F472256
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 262 | 1294 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100005121|Ga0070680_1000051215 |
| Length | 357 |
| Sequence | MWCQASCDHNQPIAPELNVVPRSRFLSCLGANKLPGRLAEKLSKTHYGAYNVTMQFAKAKTDFLEYLEIEQNRSQKTIQNYDHYLTRLIDFAGDIKVSDIDQELIRKWRLWLNRLGTNTSDELGKTTQNYHLIALRGFLKFCAKRNIIALTADKVELARTRRSQVTFLSEDELARLFAEPDTNTLAGLRDRAILELLFSSGLRVSELVGLDRDHINLKRREFMVRGKGQKDRPIFISPEAASWIEQYLAKRDDTTRPLFIRYSGNKQIDRSGNFHRLTARSVQRLVARYALLAGITKHVSPHTLRHSFATDLLMNGADLRSVQALLGHSNIATTQIYTHVTDPHLRAVHEKFHRHSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 82 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 83 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 84 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 85 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 156 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 157 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 158 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 159 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 183 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 184 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 185 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 186 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 225 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 228 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 229 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 230 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 231 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 235 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 236 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 237 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 238 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 239 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 240 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 241 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 242 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 243 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 244 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 245 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 246 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 247 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 248 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 249 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 250 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 251 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 252 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 253 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 254 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 255 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 256 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 257 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 258 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 259 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 260 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 261 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17 |
| Nodule | 0 |
| Rhizoplane | 0.15 |
| Rhizosphere | 81.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100005121 | 3300005336 | Bacteria | 9900 |
| 2 | MBSR1b_contig_3495855 | 2162886012 | Unclassified | 1857 |
| 3 | JGI24741J21665_1001677 | 3300001915 | Bacteria | 6149 |
| 4 | JGI24741J21665_1001833 | 3300001915 | Bacteria | 5814 |
| 5 | JGI24740J21852_10006473 | 3300001979 | Bacteria | 4845 |
| 6 | JGI24740J21852_10007043 | 3300001979 | Bacteria | 4609 |
| 7 | JGI24740J21852_10016764 | 3300001979 | Bacteria | 2638 |
| 8 | JGI24739J22299_10002568 | 3300001989 | Bacteria | 7001 |
| 9 | JGI24737J22298_10000003 | 3300001990 | Bacteria | 67128 |
| 10 | JGI24737J22298_10000111 | 3300001990 | Bacteria | 24854 |
| 11 | JGI24743J22301_10000261 | 3300001991 | Bacteria | 5658 |
| 12 | JGI24735J21928_10000022 | 3300002067 | Bacteria | 97715 |
| 13 | JGI24735J21928_10000049 | 3300002067 | Bacteria | 51076 |
| 14 | JGI24738J21930_10003919 | 3300002075 | Bacteria | 3710 |
| 15 | JGI24738J21930_10004073 | 3300002075 | Bacteria | 3615 |
| 16 | JGI24742J22300_10000001 | 3300002244 | Bacteria | 61784 |
| 17 | rootH2_10000311 | 3300003320 | Bacteria | 277677 |
| 18 | rootH2_10004334 | 3300003320 | Bacteria | 85448 |
| 19 | rootL2_10021337 | 3300003322 | Bacteria | 11713 |
| 20 | rootH1_10001727 | 3300003323 | Bacteria | 102468 |
| 21 | rootH1_10008297 | 3300003323 | Bacteria | 2071 |
| 22 | rootH1_10159927 | 3300003323 | Bacteria | 1567 |
| 23 | rootH1_10270649 | 3300003323 | Bacteria | 7383 |
| 24 | JGI26128J50194_1000010 | 3300003347 | Bacteria | 5835 |
| 25 | Ga0065715_10125503 | 3300005293 | Unclassified | 2129 |
| 26 | Ga0070658_10000009 | 3300005327 | Bacteria | 319868 |
| 27 | Ga0070658_10000076 | 3300005327 | Bacteria | 95016 |
| 28 | Ga0070658_10000336 | 3300005327 | Bacteria | 40548 |
| 29 | Ga0070658_10000660 | 3300005327 | Bacteria | 29772 |
| 30 | Ga0070658_10002074 | 3300005327 | Bacteria | 16820 |
| 31 | Ga0070658_10004103 | 3300005327 | Bacteria | 11936 |
| 32 | Ga0070658_10009224 | 3300005327 | Bacteria | 7933 |
| 33 | Ga0070658_10104220 | 3300005327 | Bacteria | 2346 |
| 34 | Ga0070658_10142711 | 3300005327 | Bacteria | 2001 |
| 35 | Ga0070658_10266400 | 3300005327 | Unclassified | 1456 |
| 36 | Ga0070676_10002768 | 3300005328 | Bacteria | 9061 |
| 37 | Ga0070676_10005817 | 3300005328 | Bacteria | 6575 |
| 38 | Ga0070683_100001058 | 3300005329 | Bacteria | 20652 |
| 39 | Ga0070683_100001106 | 3300005329 | Bacteria | 20343 |
| 40 | Ga0070683_100002025 | 3300005329 | Bacteria | 15933 |
| 41 | Ga0070683_100308284 | 3300005329 | Bacteria | 1506 |
| 42 | Ga0070690_100001938 | 3300005330 | Bacteria | 11006 |
| 43 | Ga0070666_10113845 | 3300005335 | Bacteria | 1872 |
| 44 | Ga0070666_10153450 | 3300005335 | Unclassified | 1607 |
| 45 | Ga0070680_100007110 | 3300005336 | Bacteria | 8529 |
| 46 | Ga0070680_100015551 | 3300005336 | Bacteria | 5970 |
| 47 | Ga0070680_100051485 | 3300005336 | Bacteria | 3360 |
| 48 | Ga0070682_100115705 | 3300005337 | Bacteria | 1793 |
| 49 | Ga0070660_100000119 | 3300005339 | Bacteria | 49566 |
| 50 | Ga0070660_100003520 | 3300005339 | Bacteria | 10794 |
| 51 | Ga0070660_100004938 | 3300005339 | Bacteria | 9226 |
| 52 | Ga0070660_100006526 | 3300005339 | Bacteria | 8094 |
| 53 | Ga0070660_100008797 | 3300005339 | Bacteria | 7073 |
| 54 | Ga0070660_100068613 | 3300005339 | Bacteria | 2764 |
| 55 | Ga0070691_10000916 | 3300005341 | Bacteria | 11964 |
| 56 | Ga0070661_100010783 | 3300005344 | Bacteria | 6363 |
| 57 | Ga0070661_100039905 | 3300005344 | Bacteria | 3422 |
| 58 | Ga0070692_10042836 | 3300005345 | Unclassified | 2326 |
| 59 | Ga0070668_100042546 | 3300005347 | Unclassified | 3482 |
| 60 | Ga0070668_100158134 | 3300005347 | Bacteria | 1837 |
| 61 | Ga0070669_100461091 | 3300005353 | Unclassified | 1049 |
| 62 | Ga0070675_100041801 | 3300005354 | Bacteria | 3745 |
| 63 | Ga0070675_100355771 | 3300005354 | Bacteria | 1299 |
| 64 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 65 | Ga0070671_100083437 | 3300005355 | Unclassified | 2672 |
| 66 | Ga0070674_100001494 | 3300005356 | Bacteria | 12457 |
| 67 | Ga0070674_100015527 | 3300005356 | Bacteria | 4755 |
| 68 | Ga0070673_100008235 | 3300005364 | Bacteria | 6924 |
| 69 | Ga0070673_100276157 | 3300005364 | Viruses | 1472 |
| 70 | Ga0070659_100000780 | 3300005366 | Bacteria | 23122 |
| 71 | Ga0070659_100003167 | 3300005366 | Bacteria | 11720 |
| 72 | Ga0070659_100060477 | 3300005366 | Bacteria | 2992 |
| 73 | Ga0070659_100118898 | 3300005366 | Bacteria | 2138 |
| 74 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 75 | Ga0070667_100132915 | 3300005367 | Bacteria | 2173 |
| 76 | Ga0070714_100000871 | 3300005435 | Bacteria | 21405 |
| 77 | Ga0070713_100381523 | 3300005436 | Bacteria | 1313 |
| 78 | Ga0070663_100033373 | 3300005455 | Bacteria | 3556 |
| 79 | Ga0070663_100234612 | 3300005455 | Viruses | 1446 |
| 80 | Ga0070678_100000753 | 3300005456 | Bacteria | 16225 |
| 81 | Ga0070678_100010185 | 3300005456 | Bacteria | 5730 |
| 82 | Ga0070662_100011590 | 3300005457 | Bacteria | 5818 |
| 83 | Ga0070681_10037793 | 3300005458 | Bacteria | 4842 |
| 84 | Ga0070681_10210323 | 3300005458 | Bacteria | 1861 |
| 85 | Ga0070681_10303727 | 3300005458 | Viruses | 1505 |
| 86 | Ga0068867_100022709 | 3300005459 | Bacteria | 4487 |
| 87 | Ga0070685_10001093 | 3300005466 | Bacteria | 14515 |
| 88 | Ga0070685_10002310 | 3300005466 | Bacteria | 9838 |
| 89 | Ga0070679_100001517 | 3300005530 | Bacteria | 20675 |
| 90 | Ga0070679_100003722 | 3300005530 | Bacteria | 13977 |
| 91 | Ga0070679_100005533 | 3300005530 | Bacteria | 11703 |
| 92 | Ga0070679_100021096 | 3300005530 | Bacteria | 6357 |
| 93 | Ga0070679_100559472 | 3300005530 | Bacteria | 1087 |
| 94 | Ga0070684_100000860 | 3300005535 | Bacteria | 21450 |
| 95 | Ga0070684_100007560 | 3300005535 | Bacteria | 8460 |
| 96 | Ga0070684_100024870 | 3300005535 | Bacteria | 5026 |
| 97 | Ga0070684_100028413 | 3300005535 | Unclassified | 4732 |
| 98 | Ga0070684_100075791 | 3300005535 | Bacteria | 2968 |
| 99 | Ga0068853_100018528 | 3300005539 | Bacteria | 5765 |
| 100 | Ga0068853_100175605 | 3300005539 | Unclassified | 1940 |
| 101 | Ga0068853_100176886 | 3300005539 | Bacteria | 1933 |
| 102 | Ga0070686_100007189 | 3300005544 | Bacteria | 6202 |
| 103 | Ga0070686_100017663 | 3300005544 | Unclassified | 4172 |
| 104 | Ga0070665_100130965 | 3300005548 | Bacteria | 2510 |
| 105 | Ga0070665_100799270 | 3300005548 | Bacteria | 956 |
| 106 | Ga0068855_100000001 | 3300005563 | Bacteria | 818777 |
| 107 | Ga0068855_100000002 | 3300005563 | Bacteria | 616881 |
| 108 | Ga0068855_100000017 | 3300005563 | Bacteria | 212278 |
| 109 | Ga0068855_100002485 | 3300005563 | Bacteria | 22714 |
| 110 | Ga0068855_100006018 | 3300005563 | Bacteria | 14797 |
| 111 | Ga0068855_100011195 | 3300005563 | Bacteria | 10833 |
| 112 | Ga0068855_100025370 | 3300005563 | Bacteria | 7093 |
| 113 | Ga0068855_100079325 | 3300005563 | Bacteria | 3808 |
| 114 | Ga0070664_100000165 | 3300005564 | Bacteria | 45818 |
| 115 | Ga0070664_100153013 | 3300005564 | Unclassified | 2037 |
| 116 | Ga0070664_100257093 | 3300005564 | Viruses | 1571 |
| 117 | Ga0068857_100000001 | 3300005577 | Bacteria | 254081 |
| 118 | Ga0068857_100000266 | 3300005577 | Bacteria | 35450 |
| 119 | Ga0068857_100163368 | 3300005577 | Bacteria | 2021 |
| 120 | Ga0068856_100000002 | 3300005614 | Bacteria | 372816 |
| 121 | Ga0068856_100000441 | 3300005614 | Bacteria | 45741 |
| 122 | Ga0068856_100001703 | 3300005614 | Bacteria | 22976 |
| 123 | Ga0068856_100002784 | 3300005614 | Bacteria | 17907 |
| 124 | Ga0068856_100036064 | 3300005614 | Bacteria | 4849 |
| 125 | Ga0068856_100045294 | 3300005614 | Bacteria | 4331 |
| 126 | Ga0068856_100119495 | 3300005614 | Bacteria | 2637 |
| 127 | Ga0068852_100000173 | 3300005616 | Bacteria | 43532 |
| 128 | Ga0068852_100037934 | 3300005616 | Bacteria | 4045 |
| 129 | Ga0068864_100530073 | 3300005618 | Viruses | 1136 |
| 130 | Ga0068863_100029972 | 3300005841 | Bacteria | 5197 |
| 131 | Ga0068863_100121081 | 3300005841 | Bacteria | 2495 |
| 132 | Ga0068858_100014703 | 3300005842 | Bacteria | 7367 |
| 133 | Ga0068860_100021321 | 3300005843 | Bacteria | 6274 |
| 134 | Ga0081455_10000020 | 3300005937 | Bacteria | 172997 |
| 135 | Ga0081539_10013697 | 3300005985 | Bacteria | 6090 |
| 136 | Ga0075365_10000007 | 3300006038 | Bacteria | 116889 |
| 137 | Ga0075365_10001244 | 3300006038 | Bacteria | 11288 |
| 138 | Ga0075365_10025938 | 3300006038 | Bacteria | 3715 |
| 139 | Ga0075368_10000090 | 3300006042 | Bacteria | 22751 |
| 140 | Ga0075368_10000174 | 3300006042 | Bacteria | 17516 |
| 141 | Ga0075363_100000147 | 3300006048 | Bacteria | 17418 |
| 142 | Ga0075363_100000352 | 3300006048 | Bacteria | 13817 |
| 143 | Ga0075364_10000111 | 3300006051 | Bacteria | 33702 |
| 144 | Ga0075364_10000937 | 3300006051 | Bacteria | 15385 |
| 145 | Ga0075364_10013165 | 3300006051 | Bacteria | 5077 |
| 146 | Ga0075367_10000296 | 3300006178 | Bacteria | 17516 |
| 147 | Ga0075367_10000339 | 3300006178 | Bacteria | 16665 |
| 148 | Ga0075367_10029637 | 3300006178 | Bacteria | 3132 |
| 149 | Ga0075369_10000004 | 3300006186 | Bacteria | 154675 |
| 150 | Ga0075369_10000031 | 3300006186 | Bacteria | 37621 |
| 151 | Ga0075369_10003342 | 3300006186 | Bacteria | 5830 |
| 152 | Ga0075366_10000003 | 3300006195 | Bacteria | 114017 |
| 153 | Ga0075366_10000010 | 3300006195 | Bacteria | 81131 |
| 154 | Ga0075366_10000096 | 3300006195 | Bacteria | 35379 |
| 155 | Ga0075366_10000204 | 3300006195 | Bacteria | 26136 |
| 156 | Ga0075366_10000978 | 3300006195 | Bacteria | 13965 |
| 157 | Ga0075366_10001219 | 3300006195 | Bacteria | 12757 |
| 158 | Ga0075366_10003860 | 3300006195 | Bacteria | 7983 |
| 159 | Ga0097621_100000001 | 3300006237 | Bacteria | 632268 |
| 160 | Ga0097621_100000052 | 3300006237 | Bacteria | 60152 |
| 161 | Ga0097621_100035651 | 3300006237 | Bacteria | 3977 |
| 162 | Ga0097621_100162187 | 3300006237 | Viruses | 1922 |
| 163 | Ga0075370_10000990 | 3300006353 | Bacteria | 11758 |
| 164 | Ga0075370_10001566 | 3300006353 | Bacteria | 10046 |
| 165 | Ga0075370_10031451 | 3300006353 | Unclassified | 2963 |
| 166 | Ga0075370_10144555 | 3300006353 | Bacteria | 1391 |
| 167 | Ga0068871_100000001 | 3300006358 | Bacteria | 215987 |
| 168 | Ga0068871_100000006 | 3300006358 | Bacteria | 116822 |
| 169 | Ga0068871_100005288 | 3300006358 | Bacteria | 9039 |
| 170 | Ga0068871_100442801 | 3300006358 | Bacteria | 1163 |
| 171 | Ga0075428_100007820 | 3300006844 | Bacteria | 11853 |
| 172 | Ga0075428_100099923 | 3300006844 | Bacteria | 3164 |
| 173 | Ga0075430_100060256 | 3300006846 | Bacteria | 3190 |
| 174 | Ga0068865_100000106 | 3300006881 | Bacteria | 43112 |
| 175 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 176 | Ga0105240_10000030 | 3300009093 | Bacteria | 321312 |
| 177 | Ga0105240_10000886 | 3300009093 | Bacteria | 53766 |
| 178 | Ga0105240_10005930 | 3300009093 | Bacteria | 18093 |
| 179 | Ga0105240_10023635 | 3300009093 | Bacteria | 8119 |
| 180 | Ga0105240_10045972 | 3300009093 | Bacteria | 5535 |
| 181 | Ga0105240_10291984 | 3300009093 | Unclassified | 1868 |
| 182 | Ga0111539_10000377 | 3300009094 | Bacteria | 55154 |
| 183 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 184 | Ga0105245_10000096 | 3300009098 | Bacteria | 84679 |
| 185 | Ga0105245_10000127 | 3300009098 | Bacteria | 72844 |
| 186 | Ga0105245_10030451 | 3300009098 | Unclassified | 4771 |
| 187 | Ga0105245_10054517 | 3300009098 | Bacteria | 3591 |
| 188 | Ga0105245_10165200 | 3300009098 | Bacteria | 2104 |
| 189 | Ga0105245_10209908 | 3300009098 | Bacteria | 1874 |
| 190 | Ga0105245_10574204 | 3300009098 | Bacteria | 1152 |
| 191 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 192 | Ga0105243_10006155 | 3300009148 | Bacteria | 9277 |
| 193 | Ga0105241_10000009 | 3300009174 | Bacteria | 258876 |
| 194 | Ga0105241_10001013 | 3300009174 | Bacteria | 21361 |
| 195 | Ga0105241_10016697 | 3300009174 | Bacteria | 5387 |
| 196 | Ga0105241_10278601 | 3300009174 | Unclassified | 1427 |
| 197 | Ga0105242_10000001 | 3300009176 | Bacteria | 574039 |
| 198 | Ga0105242_10017653 | 3300009176 | Bacteria | 5565 |
| 199 | Ga0105242_10022217 | 3300009176 | Bacteria | 4986 |
| 200 | Ga0105242_10158997 | 3300009176 | Bacteria | 1976 |
| 201 | Ga0105248_10019320 | 3300009177 | Bacteria | 7538 |
| 202 | Ga0105248_10032935 | 3300009177 | Bacteria | 5788 |
| 203 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 204 | Ga0105237_10069677 | 3300009545 | Unclassified | 3513 |
| 205 | Ga0105237_10091215 | 3300009545 | Bacteria | 3036 |
| 206 | Ga0105237_10223307 | 3300009545 | Bacteria | 1884 |
| 207 | Ga0105237_10378437 | 3300009545 | Bacteria | 1420 |
| 208 | Ga0105238_10000462 | 3300009551 | Bacteria | 42703 |
| 209 | Ga0105238_10000614 | 3300009551 | Bacteria | 37450 |
| 210 | Ga0105238_10041162 | 3300009551 | Bacteria | 4680 |
| 211 | Ga0105238_10145740 | 3300009551 | Unclassified | 2344 |
| 212 | Ga0105249_10016080 | 3300009553 | Bacteria | 6632 |
| 213 | Ga0105249_10032436 | 3300009553 | Bacteria | 4726 |
| 214 | Ga0105032_100012 | 3300009979 | Bacteria | 73994 |
| 215 | Ga0105029_100012 | 3300009984 | Bacteria | 9525 |
| 216 | Ga0105033_102652 | 3300009986 | Bacteria | 1484 |
| 217 | Ga0105030_103048 | 3300009987 | Unclassified | 1450 |
| 218 | Ga0105028_100146 | 3300009993 | Bacteria | 7569 |
| 219 | Ga0105239_10000481 | 3300010375 | Bacteria | 58265 |
| 220 | Ga0105239_10001159 | 3300010375 | Bacteria | 36200 |
| 221 | Ga0105239_10008373 | 3300010375 | Bacteria | 11782 |
| 222 | Ga0105239_10009209 | 3300010375 | Bacteria | 11167 |
| 223 | Ga0105239_10009667 | 3300010375 | Bacteria | 10845 |
| 224 | Ga0105246_10000266 | 3300011119 | Bacteria | 27135 |
| 225 | Ga0105246_10000412 | 3300011119 | Bacteria | 22903 |
| 226 | Ga0105246_10018155 | 3300011119 | Bacteria | 4480 |
| 227 | Ga0157373_10000092 | 3300013100 | Bacteria | 74657 |
| 228 | Ga0157373_10011488 | 3300013100 | Bacteria | 6510 |
| 229 | Ga0157373_10013776 | 3300013100 | Bacteria | 5927 |
| 230 | Ga0157373_10013808 | 3300013100 | Bacteria | 5922 |
| 231 | Ga0157373_10039112 | 3300013100 | Bacteria | 3396 |
| 232 | Ga0157371_10000207 | 3300013102 | Bacteria | 86226 |
| 233 | Ga0157371_10001079 | 3300013102 | Bacteria | 29525 |
| 234 | Ga0157371_10265140 | 3300013102 | Bacteria | 1239 |
| 235 | Ga0157370_10000232 | 3300013104 | Bacteria | 71177 |
| 236 | Ga0157370_10001387 | 3300013104 | Bacteria | 29999 |
| 237 | Ga0157370_10017785 | 3300013104 | Bacteria | 7165 |
| 238 | Ga0157370_10162790 | 3300013104 | Bacteria | 2075 |
| 239 | Ga0157370_10172680 | 3300013104 | Bacteria | 2009 |
| 240 | Ga0157370_10186063 | 3300013104 | Bacteria | 1928 |
| 241 | Ga0157370_10286963 | 3300013104 | Bacteria | 1520 |
| 242 | Ga0157369_10000227 | 3300013105 | Bacteria | 77626 |
| 243 | Ga0157369_10000826 | 3300013105 | Bacteria | 39569 |
| 244 | Ga0157369_10001538 | 3300013105 | Bacteria | 28252 |
| 245 | Ga0157369_10009515 | 3300013105 | Bacteria | 11111 |
| 246 | Ga0157369_10014799 | 3300013105 | Bacteria | 8803 |
| 247 | Ga0157369_10019327 | 3300013105 | Bacteria | 7622 |
| 248 | Ga0157369_10080347 | 3300013105 | Bacteria | 3491 |
| 249 | Ga0157369_10408205 | 3300013105 | Bacteria | 1409 |
| 250 | Ga0157374_10000014 | 3300013296 | Bacteria | 396846 |
| 251 | Ga0157374_10000487 | 3300013296 | Bacteria | 35920 |
| 252 | Ga0157374_10000590 | 3300013296 | Bacteria | 32049 |
| 253 | Ga0157374_10001044 | 3300013296 | Bacteria | 24049 |
| 254 | Ga0157374_10004448 | 3300013296 | Bacteria | 11779 |
| 255 | Ga0157374_10011016 | 3300013296 | Bacteria | 7808 |
| 256 | Ga0157374_10049239 | 3300013296 | Bacteria | 3913 |
| 257 | Ga0157378_10024663 | 3300013297 | Bacteria | 5295 |
| 258 | Ga0157378_10539178 | 3300013297 | Viruses | 1171 |
| 259 | Ga0163162_10040536 | 3300013306 | Bacteria | 4658 |
| 260 | Ga0157372_10000007 | 3300013307 | Bacteria | 340690 |
| 261 | Ga0157372_10000487 | 3300013307 | Bacteria | 43763 |
| 262 | Ga0157372_10023088 | 3300013307 | Bacteria | 6740 |
| 263 | Ga0157372_10139101 | 3300013307 | Bacteria | 2796 |
| 264 | Ga0157372_10147165 | 3300013307 | Bacteria | 2716 |
| 265 | Ga0157372_10156090 | 3300013307 | Bacteria | 2636 |
| 266 | Ga0157372_10512390 | 3300013307 | Unclassified | 1399 |
| 267 | Ga0157372_10582298 | 3300013307 | Unclassified | 1304 |
| 268 | Ga0157375_10371729 | 3300013308 | Bacteria | 1596 |
| 269 | Ga0157514_114767 | 3300013874 | Unclassified | 1312 |
| 270 | Ga0163163_10000544 | 3300014325 | Bacteria | 33219 |
| 271 | Ga0163163_10098256 | 3300014325 | Bacteria | 2948 |
| 272 | Ga0163163_10124000 | 3300014325 | Bacteria | 2619 |
| 273 | Ga0157380_10032740 | 3300014326 | Viruses | 4001 |
| 274 | Ga0157377_10000096 | 3300014745 | Bacteria | 62606 |
| 275 | Ga0157377_10013649 | 3300014745 | Bacteria | 4117 |
| 276 | Ga0157377_10046720 | 3300014745 | Bacteria | 2423 |
| 277 | Ga0157379_10048717 | 3300014968 | Bacteria | 3782 |
| 278 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 279 | Ga0157376_10000223 | 3300014969 | Bacteria | 39568 |
| 280 | Ga0157376_10009574 | 3300014969 | Bacteria | 7046 |
| 281 | Ga0207680_10097395 | 3300025903 | Bacteria | 1883 |
| 282 | Ga0207647_10000087 | 3300025904 | Bacteria | 70424 |
| 283 | Ga0207647_10000364 | 3300025904 | Bacteria | 36966 |
| 284 | Ga0207645_10002614 | 3300025907 | Bacteria | 14038 |
| 285 | Ga0207705_10000010 | 3300025909 | Bacteria | 518023 |
| 286 | Ga0207705_10000019 | 3300025909 | Bacteria | 317770 |
| 287 | Ga0207705_10001259 | 3300025909 | Bacteria | 20352 |
| 288 | Ga0207705_10002528 | 3300025909 | Bacteria | 14089 |
| 289 | Ga0207705_10003091 | 3300025909 | Bacteria | 12696 |
| 290 | Ga0207705_10105430 | 3300025909 | Bacteria | 2078 |
| 291 | Ga0207705_10208873 | 3300025909 | Unclassified | 1481 |
| 292 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 293 | Ga0207654_10006369 | 3300025911 | Bacteria | 5936 |
| 294 | Ga0207707_10083400 | 3300025912 | Bacteria | 2791 |
| 295 | Ga0207707_10103450 | 3300025912 | Bacteria | 2489 |
| 296 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 297 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 298 | Ga0207695_10004142 | 3300025913 | Bacteria | 19917 |
| 299 | Ga0207695_10026439 | 3300025913 | Bacteria | 6476 |
| 300 | Ga0207695_10052099 | 3300025913 | Bacteria | 4290 |
| 301 | Ga0207695_10312989 | 3300025913 | Unclassified | 1460 |
| 302 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 303 | Ga0207671_10000055 | 3300025914 | Bacteria | 187621 |
| 304 | Ga0207671_10070626 | 3300025914 | Unclassified | 2604 |
| 305 | Ga0207671_10125235 | 3300025914 | Unclassified | 1967 |
| 306 | Ga0207671_10136609 | 3300025914 | Bacteria | 1885 |
| 307 | Ga0207660_10025211 | 3300025917 | Bacteria | 4034 |
| 308 | Ga0207660_10296788 | 3300025917 | Bacteria | 1286 |
| 309 | Ga0207657_10000226 | 3300025919 | Bacteria | 59005 |
| 310 | Ga0207657_10000547 | 3300025919 | Bacteria | 40133 |
| 311 | Ga0207657_10001044 | 3300025919 | Bacteria | 29324 |
| 312 | Ga0207657_10003587 | 3300025919 | Bacteria | 16565 |
| 313 | Ga0207657_10015715 | 3300025919 | Bacteria | 7321 |
| 314 | Ga0207657_10016318 | 3300025919 | Bacteria | 7165 |
| 315 | Ga0207657_10077033 | 3300025919 | Bacteria | 2812 |
| 316 | Ga0207649_10003514 | 3300025920 | Bacteria | 8566 |
| 317 | Ga0207649_10013134 | 3300025920 | Bacteria | 4620 |
| 318 | Ga0207652_10002361 | 3300025921 | Bacteria | 15958 |
| 319 | Ga0207652_10007010 | 3300025921 | Bacteria | 9085 |
| 320 | Ga0207652_10010276 | 3300025921 | Bacteria | 7533 |
| 321 | Ga0207652_10135222 | 3300025921 | Bacteria | 2201 |
| 322 | Ga0207652_10481380 | 3300025921 | Bacteria | 1118 |
| 323 | Ga0207681_10416233 | 3300025923 | Unclassified | 1088 |
| 324 | Ga0207694_10001197 | 3300025924 | Bacteria | 22503 |
| 325 | Ga0207694_10002622 | 3300025924 | Bacteria | 14591 |
| 326 | Ga0207694_10097431 | 3300025924 | Bacteria | 2327 |
| 327 | Ga0207694_10099362 | 3300025924 | Bacteria | 2305 |
| 328 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 329 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 330 | Ga0207687_10000008 | 3300025927 | Bacteria | 497738 |
| 331 | Ga0207687_10002335 | 3300025927 | Bacteria | 12923 |
| 332 | Ga0207687_10017066 | 3300025927 | Unclassified | 4772 |
| 333 | Ga0207687_10066693 | 3300025927 | Bacteria | 2558 |
| 334 | Ga0207687_10391914 | 3300025927 | Bacteria | 1140 |
| 335 | Ga0207664_10000779 | 3300025929 | Bacteria | 21509 |
| 336 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 337 | Ga0207644_10040907 | 3300025931 | Unclassified | 3277 |
| 338 | Ga0207690_10001999 | 3300025932 | Bacteria | 12493 |
| 339 | Ga0207690_10007260 | 3300025932 | Bacteria | 6582 |
| 340 | Ga0207690_10137643 | 3300025932 | Bacteria | 1795 |
| 341 | Ga0207706_10000464 | 3300025933 | Bacteria | 43335 |
| 342 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 343 | Ga0207686_10041909 | 3300025934 | Bacteria | 2795 |
| 344 | Ga0207686_10090595 | 3300025934 | Bacteria | 2018 |
| 345 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 346 | Ga0207709_10006987 | 3300025935 | Bacteria | 6308 |
| 347 | Ga0207669_10017864 | 3300025937 | Bacteria | 3650 |
| 348 | Ga0207704_10000067 | 3300025938 | Bacteria | 66570 |
| 349 | Ga0207711_10170450 | 3300025941 | Bacteria | 1975 |
| 350 | Ga0207661_10000449 | 3300025944 | Bacteria | 26441 |
| 351 | Ga0207661_10000789 | 3300025944 | Bacteria | 20657 |
| 352 | Ga0207661_10003099 | 3300025944 | Bacteria | 11519 |
| 353 | Ga0207679_10000214 | 3300025945 | Bacteria | 45882 |
| 354 | Ga0207679_10214574 | 3300025945 | Viruses | 1616 |
| 355 | Ga0207679_10412261 | 3300025945 | Unclassified | 1191 |
| 356 | Ga0207667_10000003 | 3300025949 | Bacteria | 822935 |
| 357 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 358 | Ga0207667_10000048 | 3300025949 | Bacteria | 238293 |
| 359 | Ga0207667_10001110 | 3300025949 | Bacteria | 33935 |
| 360 | Ga0207667_10001670 | 3300025949 | Bacteria | 27952 |
| 361 | Ga0207667_10005892 | 3300025949 | Bacteria | 14926 |
| 362 | Ga0207667_10023464 | 3300025949 | Bacteria | 6793 |
| 363 | Ga0207667_10120567 | 3300025949 | Bacteria | 2703 |
| 364 | Ga0207667_10312915 | 3300025949 | Unclassified | 1604 |
| 365 | Ga0207651_10004696 | 3300025960 | Bacteria | 6932 |
| 366 | Ga0207712_10167595 | 3300025961 | Bacteria | 1713 |
| 367 | Ga0207668_10255983 | 3300025972 | Bacteria | 1424 |
| 368 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 369 | Ga0207658_10247405 | 3300025986 | Bacteria | 1513 |
| 370 | Ga0207703_10003878 | 3300026035 | Bacteria | 12428 |
| 371 | Ga0207678_10202320 | 3300026067 | Bacteria | 1698 |
| 372 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 373 | Ga0207702_10000079 | 3300026078 | Bacteria | 110210 |
| 374 | Ga0207702_10000871 | 3300026078 | Bacteria | 31407 |
| 375 | Ga0207702_10009162 | 3300026078 | Bacteria | 8326 |
| 376 | Ga0207702_10105655 | 3300026078 | Bacteria | 2494 |
| 377 | Ga0207702_10162430 | 3300026078 | Bacteria | 2041 |
| 378 | Ga0207641_10019307 | 3300026088 | Bacteria | 5594 |
| 379 | Ga0207674_10000021 | 3300026116 | Bacteria | 161986 |
| 380 | Ga0207674_10000486 | 3300026116 | Bacteria | 52406 |
| 381 | Ga0207674_10019441 | 3300026116 | Bacteria | 7355 |
| 382 | Ga0207674_10455593 | 3300026116 | Bacteria | 1236 |
| 383 | Ga0207674_10520866 | 3300026116 | Viruses | 1148 |
| 384 | Ga0207683_10002619 | 3300026121 | Bacteria | 15711 |
| 385 | Ga0207683_10033236 | 3300026121 | Bacteria | 4480 |
| 386 | Ga0207698_10000139 | 3300026142 | Bacteria | 45792 |
| 387 | Ga0207698_10006195 | 3300026142 | Bacteria | 7444 |
| 388 | Ga0207698_10032472 | 3300026142 | Bacteria | 3782 |
| 389 | Ga0209966_1000038 | 3300027695 | Bacteria | 54987 |
| 390 | Ga0209813_10000002 | 3300027866 | Bacteria | 215993 |
| 391 | Ga0209813_10000225 | 3300027866 | Bacteria | 17310 |
| 392 | Ga0268266_10002030 | 3300028379 | Bacteria | 22496 |
| 393 | Ga0268265_10086352 | 3300028380 | Unclassified | 2493 |
| 394 | Ga0268264_10060350 | 3300028381 | Bacteria | 3178 |
| 395 | Ga0265337_1000264 | 3300028556 | Bacteria | 28474 |
| 396 | Ga0265337_1002700 | 3300028556 | Bacteria | 7967 |
| 397 | Ga0265337_1003472 | 3300028556 | Bacteria | 6822 |
| 398 | Ga0265337_1010798 | 3300028556 | Bacteria | 3178 |
| 399 | Ga0265326_10000254 | 3300028558 | Bacteria | 24825 |
| 400 | Ga0265326_10000609 | 3300028558 | Bacteria | 13416 |
| 401 | Ga0265326_10003463 | 3300028558 | Bacteria | 5161 |
| 402 | Ga0265326_10007146 | 3300028558 | Bacteria | 3433 |
| 403 | Ga0265319_1004475 | 3300028563 | Bacteria | 6911 |
| 404 | Ga0265319_1004753 | 3300028563 | Bacteria | 6654 |
| 405 | Ga0265334_10000039 | 3300028573 | Bacteria | 100608 |
| 406 | Ga0265334_10000041 | 3300028573 | Bacteria | 98258 |
| 407 | Ga0265334_10003925 | 3300028573 | Bacteria | 6698 |
| 408 | Ga0265334_10004342 | 3300028573 | Bacteria | 6308 |
| 409 | Ga0265334_10009480 | 3300028573 | Bacteria | 4118 |
| 410 | Ga0265318_10002951 | 3300028577 | Bacteria | 8816 |
| 411 | Ga0265318_10043163 | 3300028577 | Unclassified | 1709 |
| 412 | Ga0265322_10001725 | 3300028654 | Bacteria | 6930 |
| 413 | Ga0265322_10029066 | 3300028654 | Bacteria | 1579 |
| 414 | Ga0265336_10000222 | 3300028666 | Bacteria | 40224 |
| 415 | Ga0265336_10001638 | 3300028666 | Bacteria | 9922 |
| 416 | Ga0265336_10003428 | 3300028666 | Bacteria | 6213 |
| 417 | Ga0265336_10005251 | 3300028666 | Bacteria | 4799 |
| 418 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 419 | Ga0265338_10000268 | 3300028800 | Bacteria | 95143 |
| 420 | Ga0265338_10000368 | 3300028800 | Bacteria | 80896 |
| 421 | Ga0265338_10000462 | 3300028800 | Bacteria | 72395 |
| 422 | Ga0265338_10000684 | 3300028800 | Bacteria | 58206 |
| 423 | Ga0265338_10001220 | 3300028800 | Bacteria | 42488 |
| 424 | Ga0265338_10001448 | 3300028800 | Bacteria | 38508 |
| 425 | Ga0265338_10001797 | 3300028800 | Bacteria | 33738 |
| 426 | Ga0265338_10004432 | 3300028800 | Bacteria | 18965 |
| 427 | Ga0265338_10005190 | 3300028800 | Bacteria | 17105 |
| 428 | Ga0265338_10005849 | 3300028800 | Bacteria | 15874 |
| 429 | Ga0265338_10010472 | 3300028800 | Bacteria | 10861 |
| 430 | Ga0265338_10011114 | 3300028800 | Bacteria | 10436 |
| 431 | Ga0265338_10012076 | 3300028800 | Bacteria | 9877 |
| 432 | Ga0265338_10013408 | 3300028800 | Bacteria | 9259 |
| 433 | Ga0265338_10016754 | 3300028800 | Bacteria | 7942 |
| 434 | Ga0265338_10066423 | 3300028800 | Bacteria | 3121 |
| 435 | Ga0265338_10334616 | 3300028800 | Bacteria | 1092 |
| 436 | Ga0265324_10001402 | 3300029957 | Bacteria | 13897 |
| 437 | Ga0265324_10003905 | 3300029957 | Bacteria | 6938 |
| 438 | Ga0314311_1014870 | 3300030733 | Bacteria | 3006 |
| 439 | Ga0314311_1186753 | 3300030733 | Bacteria | 2182 |
| 440 | Ga0316179_1028359 | 3300030734 | Bacteria | 22140 |
| 441 | Ga0316179_1084076 | 3300030734 | Bacteria | 1987 |
| 442 | Ga0316183_1053060 | 3300030742 | Bacteria | 10073 |
| 443 | Ga0316183_1176785 | 3300030742 | Bacteria | 2849 |
| 444 | Ga0316181_1123581 | 3300030744 | Bacteria | 76132 |
| 445 | Ga0316181_1247702 | 3300030744 | Unclassified | 1164 |
| 446 | Ga0316182_1253872 | 3300030745 | Bacteria | 7685 |
| 447 | Ga0316182_1303601 | 3300030745 | Bacteria | 10332 |
| 448 | Ga0265332_10001718 | 3300031238 | Bacteria | 11935 |
| 449 | Ga0265332_10055700 | 3300031238 | Bacteria | 1695 |
| 450 | Ga0265328_10007589 | 3300031239 | Unclassified | 4516 |
| 451 | Ga0265320_10002894 | 3300031240 | Bacteria | 11772 |
| 452 | Ga0265320_10008248 | 3300031240 | Bacteria | 6385 |
| 453 | Ga0265325_10007748 | 3300031241 | Bacteria | 6398 |
| 454 | Ga0265340_10001780 | 3300031247 | Bacteria | 12290 |
| 455 | Ga0265339_10013676 | 3300031249 | Bacteria | 4915 |
| 456 | Ga0265331_10002567 | 3300031250 | Bacteria | 12211 |
| 457 | Ga0265331_10071524 | 3300031250 | Unclassified | 1622 |
| 458 | Ga0265327_10000025 | 3300031251 | Bacteria | 380054 |
| 459 | Ga0265327_10001269 | 3300031251 | Bacteria | 33287 |
| 460 | Ga0265327_10006169 | 3300031251 | Bacteria | 9682 |
| 461 | Ga0265327_10010462 | 3300031251 | Bacteria | 6519 |
| 462 | Ga0265316_10000892 | 3300031344 | Bacteria | 32693 |
| 463 | Ga0265316_10141266 | 3300031344 | Bacteria | 1808 |
| 464 | Ga0265313_10009822 | 3300031595 | Bacteria | 6163 |
| 465 | Ga0265313_10010047 | 3300031595 | Bacteria | 6056 |
| 466 | Ga0265313_10046705 | 3300031595 | Bacteria | 2101 |
| 467 | Ga0265342_10012751 | 3300031712 | Bacteria | 5678 |
| 468 | Ga0307516_10000003 | 3300031730 | Bacteria | 459377 |
| 469 | Ga0307405_10007005 | 3300031731 | Bacteria | 5602 |
| 470 | Ga0307406_10000001 | 3300031901 | Bacteria | 638191 |
| 471 | Ga0307406_10001800 | 3300031901 | Bacteria | 11712 |
| 472 | Ga0307412_10016291 | 3300031911 | Bacteria | 4426 |
| 473 | Ga0395899_0000969 | 3300037312 | Bacteria | 26598 |
| 474 | Ga0395899_0091270 | 3300037312 | Bacteria | 2207 |
| 475 | Ga0395899_0109144 | 3300037312 | Bacteria | 1991 |
| 476 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 477 | Ga0395900_0000612 | 3300037418 | Bacteria | 48582 |
| 478 | Ga0395900_0002229 | 3300037418 | Bacteria | 21616 |
| 479 | Ga0395900_0038455 | 3300037418 | Bacteria | 4931 |
| 480 | Ga0395900_0040151 | 3300037418 | Bacteria | 4823 |
| 481 | Ga0395900_0122900 | 3300037418 | Bacteria | 2662 |
| 482 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 483 | Ga0395898_0004280 | 3300037466 | Bacteria | 15658 |
| 484 | Ga0395898_0008209 | 3300037466 | Bacteria | 11042 |
| 485 | Ga0395898_0085328 | 3300037466 | Bacteria | 3043 |
| 486 | Ga0395898_0332884 | 3300037466 | Bacteria | 1448 |
| 487 | Ga0395905_0003752 | 3300037471 | Bacteria | 16096 |
| 488 | Ga0395905_0026251 | 3300037471 | Bacteria | 5492 |
| 489 | Ga0395905_0224504 | 3300037471 | Bacteria | 1758 |
| 490 | Ga0395901_0000006 | 3300038443 | Bacteria | 514112 |
| 491 | Ga0395901_0000815 | 3300038443 | Bacteria | 34538 |
| 492 | Ga0395901_0001516 | 3300038443 | Bacteria | 24117 |
| 493 | Ga0395901_0025010 | 3300038443 | Bacteria | 6129 |
| 494 | Ga0395901_0030978 | 3300038443 | Bacteria | 5513 |
| 495 | Ga0395901_0070485 | 3300038443 | Unclassified | 3642 |
| 496 | Ga0395901_0091879 | 3300038443 | Bacteria | 3177 |
| 497 | Ga0395901_0206424 | 3300038443 | Bacteria | 2058 |
| 498 | Ga0439445_0000130 | 3300042004 | Bacteria | 12977 |
| 499 | Ga0439432_022498 | 3300042006 | Bacteria | 2082 |
| 500 | Ga0439463_001787 | 3300042016 | Bacteria | 5596 |
| 501 | Ga0450906_000203 | 3300042145 | Bacteria | 11291 |
| 502 | Ga0450909_001048 | 3300042185 | Bacteria | 3794 |
| 503 | Ga0439464_0000001 | 3300042439 | Bacteria | 126033 |
| 504 | Ga0450918_007118 | 3300042531 | Bacteria | 1988 |
| 505 | Ga0451577_0000021 | 3300042876 | Bacteria | 438753 |
| 506 | Ga0466965_0000131 | 3300044683 | Bacteria | 21386 |
| 507 | Ga0453684_0000073 | 3300044712 | Bacteria | 438753 |
| 508 | Ga0495629_0190325 | 3300046459 | Unclassified | 1420 |
| 509 | Ga0495622_0001254 | 3300046557 | Bacteria | 13015 |
| 510 | Ga0495634_0099711 | 3300046642 | Unclassified | 1878 |
| 511 | Ga0495588_0000186 | 3300046674 | Bacteria | 68600 |
| 512 | Ga0495670_0099995 | 3300046691 | Bacteria | 1493 |
| 513 | Ga0495649_0000209 | 3300046694 | Bacteria | 51400 |
| 514 | Ga0495600_0010909 | 3300046809 | Bacteria | 5650 |
| 515 | Ga0495672_0000284 | 3300047320 | Bacteria | 70468 |
| 516 | Ga0495686_0012388 | 3300047472 | Bacteria | 5966 |
| 517 | Ga0495602_0152301 | 3300048088 | Unclassified | 1816 |
| 518 | Ga0496109_0065395 | 3300048912 | Bacteria | 3329 |
| 519 | Ga0496124_0007711 | 3300048927 | Bacteria | 11380 |
| 520 | Ga0496125_0107257 | 3300048928 | Unclassified | 2036 |
| 521 | Ga0496126_0052748 | 3300048929 | Plasmid | 3694 |
| 522 | Ga0501031_0000327 | 3300049568 | Bacteria | 27388 |
| 523 | Ga0501032_0000934 | 3300049569 | Bacteria | 23625 |
| 524 | Ga0501033_0056714 | 3300049570 | Bacteria | 2895 |
| 525 | Ga0501033_0097488 | 3300049570 | Bacteria | 2148 |
| 526 | Ga0501033_0201409 | 3300049570 | Viruses | 1422 |
| 527 | Ga0501034_0000460 | 3300049571 | Bacteria | 67352 |
| 528 | Ga0501034_0006072 | 3300049571 | Bacteria | 13043 |
| 529 | Ga0501034_0015024 | 3300049571 | Bacteria | 7963 |
| 530 | Ga0501034_0214510 | 3300049571 | Bacteria | 1879 |
| 531 | Ga0501034_0406437 | 3300049571 | Bacteria | 1284 |
| 532 | Ga0501036_0016677 | 3300049572 | Bacteria | 6134 |
| 533 | Ga0501036_0021747 | 3300049572 | Bacteria | 5392 |
| 534 | Ga0501037_0000597 | 3300049573 | Bacteria | 28178 |
| 535 | Ga0501037_0007668 | 3300049573 | Bacteria | 7900 |
| 536 | Ga0501037_0207635 | 3300049573 | Bacteria | 1382 |
| 537 | Ga0501038_0007214 | 3300049574 | Bacteria | 10269 |
| 538 | Ga0501038_0056550 | 3300049574 | Bacteria | 3369 |
| 539 | Ga0501039_0046255 | 3300049575 | Bacteria | 3362 |
| 540 | Ga0501039_0263983 | 3300049575 | Bacteria | 1353 |
| 541 | Ga0501042_0057748 | 3300049578 | Bacteria | 2769 |
| 542 | Ga0501043_0000139 | 3300049579 | Bacteria | 67517 |
| 543 | Ga0501046_0000061 | 3300049580 | Bacteria | 120487 |
| 544 | Ga0501046_0278237 | 3300049580 | Bacteria | 1226 |
| 545 | Ga0501047_0000024 | 3300049581 | Bacteria | 230397 |
| 546 | Ga0501047_0004292 | 3300049581 | Bacteria | 13413 |
| 547 | Ga0501048_0000024 | 3300049582 | Bacteria | 67807 |
| 548 | Ga0501048_0010040 | 3300049582 | Bacteria | 7084 |
| 549 | Ga0501070_0101118 | 3300049586 | Bacteria | 2384 |
| 550 | Ga0501073_0050353 | 3300049589 | Bacteria | 2919 |
| 551 | Ga0501080_0000007 | 3300049742 | Bacteria | 135749 |
| 552 | Ga0501080_0079442 | 3300049742 | Bacteria | 3050 |
| 553 | Ga0501080_0143541 | 3300049742 | Bacteria | 2207 |
| 554 | Ga0501080_0467801 | 3300049742 | Bacteria | 1129 |
| 555 | Ga0501083_0032688 | 3300049744 | Bacteria | 3567 |
| 556 | Ga0501083_0098091 | 3300049744 | Bacteria | 1933 |
| 557 | Ga0501035_0000005 | 3300049822 | Bacteria | 392980 |
| 558 | Ga0501035_0000858 | 3300049822 | Unclassified | 32412 |
| 559 | Ga0501035_0004411 | 3300049822 | Bacteria | 13357 |
| 560 | Ga0501044_0001085 | 3300049823 | Unclassified | 32466 |
| 561 | Ga0501044_0009816 | 3300049823 | Bacteria | 10409 |
| 562 | Ga0501044_0307443 | 3300049823 | Bacteria | 1513 |
| 563 | nmdc:mga03683_353_c1 | 3300050489 | Bacteria | 13396 |
| 564 | nmdc:mga03n38_24814_c1 | 3300050490 | Bacteria | 2455 |
| 565 | nmdc:mga03n38_419_c1 | 3300050490 | Bacteria | 10518 |
| 566 | nmdc:mga00v17_21569_c1 | 3300050491 | Bacteria | 3704 |
| 567 | nmdc:mga00v17_301_c1 | 3300050491 | Bacteria | 28737 |
| 568 | nmdc:mga00v17_537_c1 | 3300050491 | Bacteria | 21238 |
| 569 | nmdc:mga0yw44_11_c1 | 3300050492 | Bacteria | 130624 |
| 570 | nmdc:mga0yw44_192527_c1 | 3300050492 | Bacteria | 1345 |
| 571 | nmdc:mga0yw44_30309_c2 | 3300050492 | Bacteria | 2199 |
| 572 | nmdc:mga0yw44_41899_c1 | 3300050492 | Unclassified | 2728 |
| 573 | nmdc:mga0yw44_61710_c1 | 3300050492 | Unclassified | 2301 |
| 574 | nmdc:mga0yw44_7_c1 | 3300050492 | Bacteria | 260877 |
| 575 | nmdc:mga0k408_110_c1 | 3300050493 | Bacteria | 26135 |
| 576 | nmdc:mga0k408_1164_c1 | 3300050493 | Bacteria | 14396 |
| 577 | nmdc:mga0k408_1263_c1 | 3300050493 | Bacteria | 13769 |
| 578 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 579 | nmdc:mga0k408_32_c1 | 3300050493 | Bacteria | 81544 |
| 580 | nmdc:mga0k408_40_c1 | 3300050493 | Bacteria | 66012 |
| 581 | nmdc:mga0k408_762_c2 | 3300050493 | Bacteria | 12965 |
| 582 | nmdc:mga06z11_10_c1 | 3300050494 | Bacteria | 105982 |
| 583 | nmdc:mga06z11_290_c1 | 3300050494 | Bacteria | 19457 |
| 584 | nmdc:mga06z11_479_c1 | 3300050494 | Bacteria | 14718 |
| 585 | nmdc:mga04h51_124_c1 | 3300050495 | Bacteria | 22571 |
| 586 | nmdc:mga04h51_2_c1 | 3300050495 | Bacteria | 215993 |
| 587 | nmdc:mga07m45_108699_c2 | 3300050496 | Bacteria | 1043 |
| 588 | nmdc:mga07m45_12648_c1 | 3300050496 | Bacteria | 4463 |
| 589 | nmdc:mga07m45_30655_c1 | 3300050496 | Unclassified | 2979 |
| 590 | nmdc:mga07m45_3254_c1 | 3300050496 | Bacteria | 7810 |
| 591 | nmdc:mga07m45_796_c1 | 3300050496 | Bacteria | 13571 |
| 592 | nmdc:mga0qj67_50842_c1 | 3300050509 | Bacteria | 3277 |
| 593 | nmdc:mga08y16_287_c1 | 3300050511 | Bacteria | 45722 |
| 594 | nmdc:mga0sz30_10_c1 | 3300050516 | Bacteria | 37628 |
| 595 | nmdc:mga0sz30_23593_c1 | 3300050516 | Bacteria | 2505 |
| 596 | nmdc:mga0sz30_2_c1 | 3300050516 | Bacteria | 626403 |
| 597 | Ga0500610_0000009 | 3300053079 | Bacteria | 105876 |
| 598 | Ga0500643_000009 | 3300053087 | Bacteria | 444150 |
| 599 | Ga0500643_000061 | 3300053087 | Bacteria | 127538 |
| 600 | Ga0500643_000157 | 3300053087 | Bacteria | 68258 |
| 601 | Ga0500643_002699 | 3300053087 | Bacteria | 8918 |
| 602 | Ga0500643_004094 | 3300053087 | Bacteria | 6718 |
| 603 | Ga0500643_009300 | 3300053087 | Bacteria | 3763 |
| 604 | Ga0500644_0000137 | 3300053088 | Bacteria | 45112 |
| 605 | Ga0500644_0000937 | 3300053088 | Bacteria | 9246 |
| 606 | Ga0500644_0001197 | 3300053088 | Bacteria | 7346 |
| 607 | Ga0500646_0000102 | 3300053090 | Bacteria | 24333 |
| 608 | Ga0500583_0000119 | 3300053092 | Bacteria | 37999 |
| 609 | Ga0500583_0032555 | 3300053092 | Bacteria | 2301 |
| 610 | Ga0500583_0058538 | 3300053092 | Bacteria | 1812 |
| 611 | Ga0500651_0000043 | 3300053093 | Bacteria | 86502 |
| 612 | Ga0500651_0000682 | 3300053093 | Bacteria | 16847 |
| 613 | Ga0500651_0002680 | 3300053093 | Bacteria | 9479 |
| 614 | Ga0500651_0123256 | 3300053093 | Unclassified | 1572 |
| 615 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 616 | Ga0500650_0000003 | 3300053098 | Bacteria | 164144 |
| 617 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 618 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 619 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 620 | Ga0500562_006712 | 3300053108 | Bacteria | 2901 |
| 621 | Ga0500593_000001 | 3300053117 | Bacteria | 784404 |
| 622 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 623 | Ga0500594_0000019 | 3300053118 | Bacteria | 56688 |
| 624 | Ga0500594_0000028 | 3300053118 | Bacteria | 50845 |
| 625 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 626 | Ga0500614_003637 | 3300053123 | Bacteria | 3309 |
| 627 | Ga0500628_000005 | 3300053129 | Bacteria | 201423 |
| 628 | Ga0500642_0000792 | 3300053130 | Bacteria | 9273 |
| 629 | Ga0500652_000012 | 3300053131 | Bacteria | 155076 |
| 630 | Ga0500655_000190 | 3300053133 | Bacteria | 14921 |
| 631 | Ga0500655_000280 | 3300053133 | Bacteria | 11753 |
| 632 | Ga0500559_0032147 | 3300053136 | Unclassified | 2254 |
| 633 | Ga0500561_0000002 | 3300053137 | Bacteria | 394147 |
| 634 | Ga0500577_0000913 | 3300053142 | Bacteria | 7645 |
| 635 | Ga0500577_0001732 | 3300053142 | Bacteria | 5594 |
| 636 | Ga0500577_0003508 | 3300053142 | Bacteria | 4075 |
| 637 | Ga0500579_000692 | 3300053143 | Bacteria | 19430 |
| 638 | Ga0500589_000003 | 3300053147 | Bacteria | 220717 |
| 639 | Ga0500604_0069206 | 3300053151 | Bacteria | 1122 |
| 640 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 641 | Ga0500616_0000067 | 3300053153 | Bacteria | 236311 |
| 642 | Ga0500649_000006 | 3300053722 | Bacteria | 116211 |
| 643 | Ga0500570_000001 | 3300053724 | Bacteria | 243552 |
| 644 | Ga0500570_002444 | 3300053724 | Bacteria | 9237 |
| 645 | Ga0500611_000379 | 3300053727 | Bacteria | 4533 |
| 646 | Ga0501084_0167366 | 3300054114 | Unclassified | 1855 |
| 647 | Ga0501082_0013374 | 3300060353 | Bacteria | 7056 |
| 648 | Ga0070680_100005121 | |||
| 649 | MBSR1b_contig_3495855 | |||
| 650 | JGI24741J21665_1001677 | |||
| 651 | JGI24741J21665_1001833 | |||
| 652 | JGI24740J21852_10006473 | |||
| 653 | JGI24740J21852_10007043 | |||
| 654 | JGI24740J21852_10016764 | |||
| 655 | JGI24739J22299_10002568 | |||
| 656 | JGI24737J22298_10000003 | |||
| 657 | JGI24737J22298_10000111 | |||
| 658 | JGI24743J22301_10000261 | |||
| 659 | JGI24735J21928_10000022 | |||
| 660 | JGI24735J21928_10000049 | |||
| 661 | JGI24738J21930_10003919 | |||
| 662 | JGI24738J21930_10004073 | |||
| 663 | JGI24742J22300_10000001 | |||
| 664 | rootH2_10000311 | |||
| 665 | rootH2_10004334 | |||
| 666 | rootL2_10021337 | |||
| 667 | rootH1_10001727 | |||
| 668 | rootH1_10008297 | |||
| 669 | rootH1_10159927 | |||
| 670 | rootH1_10270649 | |||
| 671 | JGI26128J50194_1000010 | |||
| 672 | Ga0065715_10125503 | |||
| 673 | Ga0070658_10000009 | |||
| 674 | Ga0070658_10000076 | |||
| 675 | Ga0070658_10000336 | |||
| 676 | Ga0070658_10000660 | |||
| 677 | Ga0070658_10002074 | |||
| 678 | Ga0070658_10004103 | |||
| 679 | Ga0070658_10009224 | |||
| 680 | Ga0070658_10104220 | |||
| 681 | Ga0070658_10142711 | |||
| 682 | Ga0070658_10266400 | |||
| 683 | Ga0070676_10002768 | |||
| 684 | Ga0070676_10005817 | |||
| 685 | Ga0070683_100001058 | |||
| 686 | Ga0070683_100001106 | |||
| 687 | Ga0070683_100002025 | |||
| 688 | Ga0070683_100308284 | |||
| 689 | Ga0070690_100001938 | |||
| 690 | Ga0070666_10113845 | |||
| 691 | Ga0070666_10153450 | |||
| 692 | Ga0070680_100007110 | |||
| 693 | Ga0070680_100015551 | |||
| 694 | Ga0070680_100051485 | |||
| 695 | Ga0070682_100115705 | |||
| 696 | Ga0070660_100000119 | |||
| 697 | Ga0070660_100003520 | |||
| 698 | Ga0070660_100004938 | |||
| 699 | Ga0070660_100006526 | |||
| 700 | Ga0070660_100008797 | |||
| 701 | Ga0070660_100068613 | |||
| 702 | Ga0070691_10000916 | |||
| 703 | Ga0070661_100010783 | |||
| 704 | Ga0070661_100039905 | |||
| 705 | Ga0070692_10042836 | |||
| 706 | Ga0070668_100042546 | |||
| 707 | Ga0070668_100158134 | |||
| 708 | Ga0070669_100461091 | |||
| 709 | Ga0070675_100041801 | |||
| 710 | Ga0070675_100355771 | |||
| 711 | Ga0070671_100000001 | |||
| 712 | Ga0070671_100083437 | |||
| 713 | Ga0070674_100001494 | |||
| 714 | Ga0070674_100015527 | |||
| 715 | Ga0070673_100008235 | |||
| 716 | Ga0070673_100276157 | |||
| 717 | Ga0070659_100000780 | |||
| 718 | Ga0070659_100003167 | |||
| 719 | Ga0070659_100060477 | |||
| 720 | Ga0070659_100118898 | |||
| 721 | Ga0070667_100000001 | |||
| 722 | Ga0070667_100132915 | |||
| 723 | Ga0070714_100000871 | |||
| 724 | Ga0070713_100381523 | |||
| 725 | Ga0070663_100033373 | |||
| 726 | Ga0070663_100234612 | |||
| 727 | Ga0070678_100000753 | |||
| 728 | Ga0070678_100010185 | |||
| 729 | Ga0070662_100011590 | |||
| 730 | Ga0070681_10037793 | |||
| 731 | Ga0070681_10210323 | |||
| 732 | Ga0070681_10303727 | |||
| 733 | Ga0068867_100022709 | |||
| 734 | Ga0070685_10001093 | |||
| 735 | Ga0070685_10002310 | |||
| 736 | Ga0070679_100001517 | |||
| 737 | Ga0070679_100003722 | |||
| 738 | Ga0070679_100005533 | |||
| 739 | Ga0070679_100021096 | |||
| 740 | Ga0070679_100559472 | |||
| 741 | Ga0070684_100000860 | |||
| 742 | Ga0070684_100007560 | |||
| 743 | Ga0070684_100024870 | |||
| 744 | Ga0070684_100028413 | |||
| 745 | Ga0070684_100075791 | |||
| 746 | Ga0068853_100018528 | |||
| 747 | Ga0068853_100175605 | |||
| 748 | Ga0068853_100176886 | |||
| 749 | Ga0070686_100007189 | |||
| 750 | Ga0070686_100017663 | |||
| 751 | Ga0070665_100130965 | |||
| 752 | Ga0070665_100799270 | |||
| 753 | Ga0068855_100000001 | |||
| 754 | Ga0068855_100000002 | |||
| 755 | Ga0068855_100000017 | |||
| 756 | Ga0068855_100002485 | |||
| 757 | Ga0068855_100006018 | |||
| 758 | Ga0068855_100011195 | |||
| 759 | Ga0068855_100025370 | |||
| 760 | Ga0068855_100079325 | |||
| 761 | Ga0070664_100000165 | |||
| 762 | Ga0070664_100153013 | |||
| 763 | Ga0070664_100257093 | |||
| 764 | Ga0068857_100000001 | |||
| 765 | Ga0068857_100000266 | |||
| 766 | Ga0068857_100163368 | |||
| 767 | Ga0068856_100000002 | |||
| 768 | Ga0068856_100000441 | |||
| 769 | Ga0068856_100001703 | |||
| 770 | Ga0068856_100002784 | |||
| 771 | Ga0068856_100036064 | |||
| 772 | Ga0068856_100045294 | |||
| 773 | Ga0068856_100119495 | |||
| 774 | Ga0068852_100000173 | |||
| 775 | Ga0068852_100037934 | |||
| 776 | Ga0068864_100530073 | |||
| 777 | Ga0068863_100029972 | |||
| 778 | Ga0068863_100121081 | |||
| 779 | Ga0068858_100014703 | |||
| 780 | Ga0068860_100021321 | |||
| 781 | Ga0081455_10000020 | |||
| 782 | Ga0081539_10013697 | |||
| 783 | Ga0075365_10000007 | |||
| 784 | Ga0075365_10001244 | |||
| 785 | Ga0075365_10025938 | |||
| 786 | Ga0075368_10000090 | |||
| 787 | Ga0075368_10000174 | |||
| 788 | Ga0075363_100000147 | |||
| 789 | Ga0075363_100000352 | |||
| 790 | Ga0075364_10000111 | |||
| 791 | Ga0075364_10000937 | |||
| 792 | Ga0075364_10013165 | |||
| 793 | Ga0075367_10000296 | |||
| 794 | Ga0075367_10000339 | |||
| 795 | Ga0075367_10029637 | |||
| 796 | Ga0075369_10000004 | |||
| 797 | Ga0075369_10000031 | |||
| 798 | Ga0075369_10003342 | |||
| 799 | Ga0075366_10000003 | |||
| 800 | Ga0075366_10000010 | |||
| 801 | Ga0075366_10000096 | |||
| 802 | Ga0075366_10000204 | |||
| 803 | Ga0075366_10000978 | |||
| 804 | Ga0075366_10001219 | |||
| 805 | Ga0075366_10003860 | |||
| 806 | Ga0097621_100000001 | |||
| 807 | Ga0097621_100000052 | |||
| 808 | Ga0097621_100035651 | |||
| 809 | Ga0097621_100162187 | |||
| 810 | Ga0075370_10000990 | |||
| 811 | Ga0075370_10001566 | |||
| 812 | Ga0075370_10031451 | |||
| 813 | Ga0075370_10144555 | |||
| 814 | Ga0068871_100000001 | |||
| 815 | Ga0068871_100000006 | |||
| 816 | Ga0068871_100005288 | |||
| 817 | Ga0068871_100442801 | |||
| 818 | Ga0075428_100007820 | |||
| 819 | Ga0075428_100099923 | |||
| 820 | Ga0075430_100060256 | |||
| 821 | Ga0068865_100000106 | |||
| 822 | Ga0105240_10000003 | |||
| 823 | Ga0105240_10000030 | |||
| 824 | Ga0105240_10000886 | |||
| 825 | Ga0105240_10005930 | |||
| 826 | Ga0105240_10023635 | |||
| 827 | Ga0105240_10045972 | |||
| 828 | Ga0105240_10291984 | |||
| 829 | Ga0111539_10000377 | |||
| 830 | Ga0105245_10000001 | |||
| 831 | Ga0105245_10000096 | |||
| 832 | Ga0105245_10000127 | |||
| 833 | Ga0105245_10030451 | |||
| 834 | Ga0105245_10054517 | |||
| 835 | Ga0105245_10165200 | |||
| 836 | Ga0105245_10209908 | |||
| 837 | Ga0105245_10574204 | |||
| 838 | Ga0105243_10000001 | |||
| 839 | Ga0105243_10006155 | |||
| 840 | Ga0105241_10000009 | |||
| 841 | Ga0105241_10001013 | |||
| 842 | Ga0105241_10016697 | |||
| 843 | Ga0105241_10278601 | |||
| 844 | Ga0105242_10000001 | |||
| 845 | Ga0105242_10017653 | |||
| 846 | Ga0105242_10022217 | |||
| 847 | Ga0105242_10158997 | |||
| 848 | Ga0105248_10019320 | |||
| 849 | Ga0105248_10032935 | |||
| 850 | Ga0105237_10000001 | |||
| 851 | Ga0105237_10069677 | |||
| 852 | Ga0105237_10091215 | |||
| 853 | Ga0105237_10223307 | |||
| 854 | Ga0105237_10378437 | |||
| 855 | Ga0105238_10000462 | |||
| 856 | Ga0105238_10000614 | |||
| 857 | Ga0105238_10041162 | |||
| 858 | Ga0105238_10145740 | |||
| 859 | Ga0105249_10016080 | |||
| 860 | Ga0105249_10032436 | |||
| 861 | Ga0105032_100012 | |||
| 862 | Ga0105029_100012 | |||
| 863 | Ga0105033_102652 | |||
| 864 | Ga0105030_103048 | |||
| 865 | Ga0105028_100146 | |||
| 866 | Ga0105239_10000481 | |||
| 867 | Ga0105239_10001159 | |||
| 868 | Ga0105239_10008373 | |||
| 869 | Ga0105239_10009209 | |||
| 870 | Ga0105239_10009667 | |||
| 871 | Ga0105246_10000266 | |||
| 872 | Ga0105246_10000412 | |||
| 873 | Ga0105246_10018155 | |||
| 874 | Ga0157373_10000092 | |||
| 875 | Ga0157373_10011488 | |||
| 876 | Ga0157373_10013776 | |||
| 877 | Ga0157373_10013808 | |||
| 878 | Ga0157373_10039112 | |||
| 879 | Ga0157371_10000207 | |||
| 880 | Ga0157371_10001079 | |||
| 881 | Ga0157371_10265140 | |||
| 882 | Ga0157370_10000232 | |||
| 883 | Ga0157370_10001387 | |||
| 884 | Ga0157370_10017785 | |||
| 885 | Ga0157370_10162790 | |||
| 886 | Ga0157370_10172680 | |||
| 887 | Ga0157370_10186063 | |||
| 888 | Ga0157370_10286963 | |||
| 889 | Ga0157369_10000227 | |||
| 890 | Ga0157369_10000826 | |||
| 891 | Ga0157369_10001538 | |||
| 892 | Ga0157369_10009515 | |||
| 893 | Ga0157369_10014799 | |||
| 894 | Ga0157369_10019327 | |||
| 895 | Ga0157369_10080347 | |||
| 896 | Ga0157369_10408205 | |||
| 897 | Ga0157374_10000014 | |||
| 898 | Ga0157374_10000487 | |||
| 899 | Ga0157374_10000590 | |||
| 900 | Ga0157374_10001044 | |||
| 901 | Ga0157374_10004448 | |||
| 902 | Ga0157374_10011016 | |||
| 903 | Ga0157374_10049239 | |||
| 904 | Ga0157378_10024663 | |||
| 905 | Ga0157378_10539178 | |||
| 906 | Ga0163162_10040536 | |||
| 907 | Ga0157372_10000007 | |||
| 908 | Ga0157372_10000487 | |||
| 909 | Ga0157372_10023088 | |||
| 910 | Ga0157372_10139101 | |||
| 911 | Ga0157372_10147165 | |||
| 912 | Ga0157372_10156090 | |||
| 913 | Ga0157372_10512390 | |||
| 914 | Ga0157372_10582298 | |||
| 915 | Ga0157375_10371729 | |||
| 916 | Ga0157514_114767 | |||
| 917 | Ga0163163_10000544 | |||
| 918 | Ga0163163_10098256 | |||
| 919 | Ga0163163_10124000 | |||
| 920 | Ga0157380_10032740 | |||
| 921 | Ga0157377_10000096 | |||
| 922 | Ga0157377_10013649 | |||
| 923 | Ga0157377_10046720 | |||
| 924 | Ga0157379_10048717 | |||
| 925 | Ga0157376_10000001 | |||
| 926 | Ga0157376_10000223 | |||
| 927 | Ga0157376_10009574 | |||
| 928 | Ga0207680_10097395 | |||
| 929 | Ga0207647_10000087 | |||
| 930 | Ga0207647_10000364 | |||
| 931 | Ga0207645_10002614 | |||
| 932 | Ga0207705_10000010 | |||
| 933 | Ga0207705_10000019 | |||
| 934 | Ga0207705_10001259 | |||
| 935 | Ga0207705_10002528 | |||
| 936 | Ga0207705_10003091 | |||
| 937 | Ga0207705_10105430 | |||
| 938 | Ga0207705_10208873 | |||
| 939 | Ga0207654_10000002 | |||
| 940 | Ga0207654_10006369 | |||
| 941 | Ga0207707_10083400 | |||
| 942 | Ga0207707_10103450 | |||
| 943 | Ga0207695_10000005 | |||
| 944 | Ga0207695_10000009 | |||
| 945 | Ga0207695_10004142 | |||
| 946 | Ga0207695_10026439 | |||
| 947 | Ga0207695_10052099 | |||
| 948 | Ga0207695_10312989 | |||
| 949 | Ga0207671_10000003 | |||
| 950 | Ga0207671_10000055 | |||
| 951 | Ga0207671_10070626 | |||
| 952 | Ga0207671_10125235 | |||
| 953 | Ga0207671_10136609 | |||
| 954 | Ga0207660_10025211 | |||
| 955 | Ga0207660_10296788 | |||
| 956 | Ga0207657_10000226 | |||
| 957 | Ga0207657_10000547 | |||
| 958 | Ga0207657_10001044 | |||
| 959 | Ga0207657_10003587 | |||
| 960 | Ga0207657_10015715 | |||
| 961 | Ga0207657_10016318 | |||
| 962 | Ga0207657_10077033 | |||
| 963 | Ga0207649_10003514 | |||
| 964 | Ga0207649_10013134 | |||
| 965 | Ga0207652_10002361 | |||
| 966 | Ga0207652_10007010 | |||
| 967 | Ga0207652_10010276 | |||
| 968 | Ga0207652_10135222 | |||
| 969 | Ga0207652_10481380 | |||
| 970 | Ga0207681_10416233 | |||
| 971 | Ga0207694_10001197 | |||
| 972 | Ga0207694_10002622 | |||
| 973 | Ga0207694_10097431 | |||
| 974 | Ga0207694_10099362 | |||
| 975 | Ga0207687_10000001 | |||
| 976 | Ga0207687_10000004 | |||
| 977 | Ga0207687_10000008 | |||
| 978 | Ga0207687_10002335 | |||
| 979 | Ga0207687_10017066 | |||
| 980 | Ga0207687_10066693 | |||
| 981 | Ga0207687_10391914 | |||
| 982 | Ga0207664_10000779 | |||
| 983 | Ga0207644_10000001 | |||
| 984 | Ga0207644_10040907 | |||
| 985 | Ga0207690_10001999 | |||
| 986 | Ga0207690_10007260 | |||
| 987 | Ga0207690_10137643 | |||
| 988 | Ga0207706_10000464 | |||
| 989 | Ga0207686_10000001 | |||
| 990 | Ga0207686_10041909 | |||
| 991 | Ga0207686_10090595 | |||
| 992 | Ga0207709_10000002 | |||
| 993 | Ga0207709_10006987 | |||
| 994 | Ga0207669_10017864 | |||
| 995 | Ga0207704_10000067 | |||
| 996 | Ga0207711_10170450 | |||
| 997 | Ga0207661_10000449 | |||
| 998 | Ga0207661_10000789 | |||
| 999 | Ga0207661_10003099 | |||
| 1000 | Ga0207679_10000214 | |||
| 1001 | Ga0207679_10214574 | |||
| 1002 | Ga0207679_10412261 | |||
| 1003 | Ga0207667_10000003 | |||
| 1004 | Ga0207667_10000005 | |||
| 1005 | Ga0207667_10000048 | |||
| 1006 | Ga0207667_10001110 | |||
| 1007 | Ga0207667_10001670 | |||
| 1008 | Ga0207667_10005892 | |||
| 1009 | Ga0207667_10023464 | |||
| 1010 | Ga0207667_10120567 | |||
| 1011 | Ga0207667_10312915 | |||
| 1012 | Ga0207651_10004696 | |||
| 1013 | Ga0207712_10167595 | |||
| 1014 | Ga0207668_10255983 | |||
| 1015 | Ga0207658_10000003 | |||
| 1016 | Ga0207658_10247405 | |||
| 1017 | Ga0207703_10003878 | |||
| 1018 | Ga0207678_10202320 | |||
| 1019 | Ga0207702_10000001 | |||
| 1020 | Ga0207702_10000079 | |||
| 1021 | Ga0207702_10000871 | |||
| 1022 | Ga0207702_10009162 | |||
| 1023 | Ga0207702_10105655 | |||
| 1024 | Ga0207702_10162430 | |||
| 1025 | Ga0207641_10019307 | |||
| 1026 | Ga0207674_10000021 | |||
| 1027 | Ga0207674_10000486 | |||
| 1028 | Ga0207674_10019441 | |||
| 1029 | Ga0207674_10455593 | |||
| 1030 | Ga0207674_10520866 | |||
| 1031 | Ga0207683_10002619 | |||
| 1032 | Ga0207683_10033236 | |||
| 1033 | Ga0207698_10000139 | |||
| 1034 | Ga0207698_10006195 | |||
| 1035 | Ga0207698_10032472 | |||
| 1036 | Ga0209966_1000038 | |||
| 1037 | Ga0209813_10000002 | |||
| 1038 | Ga0209813_10000225 | |||
| 1039 | Ga0268266_10002030 | |||
| 1040 | Ga0268265_10086352 | |||
| 1041 | Ga0268264_10060350 | |||
| 1042 | Ga0265337_1000264 | |||
| 1043 | Ga0265337_1002700 | |||
| 1044 | Ga0265337_1003472 | |||
| 1045 | Ga0265337_1010798 | |||
| 1046 | Ga0265326_10000254 | |||
| 1047 | Ga0265326_10000609 | |||
| 1048 | Ga0265326_10003463 | |||
| 1049 | Ga0265326_10007146 | |||
| 1050 | Ga0265319_1004475 | |||
| 1051 | Ga0265319_1004753 | |||
| 1052 | Ga0265334_10000039 | |||
| 1053 | Ga0265334_10000041 | |||
| 1054 | Ga0265334_10003925 | |||
| 1055 | Ga0265334_10004342 | |||
| 1056 | Ga0265334_10009480 | |||
| 1057 | Ga0265318_10002951 | |||
| 1058 | Ga0265318_10043163 | |||
| 1059 | Ga0265322_10001725 | |||
| 1060 | Ga0265322_10029066 | |||
| 1061 | Ga0265336_10000222 | |||
| 1062 | Ga0265336_10001638 | |||
| 1063 | Ga0265336_10003428 | |||
| 1064 | Ga0265336_10005251 | |||
| 1065 | Ga0265338_10000003 | |||
| 1066 | Ga0265338_10000268 | |||
| 1067 | Ga0265338_10000368 | |||
| 1068 | Ga0265338_10000462 | |||
| 1069 | Ga0265338_10000684 | |||
| 1070 | Ga0265338_10001220 | |||
| 1071 | Ga0265338_10001448 | |||
| 1072 | Ga0265338_10001797 | |||
| 1073 | Ga0265338_10004432 | |||
| 1074 | Ga0265338_10005190 | |||
| 1075 | Ga0265338_10005849 | |||
| 1076 | Ga0265338_10010472 | |||
| 1077 | Ga0265338_10011114 | |||
| 1078 | Ga0265338_10012076 | |||
| 1079 | Ga0265338_10013408 | |||
| 1080 | Ga0265338_10016754 | |||
| 1081 | Ga0265338_10066423 | |||
| 1082 | Ga0265338_10334616 | |||
| 1083 | Ga0265324_10001402 | |||
| 1084 | Ga0265324_10003905 | |||
| 1085 | Ga0314311_1014870 | |||
| 1086 | Ga0314311_1186753 | |||
| 1087 | Ga0316179_1028359 | |||
| 1088 | Ga0316179_1084076 | |||
| 1089 | Ga0316183_1053060 | |||
| 1090 | Ga0316183_1176785 | |||
| 1091 | Ga0316181_1123581 | |||
| 1092 | Ga0316181_1247702 | |||
| 1093 | Ga0316182_1253872 | |||
| 1094 | Ga0316182_1303601 | |||
| 1095 | Ga0265332_10001718 | |||
| 1096 | Ga0265332_10055700 | |||
| 1097 | Ga0265328_10007589 | |||
| 1098 | Ga0265320_10002894 | |||
| 1099 | Ga0265320_10008248 | |||
| 1100 | Ga0265325_10007748 | |||
| 1101 | Ga0265340_10001780 | |||
| 1102 | Ga0265339_10013676 | |||
| 1103 | Ga0265331_10002567 | |||
| 1104 | Ga0265331_10071524 | |||
| 1105 | Ga0265327_10000025 | |||
| 1106 | Ga0265327_10001269 | |||
| 1107 | Ga0265327_10006169 | |||
| 1108 | Ga0265327_10010462 | |||
| 1109 | Ga0265316_10000892 | |||
| 1110 | Ga0265316_10141266 | |||
| 1111 | Ga0265313_10009822 | |||
| 1112 | Ga0265313_10010047 | |||
| 1113 | Ga0265313_10046705 | |||
| 1114 | Ga0265342_10012751 | |||
| 1115 | Ga0307516_10000003 | |||
| 1116 | Ga0307405_10007005 | |||
| 1117 | Ga0307406_10000001 | |||
| 1118 | Ga0307406_10001800 | |||
| 1119 | Ga0307412_10016291 | |||
| 1120 | Ga0395899_0000969 | |||
| 1121 | Ga0395899_0091270 | |||
| 1122 | Ga0395899_0109144 | |||
| 1123 | Ga0395900_0000001 | |||
| 1124 | Ga0395900_0000612 | |||
| 1125 | Ga0395900_0002229 | |||
| 1126 | Ga0395900_0038455 | |||
| 1127 | Ga0395900_0040151 | |||
| 1128 | Ga0395900_0122900 | |||
| 1129 | Ga0395898_0000002 | |||
| 1130 | Ga0395898_0004280 | |||
| 1131 | Ga0395898_0008209 | |||
| 1132 | Ga0395898_0085328 | |||
| 1133 | Ga0395898_0332884 | |||
| 1134 | Ga0395905_0003752 | |||
| 1135 | Ga0395905_0026251 | |||
| 1136 | Ga0395905_0224504 | |||
| 1137 | Ga0395901_0000006 | |||
| 1138 | Ga0395901_0000815 | |||
| 1139 | Ga0395901_0001516 | |||
| 1140 | Ga0395901_0025010 | |||
| 1141 | Ga0395901_0030978 | |||
| 1142 | Ga0395901_0070485 | |||
| 1143 | Ga0395901_0091879 | |||
| 1144 | Ga0395901_0206424 | |||
| 1145 | Ga0439445_0000130 | |||
| 1146 | Ga0439432_022498 | |||
| 1147 | Ga0439463_001787 | |||
| 1148 | Ga0450906_000203 | |||
| 1149 | Ga0450909_001048 | |||
| 1150 | Ga0439464_0000001 | |||
| 1151 | Ga0450918_007118 | |||
| 1152 | Ga0451577_0000021 | |||
| 1153 | Ga0466965_0000131 | |||
| 1154 | Ga0453684_0000073 | |||
| 1155 | Ga0495629_0190325 | |||
| 1156 | Ga0495622_0001254 | |||
| 1157 | Ga0495634_0099711 | |||
| 1158 | Ga0495588_0000186 | |||
| 1159 | Ga0495670_0099995 | |||
| 1160 | Ga0495649_0000209 | |||
| 1161 | Ga0495600_0010909 | |||
| 1162 | Ga0495672_0000284 | |||
| 1163 | Ga0495686_0012388 | |||
| 1164 | Ga0495602_0152301 | |||
| 1165 | Ga0496109_0065395 | |||
| 1166 | Ga0496124_0007711 | |||
| 1167 | Ga0496125_0107257 | |||
| 1168 | Ga0496126_0052748 | |||
| 1169 | Ga0501031_0000327 | |||
| 1170 | Ga0501032_0000934 | |||
| 1171 | Ga0501033_0056714 | |||
| 1172 | Ga0501033_0097488 | |||
| 1173 | Ga0501033_0201409 | |||
| 1174 | Ga0501034_0000460 | |||
| 1175 | Ga0501034_0006072 | |||
| 1176 | Ga0501034_0015024 | |||
| 1177 | Ga0501034_0214510 | |||
| 1178 | Ga0501034_0406437 | |||
| 1179 | Ga0501036_0016677 | |||
| 1180 | Ga0501036_0021747 | |||
| 1181 | Ga0501037_0000597 | |||
| 1182 | Ga0501037_0007668 | |||
| 1183 | Ga0501037_0207635 | |||
| 1184 | Ga0501038_0007214 | |||
| 1185 | Ga0501038_0056550 | |||
| 1186 | Ga0501039_0046255 | |||
| 1187 | Ga0501039_0263983 | |||
| 1188 | Ga0501042_0057748 | |||
| 1189 | Ga0501043_0000139 | |||
| 1190 | Ga0501046_0000061 | |||
| 1191 | Ga0501046_0278237 | |||
| 1192 | Ga0501047_0000024 | |||
| 1193 | Ga0501047_0004292 | |||
| 1194 | Ga0501048_0000024 | |||
| 1195 | Ga0501048_0010040 | |||
| 1196 | Ga0501070_0101118 | |||
| 1197 | Ga0501073_0050353 | |||
| 1198 | Ga0501080_0000007 | |||
| 1199 | Ga0501080_0079442 | |||
| 1200 | Ga0501080_0143541 | |||
| 1201 | Ga0501080_0467801 | |||
| 1202 | Ga0501083_0032688 | |||
| 1203 | Ga0501083_0098091 | |||
| 1204 | Ga0501035_0000005 | |||
| 1205 | Ga0501035_0000858 | |||
| 1206 | Ga0501035_0004411 | |||
| 1207 | Ga0501044_0001085 | |||
| 1208 | Ga0501044_0009816 | |||
| 1209 | Ga0501044_0307443 | |||
| 1210 | nmdc:mga03683_353_c1 | |||
| 1211 | nmdc:mga03n38_24814_c1 | |||
| 1212 | nmdc:mga03n38_419_c1 | |||
| 1213 | nmdc:mga00v17_21569_c1 | |||
| 1214 | nmdc:mga00v17_301_c1 | |||
| 1215 | nmdc:mga00v17_537_c1 | |||
| 1216 | nmdc:mga0yw44_11_c1 | |||
| 1217 | nmdc:mga0yw44_192527_c1 | |||
| 1218 | nmdc:mga0yw44_30309_c2 | |||
| 1219 | nmdc:mga0yw44_41899_c1 | |||
| 1220 | nmdc:mga0yw44_61710_c1 | |||
| 1221 | nmdc:mga0yw44_7_c1 | |||
| 1222 | nmdc:mga0k408_110_c1 | |||
| 1223 | nmdc:mga0k408_1164_c1 | |||
| 1224 | nmdc:mga0k408_1263_c1 | |||
| 1225 | nmdc:mga0k408_1_c1 | |||
| 1226 | nmdc:mga0k408_32_c1 | |||
| 1227 | nmdc:mga0k408_40_c1 | |||
| 1228 | nmdc:mga0k408_762_c2 | |||
| 1229 | nmdc:mga06z11_10_c1 | |||
| 1230 | nmdc:mga06z11_290_c1 | |||
| 1231 | nmdc:mga06z11_479_c1 | |||
| 1232 | nmdc:mga04h51_124_c1 | |||
| 1233 | nmdc:mga04h51_2_c1 | |||
| 1234 | nmdc:mga07m45_108699_c2 | |||
| 1235 | nmdc:mga07m45_12648_c1 | |||
| 1236 | nmdc:mga07m45_30655_c1 | |||
| 1237 | nmdc:mga07m45_3254_c1 | |||
| 1238 | nmdc:mga07m45_796_c1 | |||
| 1239 | nmdc:mga0qj67_50842_c1 | |||
| 1240 | nmdc:mga08y16_287_c1 | |||
| 1241 | nmdc:mga0sz30_10_c1 | |||
| 1242 | nmdc:mga0sz30_23593_c1 | |||
| 1243 | nmdc:mga0sz30_2_c1 | |||
| 1244 | Ga0500610_0000009 | |||
| 1245 | Ga0500643_000009 | |||
| 1246 | Ga0500643_000061 | |||
| 1247 | Ga0500643_000157 | |||
| 1248 | Ga0500643_002699 | |||
| 1249 | Ga0500643_004094 | |||
| 1250 | Ga0500643_009300 | |||
| 1251 | Ga0500644_0000137 | |||
| 1252 | Ga0500644_0000937 | |||
| 1253 | Ga0500644_0001197 | |||
| 1254 | Ga0500646_0000102 | |||
| 1255 | Ga0500583_0000119 | |||
| 1256 | Ga0500583_0032555 | |||
| 1257 | Ga0500583_0058538 | |||
| 1258 | Ga0500651_0000043 | |||
| 1259 | Ga0500651_0000682 | |||
| 1260 | Ga0500651_0002680 | |||
| 1261 | Ga0500651_0123256 | |||
| 1262 | Ga0500566_0000001 | |||
| 1263 | Ga0500650_0000003 | |||
| 1264 | Ga0500555_000001 | |||
| 1265 | Ga0500555_000002 | |||
| 1266 | Ga0500562_000002 | |||
| 1267 | Ga0500562_006712 | |||
| 1268 | Ga0500593_000001 | |||
| 1269 | Ga0500594_0000001 | |||
| 1270 | Ga0500594_0000019 | |||
| 1271 | Ga0500594_0000028 | |||
| 1272 | Ga0500614_000001 | |||
| 1273 | Ga0500614_003637 | |||
| 1274 | Ga0500628_000005 | |||
| 1275 | Ga0500642_0000792 | |||
| 1276 | Ga0500652_000012 | |||
| 1277 | Ga0500655_000190 | |||
| 1278 | Ga0500655_000280 | |||
| 1279 | Ga0500559_0032147 | |||
| 1280 | Ga0500561_0000002 | |||
| 1281 | Ga0500577_0000913 | |||
| 1282 | Ga0500577_0001732 | |||
| 1283 | Ga0500577_0003508 | |||
| 1284 | Ga0500579_000692 | |||
| 1285 | Ga0500589_000003 | |||
| 1286 | Ga0500604_0069206 | |||
| 1287 | Ga0500616_0000005 | |||
| 1288 | Ga0500616_0000067 | |||
| 1289 | Ga0500649_000006 | |||
| 1290 | Ga0500570_000001 | |||
| 1291 | Ga0500570_002444 | |||
| 1292 | Ga0500611_000379 | |||
| 1293 | Ga0501084_0167366 | |||
| 1294 | Ga0501082_0013374 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nkh-assembly1.cif.gz_A | crystal structure of integrase from mrsa strain staphylococcus aureus | 0.7751 | 113 | 307 |
| 3nkh-assembly1.cif.gz_B | crystal structure of integrase from mrsa strain staphylococcus aureus | 0.7621 | 117 | 307 |
| 2kob-assembly1.cif.gz_A | solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a | 0.7443 | 12 | 120 |
| 6en0-assembly1.cif.gz_A | structure of the tn1549 transposon integrase (aa 82-397) in complex with circular intermediate dna (ci5-dna) | 0.7132 | 8 | 298 |
| 6emy-assembly1.cif.gz_A | structure of the tn1549 transposon integrase (aa 82-397, y379f) in complex with transposon right end dna | 0.7113 | 9 | 301 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8P6_5_99_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9183 | 13 | 97 | 1.10.150.130 |
| af_P0A8P6_113_288_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.8567 | 119 | 299 | 1.10.443.10 |
| af_Q2FY74_109_289_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.8554 | 117 | 299 | 1.10.443.10 |
| af_Q2FY74_109_289_1.10.443.10 | Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core | 0.8421 | 117 | 299 | 1.10.443.10 |
| af_P9WF33_5_106_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.8405 | 13 | 97 | 1.10.150.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4H0X7-F1-model_v4 | Tyr recombinase domain-containing protein | 0.9521 | 119 | 200 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-A0A350R3F4-F1-model_v4 | Integrase | 0.9129 | 124 | 283 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-A0A136KHS5-F1-model_v4 | Tyrosine recombinase XerD | 0.9114 | 9 | 279 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-X0VK10-F1-model_v4 | Tyr recombinase domain-containing protein | 0.9046 | 106 | 211 |
GO:0003677
GO:0006310 GO:0015074 |
| AF-A0A7T5UNS9-F1-model_v4 | Tyrosine-type recombinase/integrase | 0.8873 | 9 | 252 |
GO:0003677
GO:0004519 GO:0006310 GO:0015074 GO:0016539 |