140
739 Ga0171462_1003
740 Ga0157374_10393727
741 Ga0163162_10011086
742 Ga0163162_10360031
743 Ga0157372_10031466
744 Ga0157372_10202614
745 Ga0157372_10203822
746 Ga0157372_10309238
747 Ga0157372_10860525
748 Ga0163163_10016022
749 Ga0157380_10245759
750 Ga0157377_10194864
751 Ga0157379_10006941
752 Ga0157376_10273357
753 Ga0197907_11125962
754 Ga0197907_11300642
755 Ga0206356_11508020
756 Ga0206349_1688277
757 Ga0206355_1473399
758 Ga0206352_10442088
759 Ga0206354_11186439
760 Ga0206354_11188215
761 Ga0206353_10742709
762 Ga0206353_11111984
763 Ga0206353_11696962
764 Ga0224712_10003247
765 Ga0224712_10006014
766 Ga0224712_10015458
767 Ga0224712_10045271
768 Ga0209566_100149
769 Ga0209674_100001
770 Ga0209672_100006
771 Ga0209147_100849
772 Ga0209563_100001
773 Ga0209563_103901
774 Ga0207427_100010
775 Ga0209437_100216
776 Ga0209258_101905
777 Ga0209646_1000071
778 Ga0209677_100001
779 Ga0209677_101181
780 Ga0209148_1000015
781 Ga0209148_1002856
782 Ga0209233_1000001
783 Ga0209455_1000013
784 Ga0209455_1000811
785 Ga0207656_10000012
786 Ga0207655_1017656
787 Ga0207692_10096257
788 Ga0207647_10010718
789 Ga0207643_10209166
790 Ga0207643_10229181
791 Ga0207705_10000006
792 Ga0207705_10018609
793 Ga0207705_10031366
794 Ga0207705_10114097
795 Ga0207684_10046534
796 Ga0207684_10055330
797 Ga0207684_10092693
798 Ga0207654_10000003
799 Ga0207695_10005466
800 Ga0207671_10000002
801 Ga0207671_10047724
802 Ga0207660_10071151
803 Ga0207662_10170876
804 Ga0207657_10018899
805 Ga0207657_10254821
806 Ga0207649_10143594
807 Ga0207652_10138855
808 Ga0207646_10010011
809 Ga0207646_10015579
810 Ga0207646_10125443
811 Ga0207694_10000433
812 Ga0207687_10010597
813 Ga0207687_10041380
814 Ga0207690_10001456
815 Ga0207690_10160280
816 Ga0207709_10051138
817 Ga0207709_10187475
818 Ga0207709_10226261
819 Ga0207691_10177924
820 Ga0207711_10001344
821 Ga0207711_10003878
822 Ga0207667_10003435
823 Ga0207667_10028110
824 Ga0207667_10034482
825 Ga0207667_10141355
826 Ga0207668_10065840
827 Ga0207658_10007898
828 Ga0207677_10041301
829 Ga0207703_10000044
830 Ga0207703_10405855
831 Ga0207639_10429874
832 Ga0207678_10311108
833 Ga0207641_10059147
834 Ga0207641_10164418
835 Ga0207674_10004435
836 Ga0207674_10216336
837 Ga0207674_10313232
838 Ga0207675_100025236
839 Ga0207675_100558345
840 Ga0207698_10004859
841 Ga0209813_10008542
842 Ga0268266_10172760
843 Ga0307515_10065688
844 Ga0314311_1115621
845 Ga0316179_1009441
846 Ga0307513_10216642
847 Ga0307514_10016061
848 Ga0307413_10382705
849 Ga0307410_10045839
850 Ga0307410_10048629
851 Ga0307410_10129657
852 Ga0307406_10000235
853 Ga0307406_10057164
854 Ga0307406_10160943
855 Ga0307406_10489345
856 Ga0307412_10034093
857 Ga0307409_100045968
858 Ga0307409_100060763
859 Ga0307409_100146398
860 Ga0307409_100195485
861 Ga0307409_100216028
862 Ga0307416_100040035
863 Ga0307416_100056049
864 Ga0307416_100672619
865 Ga0307416_100783866
866 Ga0307414_10022142
867 Ga0307414_10208528
868 Ga0307414_10547430
869 Ga0307414_10763304
870 Ga0307411_10081730
871 Ga0307415_100148252
872 Ga0395899_0022953
873 Ga0395899_0070509
874 Ga0395900_0000774
875 Ga0395900_0006765
876 Ga0395900_0197058
877 Ga0395898_0000015
878 Ga0395898_0086750
879 Ga0395898_0184773
880 Ga0395901_0027940
881 Ga0395901_0049595
882 Ga0439465_0097340
883 Ga0451791_0837996
884 Ga0451797_0483182
885 Ga0451802_0750017
886 Ga0451837_0363453
887 Ga0451841_0047102
888 Ga0451853_3801612
889 Ga0450900_003942
890 Ga0466972_0013783
891 Ga0466972_0050673
892 Ga0466972_0067322
893 Ga0466972_0089529
894 Ga0466965_0000049
895 Ga0466965_0007873
896 Ga0466965_0013587
897 Ga0466965_0039830
898 Ga0466965_0045130
899 Ga0466965_0195055
900 Ga0466965_0222987
901 Ga0466961_0024014
902 Ga0466961_0027770
903 Ga0466964_0012477
904 Ga0466971_0024843
905 Ga0466968_0001253
906 Ga0466968_0031845
907 Ga0466968_0083071
908 Ga0466970_0000004
909 Ga0466970_0004242
910 Ga0466970_0007086
911 Ga0466970_0007409
912 Ga0466970_0017425
913 Ga0466970_0024528
914 Ga0466970_0027715
915 Ga0466970_0048621
916 Ga0466970_0049233
917 Ga0466970_0067272
918 Ga0466957_0017532
919 Ga0466957_0126418
920 Ga0466960_0006777
921 Ga0466960_0031038
922 Ga0466960_0120674
923 Ga0466960_0190010
924 Ga0466958_0008749
925 Ga0495590_0000109
926 Ga0495638_0162889
927 Ga0495654_0033080
928 Ga0495609_0013502
929 Ga0495625_0060683
930 Ga0495686_0145880
931 Ga0496100_0014695
932 Ga0496100_0032634
933 Ga0496100_0211424
934 Ga0496101_0069903
935 Ga0496102_0070307
936 Ga0496102_0093765
937 Ga0496103_0040021
938 Ga0496103_0055950
939 Ga0496104_0054964
940 Ga0496104_0153567
941 Ga0496105_0026904
942 Ga0496105_0054164
943 Ga0496106_0062189
944 Ga0496107_0014832
945 Ga0496108_0094399
946 Ga0496109_0166893
947 Ga0496109_0179762
948 Ga0496109_0260847
949 Ga0496110_0112196
950 Ga0496110_0128713
951 Ga0496111_0006270
952 Ga0496113_0078866
953 Ga0496113_0161694
954 Ga0496113_0402284
955 Ga0496114_0013770
956 Ga0496114_0020705
957 Ga0496114_0072502
958 Ga0496114_0102901
959 Ga0496115_0022524
960 Ga0496115_0042030
961 Ga0496115_0079583
962 Ga0496115_0200849
963 Ga0496116_0003139
964 Ga0496116_0054133
965 Ga0496117_0000232
966 Ga0496117_0000737
967 Ga0496117_0004041
968 Ga0496117_0005578
969 Ga0496117_0005793
970 Ga0496117_0007542
971 Ga0496117_0029392
972 Ga0496117_0122767
973 Ga0496118_0000605
974 Ga0496118_0002736
975 Ga0496118_0003338
976 Ga0496118_0004186
977 Ga0496118_0052256
978 Ga0496118_0063147
979 Ga0496118_0105327
980 Ga0496118_0296780
981 Ga0496119_0000341
982 Ga0496119_0002020
983 Ga0496119_0002098
984 Ga0496119_0003222
985 Ga0496119_0006922
986 Ga0496119_0009424
987 Ga0496119_0020558
988 Ga0496119_0022129
989 Ga0496119_0053891
990 Ga0496119_0055305
991 Ga0496119_0240361
992 Ga0496119_0250809
993 Ga0496120_0000456
994 Ga0496120_0001183
995 Ga0496120_0031385
996 Ga0496120_0033960
997 Ga0496120_0041571
998 Ga0496120_0057518
999 Ga0496120_0058400
1000 Ga0496121_0000040
1001 Ga0496121_0064938
1002 Ga0496121_0110041
1003 Ga0496122_0000030
1004 Ga0496122_0000120
1005 Ga0496122_0005995
1006 Ga0496122_0007503
1007 Ga0496122_0032104
1008 Ga0496122_0034773
1009 Ga0496122_0069611
1010 Ga0496122_0070228
1011 Ga0496123_0000024
1012 Ga0496123_0000051
1013 Ga0496123_0002368
1014 Ga0496123_0002701
1015 Ga0496123_0009280
1016 Ga0496123_0038834
1017 Ga0496123_0053387
1018 Ga0496124_0000363
1019 Ga0496124_0002437
1020 Ga0496124_0005016
1021 Ga0496124_0005922
1022 Ga0496124_0120420
1023 Ga0496124_0147008
1024 Ga0496125_0000097
1025 Ga0496125_0001405
1026 Ga0496125_0002686
1027 Ga0496125_0018821
1028 Ga0496125_0049251
1029 Ga0496125_0220907
1030 Ga0496126_0001194
1031 Ga0496126_0002527
1032 Ga0496126_0012898
1033 Ga0496126_0020398
1034 Ga0496126_0025034
1035 Ga0496126_0035675
1036 Ga0496126_0043490
1037 Ga0496126_0075463
1038 Ga0496126_0212335
1039 Ga0496126_0267941
1040 Ga0496126_0405216
1041 Ga0501031_0000454
1042 Ga0501031_0014045
1043 Ga0501031_0267153
1044 Ga0501032_0018756
1045 Ga0501032_0032274
1046 Ga0501032_0213185
1047 Ga0501032_0304133
1048 Ga0501033_0011741
1049 Ga0501033_0028007
1050 Ga0501033_0113416
1051 Ga0501033_0134828
1052 Ga0501033_0155564
1053 Ga0501033_0293698
1054 Ga0501034_0000227
1055 Ga0501034_0007058
1056 Ga0501034_0018450
1057 Ga0501034_0025911
1058 Ga0501034_0036437
1059 Ga0501034_0038369
1060 Ga0501034_0067417
1061 Ga0501034_0068832
1062 Ga0501034_0077168
1063 Ga0501034_0235466
1064 Ga0501034_0619172
1065 Ga0501036_0045835
1066 Ga0501036_0074956
1067 Ga0501036_0088330
1068 Ga0501036_0472520
1069 Ga0501037_0000536
1070 Ga0501037_0022052
1071 Ga0501037_0075830
1072 Ga0501038_0005424
1073 Ga0501038_0021735
1074 Ga0501038_0047429
1075 Ga0501038_0206603
1076 Ga0501038_0258698
1077 Ga0501039_0026758
1078 Ga0501039_0064719
1079 Ga0501039_0078754
1080 Ga0501039_0364033
1081 Ga0501040_0274130
1082 Ga0501041_0363077
1083 Ga0501042_0003632
1084 Ga0501043_0002454
1085 Ga0501043_0029285
1086 Ga0501043_0104286
1087 Ga0501043_0321223
1088 Ga0501046_0033391
1089 Ga0501046_0115627
1090 Ga0501046_0183692
1091 Ga0501046_0529680
1092 Ga0501047_0014035
1093 Ga0501047_0014129
1094 Ga0501047_0055159
1095 Ga0501047_0068104
1096 Ga0501047_0090472
1097 Ga0501047_0228375
1098 Ga0501048_0030390
1099 Ga0501068_0046523
1100 Ga0501070_0000167
1101 Ga0501070_0002705
1102 Ga0501070_0010791
1103 Ga0501070_0049972
1104 Ga0501070_0055423
1105 Ga0501070_0124206
1106 Ga0501070_0195505
1107 Ga0501070_0341028
1108 Ga0501071_0238642
1109 Ga0501072_0026621
1110 Ga0501072_0116858
1111 Ga0501073_0009587
1112 Ga0501073_0112185
1113 Ga0501074_0010738
1114 Ga0501076_0250295
1115 Ga0501079_0521382
1116 Ga0501080_0000084
1117 Ga0501080_0193318
1118 Ga0501080_0731200
1119 Ga0501083_0000027
1120 Ga0501083_0024223
1121 Ga0501083_0062547
1122 Ga0501035_0020396
1123 Ga0501035_0023927
1124 Ga0501035_0091587
1125 Ga0501035_0252001
1126 Ga0501035_0568902
1127 Ga0501044_0004023
1128 Ga0501044_0004313
1129 Ga0501044_0046051
1130 Ga0501044_0056141
1131 Ga0501044_0082435
1132 Ga0501044_0130389
1133 Ga0501044_0144912
1134 Ga0501044_0309587
1135 Ga0501045_0047611
1136 nmdc:mga00v17_10485_c1
1137 nmdc:mga00v17_12805_c1
1138 nmdc:mga00v17_221202_c1
1139 nmdc:mga00v17_34683_c1
1140 nmdc:mga0yw44_11968_c1
1141 nmdc:mga0yw44_176629_c1
1142 nmdc:mga0yw44_26395_c1
1143 nmdc:mga06z11_4650_c1
1144 nmdc:mga04h51_1398_c1
1145 nmdc:mga07m45_4789_c1
1146 nmdc:mga08y16_344289_c1
1147 Ga0500635_0000028
1148 Ga0500635_0008122
1149 Ga0495619_0042496
1150 Ga0500643_000082
1151 Ga0500651_0005308
1152 Ga0500650_0003657
1153 Ga0500556_0000001
1154 Ga0500556_0000393
1155 Ga0500556_0047463
1156 Ga0500562_000999
1157 Ga0500593_000123
1158 Ga0500593_020216
1159 Ga0500559_0000102
1160 Ga0500559_0000731
1161 Ga0500568_0000014
1162 Ga0500568_0000016
1163 Ga0500568_0006564
1164 Ga0500573_0000059
1165 Ga0500573_0000382
1166 Ga0500573_0004289
1167 Ga0500573_0099138
1168 Ga0500573_0110546
1169 Ga0500573_0204173
1170 Ga0500588_0005022
1171 Ga0500590_044920
1172 Ga0500616_0000088
1173 Ga0500616_0000125
1174 Ga0500616_0000433
1175 Ga0500620_000051
1176 Ga0500645_006814
1177 Ga0587091_000145
1178 Ga0501082_0335578
1179 Ga0466962_0011991
1180 Ga0466962_0133348
1181 2555229871
1182 2587862688
1183 2588108217
1184 2643733373
1185 2643753591
1186 2643767593
1187 2643848084
1188 2643875342
1189 2643885116
1190 2643995618
1191 2644097109
1192 2644110898
1193 2644169947
1194 2644183634
1195 2644199395
1196 2644279575
1197 2644382398
1198 2644503595
1199 2644525875
1200 2644665736
1201 2644669934
1202 2644680534
1203 2655032572
1204 2723642144
1205 2730229993
1206 2738697360
1207 2739326746
1208 2739602328
1209 2739606062
1210 2747952395
1211 2753302067
1212 2758227257
1213 2760307111
1214 2760624425
1215 2774381660
1216 2774384708
1217 2774399816
1218 2808631433
1219 2808885410
1220 2808902212
1221 2809029294
1222 2809227161
1223 2812322843
1224 2817509187
1225 2821269722
1226 2833710668
1227 2844842722
1228 2844855367
1229 2852645352
1230 2852648696
1231 2852679489
1232 2857721691
1233 2857724196
1234 2857728384
1235 2857732526
1236 2857735516
1237 2857737471
1238 2862996433
1239 2870623347
1240 2870630087
1241 2884765699
1242 2884995720
1243 2887446390
1244 2893684648
1245 2895661432
1246 2897563516
1247 2904433731
1248 2904503032
1249 2904512684
1250 2906800223
1251 2908675791
1252 2908681318
1253 2909074837
1254 2919041270
1255 2919045772
1256 2919058428
1257 2919071482
1258 2919398318
1259 2919446098
1260 2919524811
1261 2920881813
1262 2928092348
1263 2928106830
1264 2928122868
1265 2928156278
1266 2928502370
1267 2932434871
1268 2935411513
1269 2935894687
1270 2939657781
1271 2939660961
1272 2945968119
1273 2946044613
1274 2946080616
1275 2964326815
1276 2966923314
1277 2966924735
1278 2974297702
1279 2974326063
1280 2977231026
1281 2977239820
1282 2977253710
1283 2977266263
1284 2984545907
1285 2984554207
1286 2984580887
1287 8004184857
1288 8004214071
1289 8016257873
1290 8045830896
1291 8046356304
1292 8056037709
1293 8056583714
1294 8057348970

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

166

242

0.89

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

164

238

0.84

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

70

145

0.76

PF00034

Cytochrom_C

Cytochrome c

72

149

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhm-assembly1.cif.gz_C cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.7929 53 260
7e1x-assembly1.cif.gz_O cryo-em structure of hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv in presence of tb47 0.7922 53 260
6adq-assembly1.cif.gz_C respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.7915 53 260
8hcr-assembly1.cif.gz_O cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.7733 53 260
8hcr-assembly1.cif.gz_C cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.7668 53 260
ID Description Score Start End Superfamily
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9091 142 225 1.10.760.10
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8093 142 225 1.10.760.10
3mk7M03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.799 56 81 1.10.760.10
1cnoH00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7233 50 131 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7223 52 129 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.8889 53 212 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A6N9Y0U2-F1-model_v4 deleted 0.8774 124 199
AF-A0A4R4KTG3-F1-model_v4 C-type cytochrome 0.8628 60 200 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D3BQT2-F1-model_v4 Cystathionine beta-lyase 0.8597 53 169 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A7V9EYU8-F1-model_v4 Cytochrome c 0.8514 53 133 GO:0009055
GO:0020037
GO:0046872

Map