F472256

General Info

Members Datasets Scaffolds Average Seq Length
647 262 1294 307

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100005121|Ga0070680_1000051215
Length 357
Sequence MWCQASCDHNQPIAPELNVVPRSRFLSCLGANKLPGRLAEKLSKTHYGAYNVTMQFAKAKTDFLEYLEIEQNRSQKTIQNYDHYLTRLIDFAGDIKVSDIDQELIRKWRLWLNRLGTNTSDELGKTTQNYHLIALRGFLKFCAKRNIIALTADKVELARTRRSQVTFLSEDELARLFAEPDTNTLAGLRDRAILELLFSSGLRVSELVGLDRDHINLKRREFMVRGKGQKDRPIFISPEAASWIEQYLAKRDDTTRPLFIRYSGNKQIDRSGNFHRLTARSVQRLVARYALLAGITKHVSPHTLRHSFATDLLMNGADLRSVQALLGHSNIATTQIYTHVTDPHLRAVHEKFHRHSE

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
82 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
83 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
84 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
85 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
156 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
159 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
183 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
184 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
235 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
236 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
237 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
240 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
241 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
242 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
243 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
244 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
253 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
254 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
255 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
256 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
259 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
260 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17
Nodule 0
Rhizoplane 0.15
Rhizosphere 81.14
Stem 0
Stem Tuber 0
Unclassified 7.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100005121 3300005336 Bacteria 9900
2 MBSR1b_contig_3495855 2162886012 Unclassified 1857
3 JGI24741J21665_1001677 3300001915 Bacteria 6149
4 JGI24741J21665_1001833 3300001915 Bacteria 5814
5 JGI24740J21852_10006473 3300001979 Bacteria 4845
6 JGI24740J21852_10007043 3300001979 Bacteria 4609
7 JGI24740J21852_10016764 3300001979 Bacteria 2638
8 JGI24739J22299_10002568 3300001989 Bacteria 7001
9 JGI24737J22298_10000003 3300001990 Bacteria 67128
10 JGI24737J22298_10000111 3300001990 Bacteria 24854
11 JGI24743J22301_10000261 3300001991 Bacteria 5658
12 JGI24735J21928_10000022 3300002067 Bacteria 97715
13 JGI24735J21928_10000049 3300002067 Bacteria 51076
14 JGI24738J21930_10003919 3300002075 Bacteria 3710
15 JGI24738J21930_10004073 3300002075 Bacteria 3615
16 JGI24742J22300_10000001 3300002244 Bacteria 61784
17 rootH2_10000311 3300003320 Bacteria 277677
18 rootH2_10004334 3300003320 Bacteria 85448
19 rootL2_10021337 3300003322 Bacteria 11713
20 rootH1_10001727 3300003323 Bacteria 102468
21 rootH1_10008297 3300003323 Bacteria 2071
22 rootH1_10159927 3300003323 Bacteria 1567
23 rootH1_10270649 3300003323 Bacteria 7383
24 JGI26128J50194_1000010 3300003347 Bacteria 5835
25 Ga0065715_10125503 3300005293 Unclassified 2129
26 Ga0070658_10000009 3300005327 Bacteria 319868
27 Ga0070658_10000076 3300005327 Bacteria 95016
28 Ga0070658_10000336 3300005327 Bacteria 40548
29 Ga0070658_10000660 3300005327 Bacteria 29772
30 Ga0070658_10002074 3300005327 Bacteria 16820
31 Ga0070658_10004103 3300005327 Bacteria 11936
32 Ga0070658_10009224 3300005327 Bacteria 7933
33 Ga0070658_10104220 3300005327 Bacteria 2346
34 Ga0070658_10142711 3300005327 Bacteria 2001
35 Ga0070658_10266400 3300005327 Unclassified 1456
36 Ga0070676_10002768 3300005328 Bacteria 9061
37 Ga0070676_10005817 3300005328 Bacteria 6575
38 Ga0070683_100001058 3300005329 Bacteria 20652
39 Ga0070683_100001106 3300005329 Bacteria 20343
40 Ga0070683_100002025 3300005329 Bacteria 15933
41 Ga0070683_100308284 3300005329 Bacteria 1506
42 Ga0070690_100001938 3300005330 Bacteria 11006
43 Ga0070666_10113845 3300005335 Bacteria 1872
44 Ga0070666_10153450 3300005335 Unclassified 1607
45 Ga0070680_100007110 3300005336 Bacteria 8529
46 Ga0070680_100015551 3300005336 Bacteria 5970
47 Ga0070680_100051485 3300005336 Bacteria 3360
48 Ga0070682_100115705 3300005337 Bacteria 1793
49 Ga0070660_100000119 3300005339 Bacteria 49566
50 Ga0070660_100003520 3300005339 Bacteria 10794
51 Ga0070660_100004938 3300005339 Bacteria 9226
52 Ga0070660_100006526 3300005339 Bacteria 8094
53 Ga0070660_100008797 3300005339 Bacteria 7073
54 Ga0070660_100068613 3300005339 Bacteria 2764
55 Ga0070691_10000916 3300005341 Bacteria 11964
56 Ga0070661_100010783 3300005344 Bacteria 6363
57 Ga0070661_100039905 3300005344 Bacteria 3422
58 Ga0070692_10042836 3300005345 Unclassified 2326
59 Ga0070668_100042546 3300005347 Unclassified 3482
60 Ga0070668_100158134 3300005347 Bacteria 1837
61 Ga0070669_100461091 3300005353 Unclassified 1049
62 Ga0070675_100041801 3300005354 Bacteria 3745
63 Ga0070675_100355771 3300005354 Bacteria 1299
64 Ga0070671_100000001 3300005355 Bacteria 1228151
65 Ga0070671_100083437 3300005355 Unclassified 2672
66 Ga0070674_100001494 3300005356 Bacteria 12457
67 Ga0070674_100015527 3300005356 Bacteria 4755
68 Ga0070673_100008235 3300005364 Bacteria 6924
69 Ga0070673_100276157 3300005364 Viruses 1472
70 Ga0070659_100000780 3300005366 Bacteria 23122
71 Ga0070659_100003167 3300005366 Bacteria 11720
72 Ga0070659_100060477 3300005366 Bacteria 2992
73 Ga0070659_100118898 3300005366 Bacteria 2138
74 Ga0070667_100000001 3300005367 Bacteria 1108638
75 Ga0070667_100132915 3300005367 Bacteria 2173
76 Ga0070714_100000871 3300005435 Bacteria 21405
77 Ga0070713_100381523 3300005436 Bacteria 1313
78 Ga0070663_100033373 3300005455 Bacteria 3556
79 Ga0070663_100234612 3300005455 Viruses 1446
80 Ga0070678_100000753 3300005456 Bacteria 16225
81 Ga0070678_100010185 3300005456 Bacteria 5730
82 Ga0070662_100011590 3300005457 Bacteria 5818
83 Ga0070681_10037793 3300005458 Bacteria 4842
84 Ga0070681_10210323 3300005458 Bacteria 1861
85 Ga0070681_10303727 3300005458 Viruses 1505
86 Ga0068867_100022709 3300005459 Bacteria 4487
87 Ga0070685_10001093 3300005466 Bacteria 14515
88 Ga0070685_10002310 3300005466 Bacteria 9838
89 Ga0070679_100001517 3300005530 Bacteria 20675
90 Ga0070679_100003722 3300005530 Bacteria 13977
91 Ga0070679_100005533 3300005530 Bacteria 11703
92 Ga0070679_100021096 3300005530 Bacteria 6357
93 Ga0070679_100559472 3300005530 Bacteria 1087
94 Ga0070684_100000860 3300005535 Bacteria 21450
95 Ga0070684_100007560 3300005535 Bacteria 8460
96 Ga0070684_100024870 3300005535 Bacteria 5026
97 Ga0070684_100028413 3300005535 Unclassified 4732
98 Ga0070684_100075791 3300005535 Bacteria 2968
99 Ga0068853_100018528 3300005539 Bacteria 5765
100 Ga0068853_100175605 3300005539 Unclassified 1940
101 Ga0068853_100176886 3300005539 Bacteria 1933
102 Ga0070686_100007189 3300005544 Bacteria 6202
103 Ga0070686_100017663 3300005544 Unclassified 4172
104 Ga0070665_100130965 3300005548 Bacteria 2510
105 Ga0070665_100799270 3300005548 Bacteria 956
106 Ga0068855_100000001 3300005563 Bacteria 818777
107 Ga0068855_100000002 3300005563 Bacteria 616881
108 Ga0068855_100000017 3300005563 Bacteria 212278
109 Ga0068855_100002485 3300005563 Bacteria 22714
110 Ga0068855_100006018 3300005563 Bacteria 14797
111 Ga0068855_100011195 3300005563 Bacteria 10833
112 Ga0068855_100025370 3300005563 Bacteria 7093
113 Ga0068855_100079325 3300005563 Bacteria 3808
114 Ga0070664_100000165 3300005564 Bacteria 45818
115 Ga0070664_100153013 3300005564 Unclassified 2037
116 Ga0070664_100257093 3300005564 Viruses 1571
117 Ga0068857_100000001 3300005577 Bacteria 254081
118 Ga0068857_100000266 3300005577 Bacteria 35450
119 Ga0068857_100163368 3300005577 Bacteria 2021
120 Ga0068856_100000002 3300005614 Bacteria 372816
121 Ga0068856_100000441 3300005614 Bacteria 45741
122 Ga0068856_100001703 3300005614 Bacteria 22976
123 Ga0068856_100002784 3300005614 Bacteria 17907
124 Ga0068856_100036064 3300005614 Bacteria 4849
125 Ga0068856_100045294 3300005614 Bacteria 4331
126 Ga0068856_100119495 3300005614 Bacteria 2637
127 Ga0068852_100000173 3300005616 Bacteria 43532
128 Ga0068852_100037934 3300005616 Bacteria 4045
129 Ga0068864_100530073 3300005618 Viruses 1136
130 Ga0068863_100029972 3300005841 Bacteria 5197
131 Ga0068863_100121081 3300005841 Bacteria 2495
132 Ga0068858_100014703 3300005842 Bacteria 7367
133 Ga0068860_100021321 3300005843 Bacteria 6274
134 Ga0081455_10000020 3300005937 Bacteria 172997
135 Ga0081539_10013697 3300005985 Bacteria 6090
136 Ga0075365_10000007 3300006038 Bacteria 116889
137 Ga0075365_10001244 3300006038 Bacteria 11288
138 Ga0075365_10025938 3300006038 Bacteria 3715
139 Ga0075368_10000090 3300006042 Bacteria 22751
140 Ga0075368_10000174 3300006042 Bacteria 17516
141 Ga0075363_100000147 3300006048 Bacteria 17418
142 Ga0075363_100000352 3300006048 Bacteria 13817
143 Ga0075364_10000111 3300006051 Bacteria 33702
144 Ga0075364_10000937 3300006051 Bacteria 15385
145 Ga0075364_10013165 3300006051 Bacteria 5077
146 Ga0075367_10000296 3300006178 Bacteria 17516
147 Ga0075367_10000339 3300006178 Bacteria 16665
148 Ga0075367_10029637 3300006178 Bacteria 3132
149 Ga0075369_10000004 3300006186 Bacteria 154675
150 Ga0075369_10000031 3300006186 Bacteria 37621
151 Ga0075369_10003342 3300006186 Bacteria 5830
152 Ga0075366_10000003 3300006195 Bacteria 114017
153 Ga0075366_10000010 3300006195 Bacteria 81131
154 Ga0075366_10000096 3300006195 Bacteria 35379
155 Ga0075366_10000204 3300006195 Bacteria 26136
156 Ga0075366_10000978 3300006195 Bacteria 13965
157 Ga0075366_10001219 3300006195 Bacteria 12757
158 Ga0075366_10003860 3300006195 Bacteria 7983
159 Ga0097621_100000001 3300006237 Bacteria 632268
160 Ga0097621_100000052 3300006237 Bacteria 60152
161 Ga0097621_100035651 3300006237 Bacteria 3977
162 Ga0097621_100162187 3300006237 Viruses 1922
163 Ga0075370_10000990 3300006353 Bacteria 11758
164 Ga0075370_10001566 3300006353 Bacteria 10046
165 Ga0075370_10031451 3300006353 Unclassified 2963
166 Ga0075370_10144555 3300006353 Bacteria 1391
167 Ga0068871_100000001 3300006358 Bacteria 215987
168 Ga0068871_100000006 3300006358 Bacteria 116822
169 Ga0068871_100005288 3300006358 Bacteria 9039
170 Ga0068871_100442801 3300006358 Bacteria 1163
171 Ga0075428_100007820 3300006844 Bacteria 11853
172 Ga0075428_100099923 3300006844 Bacteria 3164
173 Ga0075430_100060256 3300006846 Bacteria 3190
174 Ga0068865_100000106 3300006881 Bacteria 43112
175 Ga0105240_10000003 3300009093 Bacteria 1183681
176 Ga0105240_10000030 3300009093 Bacteria 321312
177 Ga0105240_10000886 3300009093 Bacteria 53766
178 Ga0105240_10005930 3300009093 Bacteria 18093
179 Ga0105240_10023635 3300009093 Bacteria 8119
180 Ga0105240_10045972 3300009093 Bacteria 5535
181 Ga0105240_10291984 3300009093 Unclassified 1868
182 Ga0111539_10000377 3300009094 Bacteria 55154
183 Ga0105245_10000001 3300009098 Bacteria 939270
184 Ga0105245_10000096 3300009098 Bacteria 84679
185 Ga0105245_10000127 3300009098 Bacteria 72844
186 Ga0105245_10030451 3300009098 Unclassified 4771
187 Ga0105245_10054517 3300009098 Bacteria 3591
188 Ga0105245_10165200 3300009098 Bacteria 2104
189 Ga0105245_10209908 3300009098 Bacteria 1874
190 Ga0105245_10574204 3300009098 Bacteria 1152
191 Ga0105243_10000001 3300009148 Bacteria 1156578
192 Ga0105243_10006155 3300009148 Bacteria 9277
193 Ga0105241_10000009 3300009174 Bacteria 258876
194 Ga0105241_10001013 3300009174 Bacteria 21361
195 Ga0105241_10016697 3300009174 Bacteria 5387
196 Ga0105241_10278601 3300009174 Unclassified 1427
197 Ga0105242_10000001 3300009176 Bacteria 574039
198 Ga0105242_10017653 3300009176 Bacteria 5565
199 Ga0105242_10022217 3300009176 Bacteria 4986
200 Ga0105242_10158997 3300009176 Bacteria 1976
201 Ga0105248_10019320 3300009177 Bacteria 7538
202 Ga0105248_10032935 3300009177 Bacteria 5788
203 Ga0105237_10000001 3300009545 Bacteria 1009213
204 Ga0105237_10069677 3300009545 Unclassified 3513
205 Ga0105237_10091215 3300009545 Bacteria 3036
206 Ga0105237_10223307 3300009545 Bacteria 1884
207 Ga0105237_10378437 3300009545 Bacteria 1420
208 Ga0105238_10000462 3300009551 Bacteria 42703
209 Ga0105238_10000614 3300009551 Bacteria 37450
210 Ga0105238_10041162 3300009551 Bacteria 4680
211 Ga0105238_10145740 3300009551 Unclassified 2344
212 Ga0105249_10016080 3300009553 Bacteria 6632
213 Ga0105249_10032436 3300009553 Bacteria 4726
214 Ga0105032_100012 3300009979 Bacteria 73994
215 Ga0105029_100012 3300009984 Bacteria 9525
216 Ga0105033_102652 3300009986 Bacteria 1484
217 Ga0105030_103048 3300009987 Unclassified 1450
218 Ga0105028_100146 3300009993 Bacteria 7569
219 Ga0105239_10000481 3300010375 Bacteria 58265
220 Ga0105239_10001159 3300010375 Bacteria 36200
221 Ga0105239_10008373 3300010375 Bacteria 11782
222 Ga0105239_10009209 3300010375 Bacteria 11167
223 Ga0105239_10009667 3300010375 Bacteria 10845
224 Ga0105246_10000266 3300011119 Bacteria 27135
225 Ga0105246_10000412 3300011119 Bacteria 22903
226 Ga0105246_10018155 3300011119 Bacteria 4480
227 Ga0157373_10000092 3300013100 Bacteria 74657
228 Ga0157373_10011488 3300013100 Bacteria 6510
229 Ga0157373_10013776 3300013100 Bacteria 5927
230 Ga0157373_10013808 3300013100 Bacteria 5922
231 Ga0157373_10039112 3300013100 Bacteria 3396
232 Ga0157371_10000207 3300013102 Bacteria 86226
233 Ga0157371_10001079 3300013102 Bacteria 29525
234 Ga0157371_10265140 3300013102 Bacteria 1239
235 Ga0157370_10000232 3300013104 Bacteria 71177
236 Ga0157370_10001387 3300013104 Bacteria 29999
237 Ga0157370_10017785 3300013104 Bacteria 7165
238 Ga0157370_10162790 3300013104 Bacteria 2075
239 Ga0157370_10172680 3300013104 Bacteria 2009
240 Ga0157370_10186063 3300013104 Bacteria 1928
241 Ga0157370_10286963 3300013104 Bacteria 1520
242 Ga0157369_10000227 3300013105 Bacteria 77626
243 Ga0157369_10000826 3300013105 Bacteria 39569
244 Ga0157369_10001538 3300013105 Bacteria 28252
245 Ga0157369_10009515 3300013105 Bacteria 11111
246 Ga0157369_10014799 3300013105 Bacteria 8803
247 Ga0157369_10019327 3300013105 Bacteria 7622
248 Ga0157369_10080347 3300013105 Bacteria 3491
249 Ga0157369_10408205 3300013105 Bacteria 1409
250 Ga0157374_10000014 3300013296 Bacteria 396846
251 Ga0157374_10000487 3300013296 Bacteria 35920
252 Ga0157374_10000590 3300013296 Bacteria 32049
253 Ga0157374_10001044 3300013296 Bacteria 24049
254 Ga0157374_10004448 3300013296 Bacteria 11779
255 Ga0157374_10011016 3300013296 Bacteria 7808
256 Ga0157374_10049239 3300013296 Bacteria 3913
257 Ga0157378_10024663 3300013297 Bacteria 5295
258 Ga0157378_10539178 3300013297 Viruses 1171
259 Ga0163162_10040536 3300013306 Bacteria 4658
260 Ga0157372_10000007 3300013307 Bacteria 340690
261 Ga0157372_10000487 3300013307 Bacteria 43763
262 Ga0157372_10023088 3300013307 Bacteria 6740
263 Ga0157372_10139101 3300013307 Bacteria 2796
264 Ga0157372_10147165 3300013307 Bacteria 2716
265 Ga0157372_10156090 3300013307 Bacteria 2636
266 Ga0157372_10512390 3300013307 Unclassified 1399
267 Ga0157372_10582298 3300013307 Unclassified 1304
268 Ga0157375_10371729 3300013308 Bacteria 1596
269 Ga0157514_114767 3300013874 Unclassified 1312
270 Ga0163163_10000544 3300014325 Bacteria 33219
271 Ga0163163_10098256 3300014325 Bacteria 2948
272 Ga0163163_10124000 3300014325 Bacteria 2619
273 Ga0157380_10032740 3300014326 Viruses 4001
274 Ga0157377_10000096 3300014745 Bacteria 62606
275 Ga0157377_10013649 3300014745 Bacteria 4117
276 Ga0157377_10046720 3300014745 Bacteria 2423
277 Ga0157379_10048717 3300014968 Bacteria 3782
278 Ga0157376_10000001 3300014969 Bacteria 842910
279 Ga0157376_10000223 3300014969 Bacteria 39568
280 Ga0157376_10009574 3300014969 Bacteria 7046
281 Ga0207680_10097395 3300025903 Bacteria 1883
282 Ga0207647_10000087 3300025904 Bacteria 70424
283 Ga0207647_10000364 3300025904 Bacteria 36966
284 Ga0207645_10002614 3300025907 Bacteria 14038
285 Ga0207705_10000010 3300025909 Bacteria 518023
286 Ga0207705_10000019 3300025909 Bacteria 317770
287 Ga0207705_10001259 3300025909 Bacteria 20352
288 Ga0207705_10002528 3300025909 Bacteria 14089
289 Ga0207705_10003091 3300025909 Bacteria 12696
290 Ga0207705_10105430 3300025909 Bacteria 2078
291 Ga0207705_10208873 3300025909 Unclassified 1481
292 Ga0207654_10000002 3300025911 Bacteria 1460142
293 Ga0207654_10006369 3300025911 Bacteria 5936
294 Ga0207707_10083400 3300025912 Bacteria 2791
295 Ga0207707_10103450 3300025912 Bacteria 2489
296 Ga0207695_10000005 3300025913 Bacteria 1196715
297 Ga0207695_10000009 3300025913 Bacteria 1034276
298 Ga0207695_10004142 3300025913 Bacteria 19917
299 Ga0207695_10026439 3300025913 Bacteria 6476
300 Ga0207695_10052099 3300025913 Bacteria 4290
301 Ga0207695_10312989 3300025913 Unclassified 1460
302 Ga0207671_10000003 3300025914 Bacteria 1065461
303 Ga0207671_10000055 3300025914 Bacteria 187621
304 Ga0207671_10070626 3300025914 Unclassified 2604
305 Ga0207671_10125235 3300025914 Unclassified 1967
306 Ga0207671_10136609 3300025914 Bacteria 1885
307 Ga0207660_10025211 3300025917 Bacteria 4034
308 Ga0207660_10296788 3300025917 Bacteria 1286
309 Ga0207657_10000226 3300025919 Bacteria 59005
310 Ga0207657_10000547 3300025919 Bacteria 40133
311 Ga0207657_10001044 3300025919 Bacteria 29324
312 Ga0207657_10003587 3300025919 Bacteria 16565
313 Ga0207657_10015715 3300025919 Bacteria 7321
314 Ga0207657_10016318 3300025919 Bacteria 7165
315 Ga0207657_10077033 3300025919 Bacteria 2812
316 Ga0207649_10003514 3300025920 Bacteria 8566
317 Ga0207649_10013134 3300025920 Bacteria 4620
318 Ga0207652_10002361 3300025921 Bacteria 15958
319 Ga0207652_10007010 3300025921 Bacteria 9085
320 Ga0207652_10010276 3300025921 Bacteria 7533
321 Ga0207652_10135222 3300025921 Bacteria 2201
322 Ga0207652_10481380 3300025921 Bacteria 1118
323 Ga0207681_10416233 3300025923 Unclassified 1088
324 Ga0207694_10001197 3300025924 Bacteria 22503
325 Ga0207694_10002622 3300025924 Bacteria 14591
326 Ga0207694_10097431 3300025924 Bacteria 2327
327 Ga0207694_10099362 3300025924 Bacteria 2305
328 Ga0207687_10000001 3300025927 Bacteria 1130810
329 Ga0207687_10000004 3300025927 Bacteria 841177
330 Ga0207687_10000008 3300025927 Bacteria 497738
331 Ga0207687_10002335 3300025927 Bacteria 12923
332 Ga0207687_10017066 3300025927 Unclassified 4772
333 Ga0207687_10066693 3300025927 Bacteria 2558
334 Ga0207687_10391914 3300025927 Bacteria 1140
335 Ga0207664_10000779 3300025929 Bacteria 21509
336 Ga0207644_10000001 3300025931 Bacteria 1243214
337 Ga0207644_10040907 3300025931 Unclassified 3277
338 Ga0207690_10001999 3300025932 Bacteria 12493
339 Ga0207690_10007260 3300025932 Bacteria 6582
340 Ga0207690_10137643 3300025932 Bacteria 1795
341 Ga0207706_10000464 3300025933 Bacteria 43335
342 Ga0207686_10000001 3300025934 Bacteria 1169580
343 Ga0207686_10041909 3300025934 Bacteria 2795
344 Ga0207686_10090595 3300025934 Bacteria 2018
345 Ga0207709_10000002 3300025935 Bacteria 1171536
346 Ga0207709_10006987 3300025935 Bacteria 6308
347 Ga0207669_10017864 3300025937 Bacteria 3650
348 Ga0207704_10000067 3300025938 Bacteria 66570
349 Ga0207711_10170450 3300025941 Bacteria 1975
350 Ga0207661_10000449 3300025944 Bacteria 26441
351 Ga0207661_10000789 3300025944 Bacteria 20657
352 Ga0207661_10003099 3300025944 Bacteria 11519
353 Ga0207679_10000214 3300025945 Bacteria 45882
354 Ga0207679_10214574 3300025945 Viruses 1616
355 Ga0207679_10412261 3300025945 Unclassified 1191
356 Ga0207667_10000003 3300025949 Bacteria 822935
357 Ga0207667_10000005 3300025949 Bacteria 715503
358 Ga0207667_10000048 3300025949 Bacteria 238293
359 Ga0207667_10001110 3300025949 Bacteria 33935
360 Ga0207667_10001670 3300025949 Bacteria 27952
361 Ga0207667_10005892 3300025949 Bacteria 14926
362 Ga0207667_10023464 3300025949 Bacteria 6793
363 Ga0207667_10120567 3300025949 Bacteria 2703
364 Ga0207667_10312915 3300025949 Unclassified 1604
365 Ga0207651_10004696 3300025960 Bacteria 6932
366 Ga0207712_10167595 3300025961 Bacteria 1713
367 Ga0207668_10255983 3300025972 Bacteria 1424
368 Ga0207658_10000003 3300025986 Bacteria 1151934
369 Ga0207658_10247405 3300025986 Bacteria 1513
370 Ga0207703_10003878 3300026035 Bacteria 12428
371 Ga0207678_10202320 3300026067 Bacteria 1698
372 Ga0207702_10000001 3300026078 Bacteria 895738
373 Ga0207702_10000079 3300026078 Bacteria 110210
374 Ga0207702_10000871 3300026078 Bacteria 31407
375 Ga0207702_10009162 3300026078 Bacteria 8326
376 Ga0207702_10105655 3300026078 Bacteria 2494
377 Ga0207702_10162430 3300026078 Bacteria 2041
378 Ga0207641_10019307 3300026088 Bacteria 5594
379 Ga0207674_10000021 3300026116 Bacteria 161986
380 Ga0207674_10000486 3300026116 Bacteria 52406
381 Ga0207674_10019441 3300026116 Bacteria 7355
382 Ga0207674_10455593 3300026116 Bacteria 1236
383 Ga0207674_10520866 3300026116 Viruses 1148
384 Ga0207683_10002619 3300026121 Bacteria 15711
385 Ga0207683_10033236 3300026121 Bacteria 4480
386 Ga0207698_10000139 3300026142 Bacteria 45792
387 Ga0207698_10006195 3300026142 Bacteria 7444
388 Ga0207698_10032472 3300026142 Bacteria 3782
389 Ga0209966_1000038 3300027695 Bacteria 54987
390 Ga0209813_10000002 3300027866 Bacteria 215993
391 Ga0209813_10000225 3300027866 Bacteria 17310
392 Ga0268266_10002030 3300028379 Bacteria 22496
393 Ga0268265_10086352 3300028380 Unclassified 2493
394 Ga0268264_10060350 3300028381 Bacteria 3178
395 Ga0265337_1000264 3300028556 Bacteria 28474
396 Ga0265337_1002700 3300028556 Bacteria 7967
397 Ga0265337_1003472 3300028556 Bacteria 6822
398 Ga0265337_1010798 3300028556 Bacteria 3178
399 Ga0265326_10000254 3300028558 Bacteria 24825
400 Ga0265326_10000609 3300028558 Bacteria 13416
401 Ga0265326_10003463 3300028558 Bacteria 5161
402 Ga0265326_10007146 3300028558 Bacteria 3433
403 Ga0265319_1004475 3300028563 Bacteria 6911
404 Ga0265319_1004753 3300028563 Bacteria 6654
405 Ga0265334_10000039 3300028573 Bacteria 100608
406 Ga0265334_10000041 3300028573 Bacteria 98258
407 Ga0265334_10003925 3300028573 Bacteria 6698
408 Ga0265334_10004342 3300028573 Bacteria 6308
409 Ga0265334_10009480 3300028573 Bacteria 4118
410 Ga0265318_10002951 3300028577 Bacteria 8816
411 Ga0265318_10043163 3300028577 Unclassified 1709
412 Ga0265322_10001725 3300028654 Bacteria 6930
413 Ga0265322_10029066 3300028654 Bacteria 1579
414 Ga0265336_10000222 3300028666 Bacteria 40224
415 Ga0265336_10001638 3300028666 Bacteria 9922
416 Ga0265336_10003428 3300028666 Bacteria 6213
417 Ga0265336_10005251 3300028666 Bacteria 4799
418 Ga0265338_10000003 3300028800 Bacteria 733923
419 Ga0265338_10000268 3300028800 Bacteria 95143
420 Ga0265338_10000368 3300028800 Bacteria 80896
421 Ga0265338_10000462 3300028800 Bacteria 72395
422 Ga0265338_10000684 3300028800 Bacteria 58206
423 Ga0265338_10001220 3300028800 Bacteria 42488
424 Ga0265338_10001448 3300028800 Bacteria 38508
425 Ga0265338_10001797 3300028800 Bacteria 33738
426 Ga0265338_10004432 3300028800 Bacteria 18965
427 Ga0265338_10005190 3300028800 Bacteria 17105
428 Ga0265338_10005849 3300028800 Bacteria 15874
429 Ga0265338_10010472 3300028800 Bacteria 10861
430 Ga0265338_10011114 3300028800 Bacteria 10436
431 Ga0265338_10012076 3300028800 Bacteria 9877
432 Ga0265338_10013408 3300028800 Bacteria 9259
433 Ga0265338_10016754 3300028800 Bacteria 7942
434 Ga0265338_10066423 3300028800 Bacteria 3121
435 Ga0265338_10334616 3300028800 Bacteria 1092
436 Ga0265324_10001402 3300029957 Bacteria 13897
437 Ga0265324_10003905 3300029957 Bacteria 6938
438 Ga0314311_1014870 3300030733 Bacteria 3006
439 Ga0314311_1186753 3300030733 Bacteria 2182
440 Ga0316179_1028359 3300030734 Bacteria 22140
441 Ga0316179_1084076 3300030734 Bacteria 1987
442 Ga0316183_1053060 3300030742 Bacteria 10073
443 Ga0316183_1176785 3300030742 Bacteria 2849
444 Ga0316181_1123581 3300030744 Bacteria 76132
445 Ga0316181_1247702 3300030744 Unclassified 1164
446 Ga0316182_1253872 3300030745 Bacteria 7685
447 Ga0316182_1303601 3300030745 Bacteria 10332
448 Ga0265332_10001718 3300031238 Bacteria 11935
449 Ga0265332_10055700 3300031238 Bacteria 1695
450 Ga0265328_10007589 3300031239 Unclassified 4516
451 Ga0265320_10002894 3300031240 Bacteria 11772
452 Ga0265320_10008248 3300031240 Bacteria 6385
453 Ga0265325_10007748 3300031241 Bacteria 6398
454 Ga0265340_10001780 3300031247 Bacteria 12290
455 Ga0265339_10013676 3300031249 Bacteria 4915
456 Ga0265331_10002567 3300031250 Bacteria 12211
457 Ga0265331_10071524 3300031250 Unclassified 1622
458 Ga0265327_10000025 3300031251 Bacteria 380054
459 Ga0265327_10001269 3300031251 Bacteria 33287
460 Ga0265327_10006169 3300031251 Bacteria 9682
461 Ga0265327_10010462 3300031251 Bacteria 6519
462 Ga0265316_10000892 3300031344 Bacteria 32693
463 Ga0265316_10141266 3300031344 Bacteria 1808
464 Ga0265313_10009822 3300031595 Bacteria 6163
465 Ga0265313_10010047 3300031595 Bacteria 6056
466 Ga0265313_10046705 3300031595 Bacteria 2101
467 Ga0265342_10012751 3300031712 Bacteria 5678
468 Ga0307516_10000003 3300031730 Bacteria 459377
469 Ga0307405_10007005 3300031731 Bacteria 5602
470 Ga0307406_10000001 3300031901 Bacteria 638191
471 Ga0307406_10001800 3300031901 Bacteria 11712
472 Ga0307412_10016291 3300031911 Bacteria 4426
473 Ga0395899_0000969 3300037312 Bacteria 26598
474 Ga0395899_0091270 3300037312 Bacteria 2207
475 Ga0395899_0109144 3300037312 Bacteria 1991
476 Ga0395900_0000001 3300037418 Bacteria 931146
477 Ga0395900_0000612 3300037418 Bacteria 48582
478 Ga0395900_0002229 3300037418 Bacteria 21616
479 Ga0395900_0038455 3300037418 Bacteria 4931
480 Ga0395900_0040151 3300037418 Bacteria 4823
481 Ga0395900_0122900 3300037418 Bacteria 2662
482 Ga0395898_0000002 3300037466 Bacteria 931013
483 Ga0395898_0004280 3300037466 Bacteria 15658
484 Ga0395898_0008209 3300037466 Bacteria 11042
485 Ga0395898_0085328 3300037466 Bacteria 3043
486 Ga0395898_0332884 3300037466 Bacteria 1448
487 Ga0395905_0003752 3300037471 Bacteria 16096
488 Ga0395905_0026251 3300037471 Bacteria 5492
489 Ga0395905_0224504 3300037471 Bacteria 1758
490 Ga0395901_0000006 3300038443 Bacteria 514112
491 Ga0395901_0000815 3300038443 Bacteria 34538
492 Ga0395901_0001516 3300038443 Bacteria 24117
493 Ga0395901_0025010 3300038443 Bacteria 6129
494 Ga0395901_0030978 3300038443 Bacteria 5513
495 Ga0395901_0070485 3300038443 Unclassified 3642
496 Ga0395901_0091879 3300038443 Bacteria 3177
497 Ga0395901_0206424 3300038443 Bacteria 2058
498 Ga0439445_0000130 3300042004 Bacteria 12977
499 Ga0439432_022498 3300042006 Bacteria 2082
500 Ga0439463_001787 3300042016 Bacteria 5596
501 Ga0450906_000203 3300042145 Bacteria 11291
502 Ga0450909_001048 3300042185 Bacteria 3794
503 Ga0439464_0000001 3300042439 Bacteria 126033
504 Ga0450918_007118 3300042531 Bacteria 1988
505 Ga0451577_0000021 3300042876 Bacteria 438753
506 Ga0466965_0000131 3300044683 Bacteria 21386
507 Ga0453684_0000073 3300044712 Bacteria 438753
508 Ga0495629_0190325 3300046459 Unclassified 1420
509 Ga0495622_0001254 3300046557 Bacteria 13015
510 Ga0495634_0099711 3300046642 Unclassified 1878
511 Ga0495588_0000186 3300046674 Bacteria 68600
512 Ga0495670_0099995 3300046691 Bacteria 1493
513 Ga0495649_0000209 3300046694 Bacteria 51400
514 Ga0495600_0010909 3300046809 Bacteria 5650
515 Ga0495672_0000284 3300047320 Bacteria 70468
516 Ga0495686_0012388 3300047472 Bacteria 5966
517 Ga0495602_0152301 3300048088 Unclassified 1816
518 Ga0496109_0065395 3300048912 Bacteria 3329
519 Ga0496124_0007711 3300048927 Bacteria 11380
520 Ga0496125_0107257 3300048928 Unclassified 2036
521 Ga0496126_0052748 3300048929 Plasmid 3694
522 Ga0501031_0000327 3300049568 Bacteria 27388
523 Ga0501032_0000934 3300049569 Bacteria 23625
524 Ga0501033_0056714 3300049570 Bacteria 2895
525 Ga0501033_0097488 3300049570 Bacteria 2148
526 Ga0501033_0201409 3300049570 Viruses 1422
527 Ga0501034_0000460 3300049571 Bacteria 67352
528 Ga0501034_0006072 3300049571 Bacteria 13043
529 Ga0501034_0015024 3300049571 Bacteria 7963
530 Ga0501034_0214510 3300049571 Bacteria 1879
531 Ga0501034_0406437 3300049571 Bacteria 1284
532 Ga0501036_0016677 3300049572 Bacteria 6134
533 Ga0501036_0021747 3300049572 Bacteria 5392
534 Ga0501037_0000597 3300049573 Bacteria 28178
535 Ga0501037_0007668 3300049573 Bacteria 7900
536 Ga0501037_0207635 3300049573 Bacteria 1382
537 Ga0501038_0007214 3300049574 Bacteria 10269
538 Ga0501038_0056550 3300049574 Bacteria 3369
539 Ga0501039_0046255 3300049575 Bacteria 3362
540 Ga0501039_0263983 3300049575 Bacteria 1353
541 Ga0501042_0057748 3300049578 Bacteria 2769
542 Ga0501043_0000139 3300049579 Bacteria 67517
543 Ga0501046_0000061 3300049580 Bacteria 120487
544 Ga0501046_0278237 3300049580 Bacteria 1226
545 Ga0501047_0000024 3300049581 Bacteria 230397
546 Ga0501047_0004292 3300049581 Bacteria 13413
547 Ga0501048_0000024 3300049582 Bacteria 67807
548 Ga0501048_0010040 3300049582 Bacteria 7084
549 Ga0501070_0101118 3300049586 Bacteria 2384
550 Ga0501073_0050353 3300049589 Bacteria 2919
551 Ga0501080_0000007 3300049742 Bacteria 135749
552 Ga0501080_0079442 3300049742 Bacteria 3050
553 Ga0501080_0143541 3300049742 Bacteria 2207
554 Ga0501080_0467801 3300049742 Bacteria 1129
555 Ga0501083_0032688 3300049744 Bacteria 3567
556 Ga0501083_0098091 3300049744 Bacteria 1933
557 Ga0501035_0000005 3300049822 Bacteria 392980
558 Ga0501035_0000858 3300049822 Unclassified 32412
559 Ga0501035_0004411 3300049822 Bacteria 13357
560 Ga0501044_0001085 3300049823 Unclassified 32466
561 Ga0501044_0009816 3300049823 Bacteria 10409
562 Ga0501044_0307443 3300049823 Bacteria 1513
563 nmdc:mga03683_353_c1 3300050489 Bacteria 13396
564 nmdc:mga03n38_24814_c1 3300050490 Bacteria 2455
565 nmdc:mga03n38_419_c1 3300050490 Bacteria 10518
566 nmdc:mga00v17_21569_c1 3300050491 Bacteria 3704
567 nmdc:mga00v17_301_c1 3300050491 Bacteria 28737
568 nmdc:mga00v17_537_c1 3300050491 Bacteria 21238
569 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
570 nmdc:mga0yw44_192527_c1 3300050492 Bacteria 1345
571 nmdc:mga0yw44_30309_c2 3300050492 Bacteria 2199
572 nmdc:mga0yw44_41899_c1 3300050492 Unclassified 2728
573 nmdc:mga0yw44_61710_c1 3300050492 Unclassified 2301
574 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
575 nmdc:mga0k408_110_c1 3300050493 Bacteria 26135
576 nmdc:mga0k408_1164_c1 3300050493 Bacteria 14396
577 nmdc:mga0k408_1263_c1 3300050493 Bacteria 13769
578 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
579 nmdc:mga0k408_32_c1 3300050493 Bacteria 81544
580 nmdc:mga0k408_40_c1 3300050493 Bacteria 66012
581 nmdc:mga0k408_762_c2 3300050493 Bacteria 12965
582 nmdc:mga06z11_10_c1 3300050494 Bacteria 105982
583 nmdc:mga06z11_290_c1 3300050494 Bacteria 19457
584 nmdc:mga06z11_479_c1 3300050494 Bacteria 14718
585 nmdc:mga04h51_124_c1 3300050495 Bacteria 22571
586 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
587 nmdc:mga07m45_108699_c2 3300050496 Bacteria 1043
588 nmdc:mga07m45_12648_c1 3300050496 Bacteria 4463
589 nmdc:mga07m45_30655_c1 3300050496 Unclassified 2979
590 nmdc:mga07m45_3254_c1 3300050496 Bacteria 7810
591 nmdc:mga07m45_796_c1 3300050496 Bacteria 13571
592 nmdc:mga0qj67_50842_c1 3300050509 Bacteria 3277
593 nmdc:mga08y16_287_c1 3300050511 Bacteria 45722
594 nmdc:mga0sz30_10_c1 3300050516 Bacteria 37628
595 nmdc:mga0sz30_23593_c1 3300050516 Bacteria 2505
596 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
597 Ga0500610_0000009 3300053079 Bacteria 105876
598 Ga0500643_000009 3300053087 Bacteria 444150
599 Ga0500643_000061 3300053087 Bacteria 127538
600 Ga0500643_000157 3300053087 Bacteria 68258
601 Ga0500643_002699 3300053087 Bacteria 8918
602 Ga0500643_004094 3300053087 Bacteria 6718
603 Ga0500643_009300 3300053087 Bacteria 3763
604 Ga0500644_0000137 3300053088 Bacteria 45112
605 Ga0500644_0000937 3300053088 Bacteria 9246
606 Ga0500644_0001197 3300053088 Bacteria 7346
607 Ga0500646_0000102 3300053090 Bacteria 24333
608 Ga0500583_0000119 3300053092 Bacteria 37999
609 Ga0500583_0032555 3300053092 Bacteria 2301
610 Ga0500583_0058538 3300053092 Bacteria 1812
611 Ga0500651_0000043 3300053093 Bacteria 86502
612 Ga0500651_0000682 3300053093 Bacteria 16847
613 Ga0500651_0002680 3300053093 Bacteria 9479
614 Ga0500651_0123256 3300053093 Unclassified 1572
615 Ga0500566_0000001 3300053094 Bacteria 1101031
616 Ga0500650_0000003 3300053098 Bacteria 164144
617 Ga0500555_000001 3300053103 Bacteria 1353713
618 Ga0500555_000002 3300053103 Bacteria 1314346
619 Ga0500562_000002 3300053108 Bacteria 977234
620 Ga0500562_006712 3300053108 Bacteria 2901
621 Ga0500593_000001 3300053117 Bacteria 784404
622 Ga0500594_0000001 3300053118 Bacteria 1178472
623 Ga0500594_0000019 3300053118 Bacteria 56688
624 Ga0500594_0000028 3300053118 Bacteria 50845
625 Ga0500614_000001 3300053123 Bacteria 1274484
626 Ga0500614_003637 3300053123 Bacteria 3309
627 Ga0500628_000005 3300053129 Bacteria 201423
628 Ga0500642_0000792 3300053130 Bacteria 9273
629 Ga0500652_000012 3300053131 Bacteria 155076
630 Ga0500655_000190 3300053133 Bacteria 14921
631 Ga0500655_000280 3300053133 Bacteria 11753
632 Ga0500559_0032147 3300053136 Unclassified 2254
633 Ga0500561_0000002 3300053137 Bacteria 394147
634 Ga0500577_0000913 3300053142 Bacteria 7645
635 Ga0500577_0001732 3300053142 Bacteria 5594
636 Ga0500577_0003508 3300053142 Bacteria 4075
637 Ga0500579_000692 3300053143 Bacteria 19430
638 Ga0500589_000003 3300053147 Bacteria 220717
639 Ga0500604_0069206 3300053151 Bacteria 1122
640 Ga0500616_0000005 3300053153 Bacteria 961725
641 Ga0500616_0000067 3300053153 Bacteria 236311
642 Ga0500649_000006 3300053722 Bacteria 116211
643 Ga0500570_000001 3300053724 Bacteria 243552
644 Ga0500570_002444 3300053724 Bacteria 9237
645 Ga0500611_000379 3300053727 Bacteria 4533
646 Ga0501084_0167366 3300054114 Unclassified 1855
647 Ga0501082_0013374 3300060353 Bacteria 7056
648 Ga0070680_100005121
649 MBSR1b_contig_3495855
650 JGI24741J21665_1001677
651 JGI24741J21665_1001833
652 JGI24740J21852_10006473
653 JGI24740J21852_10007043
654 JGI24740J21852_10016764
655 JGI24739J22299_10002568
656 JGI24737J22298_10000003
657 JGI24737J22298_10000111
658 JGI24743J22301_10000261
659 JGI24735J21928_10000022
660 JGI24735J21928_10000049
661 JGI24738J21930_10003919
662 JGI24738J21930_10004073
663 JGI24742J22300_10000001
664 rootH2_10000311
665 rootH2_10004334
666 rootL2_10021337
667 rootH1_10001727
668 rootH1_10008297
669 rootH1_10159927
670 rootH1_10270649
671 JGI26128J50194_1000010
672 Ga0065715_10125503
673 Ga0070658_10000009
674 Ga0070658_10000076
675 Ga0070658_10000336
676 Ga0070658_10000660
677 Ga0070658_10002074
678 Ga0070658_10004103
679 Ga0070658_10009224
680 Ga0070658_10104220
681 Ga0070658_10142711
682 Ga0070658_10266400
683 Ga0070676_10002768
684 Ga0070676_10005817
685 Ga0070683_100001058
686 Ga0070683_100001106
687 Ga0070683_100002025
688 Ga0070683_100308284
689 Ga0070690_100001938
690 Ga0070666_10113845
691 Ga0070666_10153450
692 Ga0070680_100007110
693 Ga0070680_100015551
694 Ga0070680_100051485
695 Ga0070682_100115705
696 Ga0070660_100000119
697 Ga0070660_100003520
698 Ga0070660_100004938
699 Ga0070660_100006526
700 Ga0070660_100008797
701 Ga0070660_100068613
702 Ga0070691_10000916
703 Ga0070661_100010783
704 Ga0070661_100039905
705 Ga0070692_10042836
706 Ga0070668_100042546
707 Ga0070668_100158134
708 Ga0070669_100461091
709 Ga0070675_100041801
710 Ga0070675_100355771
711 Ga0070671_100000001
712 Ga0070671_100083437
713 Ga0070674_100001494
714 Ga0070674_100015527
715 Ga0070673_100008235
716 Ga0070673_100276157
717 Ga0070659_100000780
718 Ga0070659_100003167
719 Ga0070659_100060477
720 Ga0070659_100118898
721 Ga0070667_100000001
722 Ga0070667_100132915
723 Ga0070714_100000871
724 Ga0070713_100381523
725 Ga0070663_100033373
726 Ga0070663_100234612
727 Ga0070678_100000753
728 Ga0070678_100010185
729 Ga0070662_100011590
730 Ga0070681_10037793
731 Ga0070681_10210323
732 Ga0070681_10303727
733 Ga0068867_100022709
734 Ga0070685_10001093
735 Ga0070685_10002310
736 Ga0070679_100001517
737 Ga0070679_100003722
738 Ga0070679_100005533
739 Ga0070679_100021096
740 Ga0070679_100559472
741 Ga0070684_100000860
742 Ga0070684_100007560
743 Ga0070684_100024870
744 Ga0070684_100028413
745 Ga0070684_100075791
746 Ga0068853_100018528
747 Ga0068853_100175605
748 Ga0068853_100176886
749 Ga0070686_100007189
750 Ga0070686_100017663
751 Ga0070665_100130965
752 Ga0070665_100799270
753 Ga0068855_100000001
754 Ga0068855_100000002
755 Ga0068855_100000017
756 Ga0068855_100002485
757 Ga0068855_100006018
758 Ga0068855_100011195
759 Ga0068855_100025370
760 Ga0068855_100079325
761 Ga0070664_100000165
762 Ga0070664_100153013
763 Ga0070664_100257093
764 Ga0068857_100000001
765 Ga0068857_100000266
766 Ga0068857_100163368
767 Ga0068856_100000002
768 Ga0068856_100000441
769 Ga0068856_100001703
770 Ga0068856_100002784
771 Ga0068856_100036064
772 Ga0068856_100045294
773 Ga0068856_100119495
774 Ga0068852_100000173
775 Ga0068852_100037934
776 Ga0068864_100530073
777 Ga0068863_100029972
778 Ga0068863_100121081
779 Ga0068858_100014703
780 Ga0068860_100021321
781 Ga0081455_10000020
782 Ga0081539_10013697
783 Ga0075365_10000007
784 Ga0075365_10001244
785 Ga0075365_10025938
786 Ga0075368_10000090
787 Ga0075368_10000174
788 Ga0075363_100000147
789 Ga0075363_100000352
790 Ga0075364_10000111
791 Ga0075364_10000937
792 Ga0075364_10013165
793 Ga0075367_10000296
794 Ga0075367_10000339
795 Ga0075367_10029637
796 Ga0075369_10000004
797 Ga0075369_10000031
798 Ga0075369_10003342
799 Ga0075366_10000003
800 Ga0075366_10000010
801 Ga0075366_10000096
802 Ga0075366_10000204
803 Ga0075366_10000978
804 Ga0075366_10001219
805 Ga0075366_10003860
806 Ga0097621_100000001
807 Ga0097621_100000052
808 Ga0097621_100035651
809 Ga0097621_100162187
810 Ga0075370_10000990
811 Ga0075370_10001566
812 Ga0075370_10031451
813 Ga0075370_10144555
814 Ga0068871_100000001
815 Ga0068871_100000006
816 Ga0068871_100005288
817 Ga0068871_100442801
818 Ga0075428_100007820
819 Ga0075428_100099923
820 Ga0075430_100060256
821 Ga0068865_100000106
822 Ga0105240_10000003
823 Ga0105240_10000030
824 Ga0105240_10000886
825 Ga0105240_10005930
826 Ga0105240_10023635
827 Ga0105240_10045972
828 Ga0105240_10291984
829 Ga0111539_10000377
830 Ga0105245_10000001
831 Ga0105245_10000096
832 Ga0105245_10000127
833 Ga0105245_10030451
834 Ga0105245_10054517
835 Ga0105245_10165200
836 Ga0105245_10209908
837 Ga0105245_10574204
838 Ga0105243_10000001
839 Ga0105243_10006155
840 Ga0105241_10000009
841 Ga0105241_10001013
842 Ga0105241_10016697
843 Ga0105241_10278601
844 Ga0105242_10000001
845 Ga0105242_10017653
846 Ga0105242_10022217
847 Ga0105242_10158997
848 Ga0105248_10019320
849 Ga0105248_10032935
850 Ga0105237_10000001
851 Ga0105237_10069677
852 Ga0105237_10091215
853 Ga0105237_10223307
854 Ga0105237_10378437
855 Ga0105238_10000462
856 Ga0105238_10000614
857 Ga0105238_10041162
858 Ga0105238_10145740
859 Ga0105249_10016080
860 Ga0105249_10032436
861 Ga0105032_100012
862 Ga0105029_100012
863 Ga0105033_102652
864 Ga0105030_103048
865 Ga0105028_100146
866 Ga0105239_10000481
867 Ga0105239_10001159
868 Ga0105239_10008373
869 Ga0105239_10009209
870 Ga0105239_10009667
871 Ga0105246_10000266
872 Ga0105246_10000412
873 Ga0105246_10018155
874 Ga0157373_10000092
875 Ga0157373_10011488
876 Ga0157373_10013776
877 Ga0157373_10013808
878 Ga0157373_10039112
879 Ga0157371_10000207
880 Ga0157371_10001079
881 Ga0157371_10265140
882 Ga0157370_10000232
883 Ga0157370_10001387
884 Ga0157370_10017785
885 Ga0157370_10162790
886 Ga0157370_10172680
887 Ga0157370_10186063
888 Ga0157370_10286963
889 Ga0157369_10000227
890 Ga0157369_10000826
891 Ga0157369_10001538
892 Ga0157369_10009515
893 Ga0157369_10014799
894 Ga0157369_10019327
895 Ga0157369_10080347
896 Ga0157369_10408205
897 Ga0157374_10000014
898 Ga0157374_10000487
899 Ga0157374_10000590
900 Ga0157374_10001044
901 Ga0157374_10004448
902 Ga0157374_10011016
903 Ga0157374_10049239
904 Ga0157378_10024663
905 Ga0157378_10539178
906 Ga0163162_10040536
907 Ga0157372_10000007
908 Ga0157372_10000487
909 Ga0157372_10023088
910 Ga0157372_10139101
911 Ga0157372_10147165
912 Ga0157372_10156090
913 Ga0157372_10512390
914 Ga0157372_10582298
915 Ga0157375_10371729
916 Ga0157514_114767
917 Ga0163163_10000544
918 Ga0163163_10098256
919 Ga0163163_10124000
920 Ga0157380_10032740
921 Ga0157377_10000096
922 Ga0157377_10013649
923 Ga0157377_10046720
924 Ga0157379_10048717
925 Ga0157376_10000001
926 Ga0157376_10000223
927 Ga0157376_10009574
928 Ga0207680_10097395
929 Ga0207647_10000087
930 Ga0207647_10000364
931 Ga0207645_10002614
932 Ga0207705_10000010
933 Ga0207705_10000019
934 Ga0207705_10001259
935 Ga0207705_10002528
936 Ga0207705_10003091
937 Ga0207705_10105430
938 Ga0207705_10208873
939 Ga0207654_10000002
940 Ga0207654_10006369
941 Ga0207707_10083400
942 Ga0207707_10103450
943 Ga0207695_10000005
944 Ga0207695_10000009
945 Ga0207695_10004142
946 Ga0207695_10026439
947 Ga0207695_10052099
948 Ga0207695_10312989
949 Ga0207671_10000003
950 Ga0207671_10000055
951 Ga0207671_10070626
952 Ga0207671_10125235
953 Ga0207671_10136609
954 Ga0207660_10025211
955 Ga0207660_10296788
956 Ga0207657_10000226
957 Ga0207657_10000547
958 Ga0207657_10001044
959 Ga0207657_10003587
960 Ga0207657_10015715
961 Ga0207657_10016318
962 Ga0207657_10077033
963 Ga0207649_10003514
964 Ga0207649_10013134
965 Ga0207652_10002361
966 Ga0207652_10007010
967 Ga0207652_10010276
968 Ga0207652_10135222
969 Ga0207652_10481380
970 Ga0207681_10416233
971 Ga0207694_10001197
972 Ga0207694_10002622
973 Ga0207694_10097431
974 Ga0207694_10099362
975 Ga0207687_10000001
976 Ga0207687_10000004
977 Ga0207687_10000008
978 Ga0207687_10002335
979 Ga0207687_10017066
980 Ga0207687_10066693
981 Ga0207687_10391914
982 Ga0207664_10000779
983 Ga0207644_10000001
984 Ga0207644_10040907
985 Ga0207690_10001999
986 Ga0207690_10007260
987 Ga0207690_10137643
988 Ga0207706_10000464
989 Ga0207686_10000001
990 Ga0207686_10041909
991 Ga0207686_10090595
992 Ga0207709_10000002
993 Ga0207709_10006987
994 Ga0207669_10017864
995 Ga0207704_10000067
996 Ga0207711_10170450
997 Ga0207661_10000449
998 Ga0207661_10000789
999 Ga0207661_10003099
1000 Ga0207679_10000214
1001 Ga0207679_10214574
1002 Ga0207679_10412261
1003 Ga0207667_10000003
1004 Ga0207667_10000005
1005 Ga0207667_10000048
1006 Ga0207667_10001110
1007 Ga0207667_10001670
1008 Ga0207667_10005892
1009 Ga0207667_10023464
1010 Ga0207667_10120567
1011 Ga0207667_10312915
1012 Ga0207651_10004696
1013 Ga0207712_10167595
1014 Ga0207668_10255983
1015 Ga0207658_10000003
1016 Ga0207658_10247405
1017 Ga0207703_10003878
1018 Ga0207678_10202320
1019 Ga0207702_10000001
1020 Ga0207702_10000079
1021 Ga0207702_10000871
1022 Ga0207702_10009162
1023 Ga0207702_10105655
1024 Ga0207702_10162430
1025 Ga0207641_10019307
1026 Ga0207674_10000021
1027 Ga0207674_10000486
1028 Ga0207674_10019441
1029 Ga0207674_10455593
1030 Ga0207674_10520866
1031 Ga0207683_10002619
1032 Ga0207683_10033236
1033 Ga0207698_10000139
1034 Ga0207698_10006195
1035 Ga0207698_10032472
1036 Ga0209966_1000038
1037 Ga0209813_10000002
1038 Ga0209813_10000225
1039 Ga0268266_10002030
1040 Ga0268265_10086352
1041 Ga0268264_10060350
1042 Ga0265337_1000264
1043 Ga0265337_1002700
1044 Ga0265337_1003472
1045 Ga0265337_1010798
1046 Ga0265326_10000254
1047 Ga0265326_10000609
1048 Ga0265326_10003463
1049 Ga0265326_10007146
1050 Ga0265319_1004475
1051 Ga0265319_1004753
1052 Ga0265334_10000039
1053 Ga0265334_10000041
1054 Ga0265334_10003925
1055 Ga0265334_10004342
1056 Ga0265334_10009480
1057 Ga0265318_10002951
1058 Ga0265318_10043163
1059 Ga0265322_10001725
1060 Ga0265322_10029066
1061 Ga0265336_10000222
1062 Ga0265336_10001638
1063 Ga0265336_10003428
1064 Ga0265336_10005251
1065 Ga0265338_10000003
1066 Ga0265338_10000268
1067 Ga0265338_10000368
1068 Ga0265338_10000462
1069 Ga0265338_10000684
1070 Ga0265338_10001220
1071 Ga0265338_10001448
1072 Ga0265338_10001797
1073 Ga0265338_10004432
1074 Ga0265338_10005190
1075 Ga0265338_10005849
1076 Ga0265338_10010472
1077 Ga0265338_10011114
1078 Ga0265338_10012076
1079 Ga0265338_10013408
1080 Ga0265338_10016754
1081 Ga0265338_10066423
1082 Ga0265338_10334616
1083 Ga0265324_10001402
1084 Ga0265324_10003905
1085 Ga0314311_1014870
1086 Ga0314311_1186753
1087 Ga0316179_1028359
1088 Ga0316179_1084076
1089 Ga0316183_1053060
1090 Ga0316183_1176785
1091 Ga0316181_1123581
1092 Ga0316181_1247702
1093 Ga0316182_1253872
1094 Ga0316182_1303601
1095 Ga0265332_10001718
1096 Ga0265332_10055700
1097 Ga0265328_10007589
1098 Ga0265320_10002894
1099 Ga0265320_10008248
1100 Ga0265325_10007748
1101 Ga0265340_10001780
1102 Ga0265339_10013676
1103 Ga0265331_10002567
1104 Ga0265331_10071524
1105 Ga0265327_10000025
1106 Ga0265327_10001269
1107 Ga0265327_10006169
1108 Ga0265327_10010462
1109 Ga0265316_10000892
1110 Ga0265316_10141266
1111 Ga0265313_10009822
1112 Ga0265313_10010047
1113 Ga0265313_10046705
1114 Ga0265342_10012751
1115 Ga0307516_10000003
1116 Ga0307405_10007005
1117 Ga0307406_10000001
1118 Ga0307406_10001800
1119 Ga0307412_10016291
1120 Ga0395899_0000969
1121 Ga0395899_0091270
1122 Ga0395899_0109144
1123 Ga0395900_0000001
1124 Ga0395900_0000612
1125 Ga0395900_0002229
1126 Ga0395900_0038455
1127 Ga0395900_0040151
1128 Ga0395900_0122900
1129 Ga0395898_0000002
1130 Ga0395898_0004280
1131 Ga0395898_0008209
1132 Ga0395898_0085328
1133 Ga0395898_0332884
1134 Ga0395905_0003752
1135 Ga0395905_0026251
1136 Ga0395905_0224504
1137 Ga0395901_0000006
1138 Ga0395901_0000815
1139 Ga0395901_0001516
1140 Ga0395901_0025010
1141 Ga0395901_0030978
1142 Ga0395901_0070485
1143 Ga0395901_0091879
1144 Ga0395901_0206424
1145 Ga0439445_0000130
1146 Ga0439432_022498
1147 Ga0439463_001787
1148 Ga0450906_000203
1149 Ga0450909_001048
1150 Ga0439464_0000001
1151 Ga0450918_007118
1152 Ga0451577_0000021
1153 Ga0466965_0000131
1154 Ga0453684_0000073
1155 Ga0495629_0190325
1156 Ga0495622_0001254
1157 Ga0495634_0099711
1158 Ga0495588_0000186
1159 Ga0495670_0099995
1160 Ga0495649_0000209
1161 Ga0495600_0010909
1162 Ga0495672_0000284
1163 Ga0495686_0012388
1164 Ga0495602_0152301
1165 Ga0496109_0065395
1166 Ga0496124_0007711
1167 Ga0496125_0107257
1168 Ga0496126_0052748
1169 Ga0501031_0000327
1170 Ga0501032_0000934
1171 Ga0501033_0056714
1172 Ga0501033_0097488
1173 Ga0501033_0201409
1174 Ga0501034_0000460
1175 Ga0501034_0006072
1176 Ga0501034_0015024
1177 Ga0501034_0214510
1178 Ga0501034_0406437
1179 Ga0501036_0016677
1180 Ga0501036_0021747
1181 Ga0501037_0000597
1182 Ga0501037_0007668
1183 Ga0501037_0207635
1184 Ga0501038_0007214
1185 Ga0501038_0056550
1186 Ga0501039_0046255
1187 Ga0501039_0263983
1188 Ga0501042_0057748
1189 Ga0501043_0000139
1190 Ga0501046_0000061
1191 Ga0501046_0278237
1192 Ga0501047_0000024
1193 Ga0501047_0004292
1194 Ga0501048_0000024
1195 Ga0501048_0010040
1196 Ga0501070_0101118
1197 Ga0501073_0050353
1198 Ga0501080_0000007
1199 Ga0501080_0079442
1200 Ga0501080_0143541
1201 Ga0501080_0467801
1202 Ga0501083_0032688
1203 Ga0501083_0098091
1204 Ga0501035_0000005
1205 Ga0501035_0000858
1206 Ga0501035_0004411
1207 Ga0501044_0001085
1208 Ga0501044_0009816
1209 Ga0501044_0307443
1210 nmdc:mga03683_353_c1
1211 nmdc:mga03n38_24814_c1
1212 nmdc:mga03n38_419_c1
1213 nmdc:mga00v17_21569_c1
1214 nmdc:mga00v17_301_c1
1215 nmdc:mga00v17_537_c1
1216 nmdc:mga0yw44_11_c1
1217 nmdc:mga0yw44_192527_c1
1218 nmdc:mga0yw44_30309_c2
1219 nmdc:mga0yw44_41899_c1
1220 nmdc:mga0yw44_61710_c1
1221 nmdc:mga0yw44_7_c1
1222 nmdc:mga0k408_110_c1
1223 nmdc:mga0k408_1164_c1
1224 nmdc:mga0k408_1263_c1
1225 nmdc:mga0k408_1_c1
1226 nmdc:mga0k408_32_c1
1227 nmdc:mga0k408_40_c1
1228 nmdc:mga0k408_762_c2
1229 nmdc:mga06z11_10_c1
1230 nmdc:mga06z11_290_c1
1231 nmdc:mga06z11_479_c1
1232 nmdc:mga04h51_124_c1
1233 nmdc:mga04h51_2_c1
1234 nmdc:mga07m45_108699_c2
1235 nmdc:mga07m45_12648_c1
1236 nmdc:mga07m45_30655_c1
1237 nmdc:mga07m45_3254_c1
1238 nmdc:mga07m45_796_c1
1239 nmdc:mga0qj67_50842_c1
1240 nmdc:mga08y16_287_c1
1241 nmdc:mga0sz30_10_c1
1242 nmdc:mga0sz30_23593_c1
1243 nmdc:mga0sz30_2_c1
1244 Ga0500610_0000009
1245 Ga0500643_000009
1246 Ga0500643_000061
1247 Ga0500643_000157
1248 Ga0500643_002699
1249 Ga0500643_004094
1250 Ga0500643_009300
1251 Ga0500644_0000137
1252 Ga0500644_0000937
1253 Ga0500644_0001197
1254 Ga0500646_0000102
1255 Ga0500583_0000119
1256 Ga0500583_0032555
1257 Ga0500583_0058538
1258 Ga0500651_0000043
1259 Ga0500651_0000682
1260 Ga0500651_0002680
1261 Ga0500651_0123256
1262 Ga0500566_0000001
1263 Ga0500650_0000003
1264 Ga0500555_000001
1265 Ga0500555_000002
1266 Ga0500562_000002
1267 Ga0500562_006712
1268 Ga0500593_000001
1269 Ga0500594_0000001
1270 Ga0500594_0000019
1271 Ga0500594_0000028
1272 Ga0500614_000001
1273 Ga0500614_003637
1274 Ga0500628_000005
1275 Ga0500642_0000792
1276 Ga0500652_000012
1277 Ga0500655_000190
1278 Ga0500655_000280
1279 Ga0500559_0032147
1280 Ga0500561_0000002
1281 Ga0500577_0000913
1282 Ga0500577_0001732
1283 Ga0500577_0003508
1284 Ga0500579_000692
1285 Ga0500589_000003
1286 Ga0500604_0069206
1287 Ga0500616_0000005
1288 Ga0500616_0000067
1289 Ga0500649_000006
1290 Ga0500570_000001
1291 Ga0500570_002444
1292 Ga0500611_000379
1293 Ga0501084_0167366
1294 Ga0501082_0013374

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

166

344

0.97

PF13102

Phage_int_SAM_5

Phage integrase SAM-like domain

61

155

0.9

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

61

146

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nkh-assembly1.cif.gz_A crystal structure of integrase from mrsa strain staphylococcus aureus 0.7751 113 307
3nkh-assembly1.cif.gz_B crystal structure of integrase from mrsa strain staphylococcus aureus 0.7621 117 307
2kob-assembly1.cif.gz_A solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a 0.7443 12 120
6en0-assembly1.cif.gz_A structure of the tn1549 transposon integrase (aa 82-397) in complex with circular intermediate dna (ci5-dna) 0.7132 8 298
6emy-assembly1.cif.gz_A structure of the tn1549 transposon integrase (aa 82-397, y379f) in complex with transposon right end dna 0.7113 9 301
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9183 13 97 1.10.150.130
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8567 119 299 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8554 117 299 1.10.443.10
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8421 117 299 1.10.443.10
af_P9WF33_5_106_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8405 13 97 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A7V4H0X7-F1-model_v4 Tyr recombinase domain-containing protein 0.9521 119 200 GO:0003677
GO:0006310
GO:0015074
AF-A0A350R3F4-F1-model_v4 Integrase 0.9129 124 283 GO:0003677
GO:0006310
GO:0015074
AF-A0A136KHS5-F1-model_v4 Tyrosine recombinase XerD 0.9114 9 279 GO:0003677
GO:0006310
GO:0015074
AF-X0VK10-F1-model_v4 Tyr recombinase domain-containing protein 0.9046 106 211 GO:0003677
GO:0006310
GO:0015074
AF-A0A7T5UNS9-F1-model_v4 Tyrosine-type recombinase/integrase 0.8873 9 252 GO:0003677
GO:0004519
GO:0006310
GO:0015074
GO:0016539

Map