F472257

General Info

Members Datasets Scaffolds Average Seq Length
647 273 626 850

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100013651|Ga0070680_1000136514
Length 914
Sequence MGAFAMTNRTVRALTVGFLASTALAPPLWAADSQPQTTGQSPAPATNATDVTAPPPKVQQAQQGQVPDQSEIIITATKREENLQNVPISVQVLGNRRLDQLNISNFEQFTKQLPSVSFLEYQPGQTTVYMRGISSSGGSNSEGNHSGPLPQVGFYLDEQPITTIGGTLDVHIYDIARIENLSGPQGTLYGASSEAGTIRIITNKPELGRTYGRVDAEVNSVDHGGIGGKLEGMINLPLTSRIAFRGVAFDQRDAGFIDNVFGSRTYCGTTITDPVTQAAIGCVLDGPTVTNAGLVKKNFNYQDVYGGRAALKIDLDDNWTAEPTFMYQKSYANGVFFYDPKLGDLKIDRFRHEWSKDRFWQAALTLQGKIANFDVTYAGAYMDRPNKGINDYADYTDQYDRLYQSVGGLAYYFYLQDAAGNFVANPQQWIKGSNHFRKLSQELRFASPIENPFRVIAGAFYQRQSNFIHQDYKVDDLGPQVSVNGHTGTLWLTQQERVDRDYALFGEASWDVLPKVTLTAGARAFRYDNSLVGFFGFGRNPAGDFTSKPFNAAGSSHTGVVSCFLNNGETLGQAVANGEDVTGIGFAPAVVPGSPCTNLGVFSNGNVLPKHAKGSGVTWRFNGQWKPRNNLMFYATWSKGFRPGGINRRGDIGPYAPDFLYNVEAGWKTTFGPIRWNGAIYHELWQAFQFAFLGANSFTEIHNGKNARVNGLETDINYIHRGLTLNATAAYTDAKTKGNICSISSDTDPNCAGVIEVDPGDFVQDFISAPSGTRLPVTPKFKGSASARYSWPAWANVMAHVQGVVSYQGSAPSSLRTQVQLVGTDATAVCAAAGALLPDGLCDPNKFQGKLRSATLVDLYAGLDWANWNFEIFGTNIFDKRNDLSRFTACGSCTRALVVPGRPRTIGIRAGLKF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221640 Caulobacter sp. Root342 Isolate Unclassified
8 2643221642 Caulobacter sp. Root343 Isolate Unclassified
9 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
10 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
11 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
12 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
13 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
14 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
15 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
16 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
17 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
18 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
19 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
20 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
21 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
22 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
184 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
263 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
269 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
270 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
271 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
272 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
273 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 0
Isolates 3.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0
Rhizoplane 4.33
Rhizosphere 80.83
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1875504 2162886007 Bacteria 7481
2 JGI24741J21665_1001079 3300001915 Bacteria 8149
3 JGI24740J21852_10000840 3300001979 Bacteria 13577
4 JGI24740J21852_10007092 3300001979 Bacteria 4588
5 JGI24739J22299_10004250 3300001989 Bacteria 5484
6 JGI24739J22299_10006537 3300001989 Bacteria 4390
7 JGI24739J22299_10007032 3300001989 Bacteria 4236
8 JGI24737J22298_10006121 3300001990 Bacteria 4122
9 JGI24737J22298_10006718 3300001990 Bacteria 3914
10 JGI24735J21928_10003334 3300002067 Bacteria 5479
11 JGI24735J21928_10003862 3300002067 Bacteria 5071
12 JGI24735J21928_10006678 3300002067 Bacteria 3787
13 JGI24738J21930_10001669 3300002075 Bacteria 6074
14 JGI24744J21845_10000306 3300002077 Bacteria 8226
15 JGI25153J46596_10000034 3300003215 Bacteria 192215
16 JGI25153J46596_10000097 3300003215 Bacteria 101627
17 rootH1_10043878 3300003323 Bacteria 6581
18 Ga0055525_1000058 3300003759 Bacteria 210367
19 Ga0055542_1000041 3300003762 Bacteria 208892
20 Ga0055529_1000040 3300003763 Bacteria 230562
21 Ga0055536_1004780 3300003781 Bacteria 6793
22 Ga0055536_1004876 3300003781 Bacteria 6697
23 Ga0055530_10004796 3300003791 Bacteria 6785
24 Ga0055530_10004858 3300003791 Bacteria 6708
25 Ga0055531_10004028 3300003794 Bacteria 9116
26 Ga0065165_1001810 3300005262 Bacteria 20963
27 Ga0065704_10000358 3300005289 Bacteria 27729
28 Ga0065715_10091114 3300005293 Bacteria 6098
29 Ga0070658_10000033 3300005327 Bacteria 147380
30 Ga0070658_10000809 3300005327 Bacteria 26763
31 Ga0070658_10004262 3300005327 Bacteria 11685
32 Ga0070658_10004264 3300005327 Bacteria 11685
33 Ga0070658_10009299 3300005327 Bacteria 7905
34 Ga0070658_10011699 3300005327 Bacteria 7039
35 Ga0070658_10033383 3300005327 Bacteria 4140
36 Ga0070658_10041711 3300005327 Bacteria 3703
37 Ga0070676_10022560 3300005328 Bacteria 3530
38 Ga0070683_100024730 3300005329 Bacteria 5383
39 Ga0070683_100030680 3300005329 Bacteria 4883
40 Ga0070670_100000716 3300005331 Bacteria 25784
41 Ga0070670_100000968 3300005331 Bacteria 22548
42 Ga0070670_100002741 3300005331 Bacteria 14548
43 Ga0070670_100006851 3300005331 Bacteria 9653
44 Ga0070670_100011660 3300005331 Bacteria 7517
45 Ga0070670_100011685 3300005331 Bacteria 7510
46 Ga0070670_100012862 3300005331 Bacteria 7164
47 Ga0070677_10000312 3300005333 Bacteria 16970
48 Ga0070677_10003937 3300005333 Bacteria 4819
49 Ga0070677_10004136 3300005333 Bacteria 4713
50 Ga0068869_100002970 3300005334 Bacteria 10301
51 Ga0070666_10008188 3300005335 Bacteria 6478
52 Ga0070666_10013070 3300005335 Bacteria 5259
53 Ga0070680_100005032 3300005336 Bacteria 9971
54 Ga0070680_100011326 3300005336 Bacteria 6897
55 Ga0070680_100013651 3300005336 Bacteria 6333
56 Ga0070682_100002792 3300005337 Bacteria 9674
57 Ga0068868_100000007 3300005338 Bacteria 123028
58 Ga0068868_100005974 3300005338 Bacteria 8590
59 Ga0070660_100000405 3300005339 Bacteria 28752
60 Ga0070660_100000558 3300005339 Bacteria 25015
61 Ga0070660_100001018 3300005339 Bacteria 18836
62 Ga0070660_100003320 3300005339 Bacteria 11057
63 Ga0070660_100003945 3300005339 Bacteria 10254
64 Ga0070660_100009744 3300005339 Bacteria 6770
65 Ga0070691_10002673 3300005341 Bacteria 7942
66 Ga0070661_100013928 3300005344 Bacteria 5652
67 Ga0070661_100019002 3300005344 Bacteria 4892
68 Ga0070661_100026881 3300005344 Bacteria 4142
69 Ga0070692_10002193 3300005345 Bacteria 7477
70 Ga0070692_10002664 3300005345 Bacteria 6991
71 Ga0070692_10003449 3300005345 Bacteria 6413
72 Ga0070692_10005692 3300005345 Bacteria 5347
73 Ga0070668_100001032 3300005347 Bacteria 19554
74 Ga0070668_100018211 3300005347 Bacteria 5270
75 Ga0070669_100002756 3300005353 Bacteria 12679
76 Ga0070669_100004211 3300005353 Bacteria 10406
77 Ga0070669_100005377 3300005353 Bacteria 9241
78 Ga0070669_100035785 3300005353 Bacteria 3597
79 Ga0070669_100041028 3300005353 Bacteria 3365
80 Ga0070669_100052095 3300005353 Bacteria 2993
81 Ga0070675_100000229 3300005354 Bacteria 36015
82 Ga0070675_100020437 3300005354 Bacteria 5284
83 Ga0070671_100000407 3300005355 Bacteria 29738
84 Ga0070671_100006028 3300005355 Bacteria 9659
85 Ga0070671_100006646 3300005355 Bacteria 9244
86 Ga0070671_100024136 3300005355 Bacteria 4977
87 Ga0070671_100024959 3300005355 Bacteria 4898
88 Ga0070671_100054299 3300005355 Bacteria 3331
89 Ga0070674_100003998 3300005356 Bacteria 8358
90 Ga0070674_100004843 3300005356 Bacteria 7716
91 Ga0070674_100029362 3300005356 Bacteria 3621
92 Ga0070674_100036160 3300005356 Bacteria 3312
93 Ga0070673_100005349 3300005364 Bacteria 8202
94 Ga0070673_100007945 3300005364 Bacteria 7030
95 Ga0070673_100046010 3300005364 Bacteria 3387
96 Ga0070659_100000004 3300005366 Bacteria 267958
97 Ga0070659_100003704 3300005366 Bacteria 10904
98 Ga0070659_100005033 3300005366 Bacteria 9473
99 Ga0070659_100027625 3300005366 Bacteria 4375
100 Ga0070659_100031048 3300005366 Bacteria 4136
101 Ga0070659_100044475 3300005366 Bacteria 3477
102 Ga0070667_100005475 3300005367 Bacteria 10597
103 Ga0070667_100022077 3300005367 Bacteria 5281
104 Ga0070667_100024637 3300005367 Bacteria 4999
105 Ga0070667_100025654 3300005367 Bacteria 4901
106 Ga0070667_100027117 3300005367 Bacteria 4767
107 Ga0070667_100037217 3300005367 Bacteria 4079
108 Ga0070709_10012379 3300005434 Bacteria 4774
109 Ga0070714_100010083 3300005435 Bacteria 7456
110 Ga0070713_100033381 3300005436 Bacteria 4121
111 Ga0070694_100005612 3300005444 Bacteria 7605
112 Ga0070663_100017178 3300005455 Bacteria 4716
113 Ga0070678_100003165 3300005456 Bacteria 9116
114 Ga0070678_100006758 3300005456 Bacteria 6759
115 Ga0070662_100001340 3300005457 Bacteria 15141
116 Ga0070662_100002358 3300005457 Bacteria 11608
117 Ga0070662_100002550 3300005457 Bacteria 11217
118 Ga0070662_100007374 3300005457 Bacteria 7126
119 Ga0070662_100012530 3300005457 Bacteria 5624
120 Ga0070662_100048701 3300005457 Bacteria 3053
121 Ga0068867_100002596 3300005459 Bacteria 12739
122 Ga0068867_100018239 3300005459 Bacteria 4986
123 Ga0070684_100001781 3300005535 Bacteria 15732
124 Ga0070684_100006000 3300005535 Bacteria 9359
125 Ga0070672_100001475 3300005543 Bacteria 14600
126 Ga0070672_100007220 3300005543 Bacteria 7526
127 Ga0070672_100008584 3300005543 Bacteria 6998
128 Ga0070672_100008855 3300005543 Bacteria 6912
129 Ga0070672_100010560 3300005543 Bacteria 6409
130 Ga0070686_100000465 3300005544 Bacteria 24524
131 Ga0070696_100003138 3300005546 Bacteria 11006
132 Ga0070696_100015462 3300005546 Bacteria 5124
133 Ga0070693_100017967 3300005547 Bacteria 3687
134 Ga0070665_100000493 3300005548 Bacteria 56564
135 Ga0070665_100000537 3300005548 Bacteria 53369
136 Ga0070665_100004116 3300005548 Bacteria 15300
137 Ga0070665_100004800 3300005548 Bacteria 14058
138 Ga0070665_100015800 3300005548 Bacteria 7582
139 Ga0070665_100079750 3300005548 Bacteria 3279
140 Ga0068855_100000140 3300005563 Bacteria 92525
141 Ga0070664_100000247 3300005564 Bacteria 38997
142 Ga0070664_100002842 3300005564 Bacteria 14008
143 Ga0070664_100012186 3300005564 Bacteria 6987
144 Ga0070664_100016097 3300005564 Bacteria 6129
145 Ga0070664_100016155 3300005564 Bacteria 6117
146 Ga0070664_100036818 3300005564 Bacteria 4111
147 Ga0070664_100038689 3300005564 Bacteria 4016
148 Ga0070664_100041505 3300005564 Bacteria 3882
149 Ga0068857_100031990 3300005577 Bacteria 4650
150 Ga0068857_100049656 3300005577 Bacteria 3722
151 Ga0068857_100061112 3300005577 Bacteria 3347
152 Ga0068854_100000103 3300005578 Bacteria 59186
153 Ga0068856_100068799 3300005614 Bacteria 3500
154 Ga0068856_100092404 3300005614 Bacteria 3011
155 Ga0068852_100009838 3300005616 Bacteria 7113
156 Ga0068852_100015112 3300005616 Bacteria 5972
157 Ga0068852_100036536 3300005616 Bacteria 4111
158 Ga0068852_100038415 3300005616 Bacteria 4023
159 Ga0068859_100014575 3300005617 Bacteria 7895
160 Ga0068859_100045593 3300005617 Bacteria 4404
161 Ga0068864_100000509 3300005618 Bacteria 33512
162 Ga0068864_100026843 3300005618 Bacteria 4857
163 Ga0068861_100001690 3300005719 Bacteria 14160
164 Ga0068861_100005114 3300005719 Bacteria 8845
165 Ga0068851_10009179 3300005834 Bacteria 4592
166 Ga0068863_100039037 3300005841 Bacteria 4518
167 Ga0068858_100000181 3300005842 Bacteria 66254
168 Ga0068858_100011918 3300005842 Bacteria 8194
169 Ga0068858_100013290 3300005842 Bacteria 7762
170 Ga0068858_100025525 3300005842 Bacteria 5497
171 Ga0068860_100002208 3300005843 Bacteria 20485
172 Ga0068860_100027009 3300005843 Bacteria 5531
173 Ga0068860_100069398 3300005843 Bacteria 3350
174 Ga0068862_100001874 3300005844 Bacteria 19050
175 Ga0068862_100020346 3300005844 Bacteria 5543
176 Ga0068862_100034239 3300005844 Bacteria 4296
177 Ga0068862_100040204 3300005844 Bacteria 3975
178 Ga0081539_10022127 3300005985 Bacteria 4218
179 Ga0070716_100011392 3300006173 Bacteria 4475
180 Ga0070712_100010919 3300006175 Bacteria 5743
181 Ga0075369_10001000 3300006186 Bacteria 9425
182 Ga0097621_100010698 3300006237 Bacteria 6724
183 Ga0068871_100003159 3300006358 Bacteria 11312
184 Ga0068871_100010978 3300006358 Bacteria 6634
185 Ga0068871_100017669 3300006358 Bacteria 5402
186 Ga0075431_100013164 3300006847 Bacteria 8358
187 Ga0097620_100014574 3300006931 Bacteria 7895
188 Ga0097620_100045592 3300006931 Bacteria 4404
189 Ga0105240_10002534 3300009093 Bacteria 29308
190 Ga0111539_10017555 3300009094 Bacteria 8857
191 Ga0105245_10015390 3300009098 Bacteria 6668
192 Ga0105245_10016818 3300009098 Bacteria 6386
193 Ga0105243_10033687 3300009148 Bacteria 3962
194 Ga0105241_10001067 3300009174 Bacteria 20901
195 Ga0105242_10058866 3300009176 Bacteria 3151
196 Ga0105248_10000764 3300009177 Bacteria 36109
197 Ga0105248_10001586 3300009177 Bacteria 25332
198 Ga0105248_10014710 3300009177 Bacteria 8613
199 Ga0105248_10023141 3300009177 Bacteria 6901
200 Ga0105248_10038975 3300009177 Bacteria 5320
201 Ga0105248_10055497 3300009177 Bacteria 4443
202 Ga0105237_10003027 3300009545 Bacteria 20272
203 Ga0105237_10004174 3300009545 Bacteria 16820
204 Ga0105238_10021536 3300009551 Bacteria 6566
205 Ga0105249_10052837 3300009553 Bacteria 3712
206 Ga0105239_10000156 3300010375 Bacteria 98400
207 Ga0105239_10058205 3300010375 Bacteria 4241
208 Ga0157373_10008085 3300013100 Bacteria 7818
209 Ga0157373_10012888 3300013100 Bacteria 6139
210 Ga0157373_10019689 3300013100 Bacteria 4909
211 Ga0157373_10026144 3300013100 Bacteria 4219
212 Ga0157371_10003832 3300013102 Bacteria 13423
213 Ga0157371_10013683 3300013102 Bacteria 6156
214 Ga0157371_10024820 3300013102 Bacteria 4375
215 Ga0157370_10000020 3300013104 Bacteria 166524
216 Ga0157370_10007681 3300013104 Bacteria 11703
217 Ga0157370_10018175 3300013104 Bacteria 7076
218 Ga0157370_10040877 3300013104 Bacteria 4476
219 Ga0157369_10004778 3300013105 Bacteria 15925
220 Ga0157369_10042165 3300013105 Bacteria 4979
221 Ga0157374_10024065 3300013296 Bacteria 5455
222 Ga0157374_10032783 3300013296 Bacteria 4734
223 Ga0157374_10039077 3300013296 Bacteria 4365
224 Ga0163162_10007146 3300013306 Bacteria 10838
225 Ga0163162_10010617 3300013306 Bacteria 8955
226 Ga0163162_10016336 3300013306 Bacteria 7255
227 Ga0163162_10043875 3300013306 Bacteria 4477
228 Ga0163162_10097821 3300013306 Bacteria 3023
229 Ga0157372_10035366 3300013307 Bacteria 5499
230 Ga0157375_10074288 3300013308 Bacteria 3421
231 Ga0157375_10074822 3300013308 Bacteria 3409
232 Ga0163163_10043269 3300014325 Bacteria 4414
233 Ga0157380_10000410 3300014326 Bacteria 26058
234 Ga0157379_10024736 3300014968 Bacteria 5330
235 Ga0209563_100024 3300025230 Bacteria 601155
236 Ga0209148_1000008 3300025254 Bacteria 1504371
237 Ga0209148_1000171 3300025254 Bacteria 131700
238 Ga0209148_1000934 3300025254 Bacteria 19245
239 Ga0209455_1000002 3300025272 Bacteria 1505459
240 Ga0209455_1000969 3300025272 Bacteria 14556
241 Ga0209676_1000171 3300025292 Bacteria 154045
242 Ga0209676_1000177 3300025292 Bacteria 151589
243 Ga0209758_1000007 3300025297 Bacteria 1270410
244 Ga0209050_1000837 3300025298 Bacteria 42462
245 Ga0209050_1001766 3300025298 Bacteria 21350
246 Ga0209051_1001860 3300025303 Bacteria 16592
247 Ga0209257_1000253 3300025304 Bacteria 123508
248 Ga0209257_1015520 3300025304 Bacteria 3162
249 Ga0207697_10000376 3300025315 Bacteria 24993
250 Ga0207656_10000677 3300025321 Bacteria 11171
251 Ga0207682_10000533 3300025893 Bacteria 17501
252 Ga0207682_10007714 3300025893 Bacteria 4279
253 Ga0207688_10016533 3300025901 Bacteria 4002
254 Ga0207680_10007208 3300025903 Bacteria 5406
255 Ga0207647_10000327 3300025904 Bacteria 38973
256 Ga0207647_10001105 3300025904 Bacteria 20793
257 Ga0207647_10032113 3300025904 Bacteria 3376
258 Ga0207647_10035732 3300025904 Bacteria 3164
259 Ga0207645_10003851 3300025907 Bacteria 11228
260 Ga0207645_10009540 3300025907 Bacteria 6706
261 Ga0207705_10000002 3300025909 Bacteria 2046852
262 Ga0207705_10000061 3300025909 Bacteria 150179
263 Ga0207705_10000253 3300025909 Bacteria 52359
264 Ga0207705_10001217 3300025909 Bacteria 20815
265 Ga0207705_10001405 3300025909 Bacteria 19182
266 Ga0207705_10007615 3300025909 Bacteria 7962
267 Ga0207705_10009812 3300025909 Bacteria 6969
268 Ga0207705_10013123 3300025909 Bacteria 5980
269 Ga0207705_10018592 3300025909 Bacteria 4967
270 Ga0207705_10026911 3300025909 Bacteria 4099
271 Ga0207705_10036747 3300025909 Bacteria 3504
272 Ga0207705_10037233 3300025909 Bacteria 3481
273 Ga0207705_10044181 3300025909 Bacteria 3202
274 Ga0207654_10000449 3300025911 Bacteria 23541
275 Ga0207707_10022928 3300025912 Bacteria 5460
276 Ga0207695_10000521 3300025913 Bacteria 81496
277 Ga0207695_10028754 3300025913 Bacteria 6155
278 Ga0207695_10047602 3300025913 Bacteria 4536
279 Ga0207671_10000607 3300025914 Bacteria 47542
280 Ga0207671_10008025 3300025914 Bacteria 9032
281 Ga0207671_10022956 3300025914 Bacteria 4711
282 Ga0207693_10009547 3300025915 Bacteria 7900
283 Ga0207660_10000492 3300025917 Bacteria 26361
284 Ga0207660_10017087 3300025917 Bacteria 4814
285 Ga0207657_10002527 3300025919 Bacteria 19795
286 Ga0207657_10002626 3300025919 Bacteria 19417
287 Ga0207657_10004025 3300025919 Bacteria 15608
288 Ga0207657_10004207 3300025919 Bacteria 15239
289 Ga0207657_10004892 3300025919 Bacteria 14088
290 Ga0207657_10007475 3300025919 Bacteria 11195
291 Ga0207657_10010998 3300025919 Bacteria 8995
292 Ga0207657_10011611 3300025919 Bacteria 8735
293 Ga0207657_10017525 3300025919 Bacteria 6863
294 Ga0207657_10022997 3300025919 Bacteria 5815
295 Ga0207649_10000850 3300025920 Bacteria 19631
296 Ga0207649_10016349 3300025920 Bacteria 4181
297 Ga0207649_10019224 3300025920 Bacteria 3901
298 Ga0207649_10027995 3300025920 Bacteria 3314
299 Ga0207649_10030433 3300025920 Bacteria 3197
300 Ga0207652_10016169 3300025921 Bacteria 6086
301 Ga0207681_10000926 3300025923 Bacteria 19145
302 Ga0207681_10006440 3300025923 Bacteria 7207
303 Ga0207681_10010450 3300025923 Bacteria 5680
304 Ga0207681_10011670 3300025923 Bacteria 5402
305 Ga0207650_10000200 3300025925 Bacteria 69213
306 Ga0207650_10002730 3300025925 Bacteria 12190
307 Ga0207650_10003374 3300025925 Bacteria 10996
308 Ga0207650_10004763 3300025925 Bacteria 9268
309 Ga0207650_10022295 3300025925 Bacteria 4481
310 Ga0207659_10006793 3300025926 Bacteria 7034
311 Ga0207659_10007734 3300025926 Bacteria 6634
312 Ga0207687_10018339 3300025927 Bacteria 4617
313 Ga0207644_10001728 3300025931 Bacteria 14123
314 Ga0207644_10005709 3300025931 Bacteria 8100
315 Ga0207644_10006667 3300025931 Bacteria 7524
316 Ga0207644_10014208 3300025931 Bacteria 5324
317 Ga0207644_10018036 3300025931 Bacteria 4771
318 Ga0207644_10033594 3300025931 Bacteria 3586
319 Ga0207690_10000001 3300025932 Bacteria 807539
320 Ga0207690_10000002 3300025932 Bacteria 807473
321 Ga0207690_10000003 3300025932 Bacteria 783011
322 Ga0207690_10000004 3300025932 Bacteria 746138
323 Ga0207690_10002956 3300025932 Bacteria 10241
324 Ga0207690_10008543 3300025932 Bacteria 6077
325 Ga0207690_10013353 3300025932 Bacteria 4935
326 Ga0207690_10013525 3300025932 Bacteria 4904
327 Ga0207690_10014590 3300025932 Bacteria 4746
328 Ga0207690_10015670 3300025932 Bacteria 4599
329 Ga0207706_10000480 3300025933 Bacteria 42754
330 Ga0207706_10001168 3300025933 Bacteria 26635
331 Ga0207706_10003464 3300025933 Bacteria 15067
332 Ga0207706_10005186 3300025933 Bacteria 12161
333 Ga0207706_10005358 3300025933 Bacteria 11954
334 Ga0207706_10006622 3300025933 Bacteria 10722
335 Ga0207706_10013967 3300025933 Bacteria 7282
336 Ga0207706_10017933 3300025933 Bacteria 6372
337 Ga0207706_10018415 3300025933 Bacteria 6284
338 Ga0207706_10062616 3300025933 Bacteria 3276
339 Ga0207709_10000005 3300025935 Bacteria 806813
340 Ga0207669_10011389 3300025937 Bacteria 4325
341 Ga0207665_10013292 3300025939 Bacteria 5411
342 Ga0207691_10002585 3300025940 Bacteria 17684
343 Ga0207691_10007026 3300025940 Bacteria 10861
344 Ga0207691_10013911 3300025940 Bacteria 7677
345 Ga0207691_10014963 3300025940 Bacteria 7389
346 Ga0207711_10004111 3300025941 Bacteria 12473
347 Ga0207711_10006891 3300025941 Bacteria 9542
348 Ga0207711_10008462 3300025941 Bacteria 8607
349 Ga0207689_10005302 3300025942 Bacteria 11550
350 Ga0207689_10029198 3300025942 Bacteria 4608
351 Ga0207661_10006376 3300025944 Bacteria 8343
352 Ga0207679_10009643 3300025945 Bacteria 6189
353 Ga0207679_10019691 3300025945 Bacteria 4540
354 Ga0207679_10020156 3300025945 Bacteria 4496
355 Ga0207679_10030427 3300025945 Bacteria 3769
356 Ga0207679_10039835 3300025945 Bacteria 3359
357 Ga0207667_10000001 3300025949 Bacteria 1178522
358 Ga0207667_10000282 3300025949 Bacteria 69790
359 Ga0207651_10024115 3300025960 Bacteria 3756
360 Ga0207712_10002694 3300025961 Bacteria 11336
361 Ga0207712_10053822 3300025961 Bacteria 2825
362 Ga0207668_10007021 3300025972 Bacteria 6679
363 Ga0207668_10012097 3300025972 Bacteria 5271
364 Ga0207640_10000332 3300025981 Bacteria 31426
365 Ga0207640_10007833 3300025981 Bacteria 5897
366 Ga0207640_10008872 3300025981 Bacteria 5600
367 Ga0207658_10007224 3300025986 Bacteria 7574
368 Ga0207658_10009620 3300025986 Bacteria 6561
369 Ga0207677_10000014 3300026023 Bacteria 181712
370 Ga0207677_10002473 3300026023 Bacteria 9698
371 Ga0207703_10000135 3300026035 Bacteria 89779
372 Ga0207703_10007159 3300026035 Bacteria 8873
373 Ga0207703_10009181 3300026035 Bacteria 7782
374 Ga0207703_10019631 3300026035 Bacteria 5282
375 Ga0207639_10001401 3300026041 Bacteria 16275
376 Ga0207639_10054311 3300026041 Bacteria 3061
377 Ga0207678_10001226 3300026067 Bacteria 23602
378 Ga0207678_10001889 3300026067 Bacteria 19110
379 Ga0207678_10011456 3300026067 Bacteria 7786
380 Ga0207678_10013912 3300026067 Bacteria 7071
381 Ga0207678_10021226 3300026067 Bacteria 5692
382 Ga0207678_10030168 3300026067 Bacteria 4733
383 Ga0207678_10048645 3300026067 Bacteria 3665
384 Ga0207678_10053405 3300026067 Bacteria 3482
385 Ga0207702_10013120 3300026078 Bacteria 6889
386 Ga0207702_10030679 3300026078 Bacteria 4478
387 Ga0207702_10064217 3300026078 Bacteria 3141
388 Ga0207641_10017090 3300026088 Bacteria 5935
389 Ga0207641_10042329 3300026088 Bacteria 3820
390 Ga0207648_10000962 3300026089 Bacteria 32576
391 Ga0207648_10023761 3300026089 Bacteria 5483
392 Ga0207648_10037095 3300026089 Bacteria 4293
393 Ga0207676_10006804 3300026095 Bacteria 8092
394 Ga0207676_10018132 3300026095 Bacteria 5112
395 Ga0207676_10023779 3300026095 Bacteria 4526
396 Ga0207674_10000626 3300026116 Bacteria 46240
397 Ga0207674_10003891 3300026116 Bacteria 18169
398 Ga0207674_10005315 3300026116 Bacteria 15320
399 Ga0207674_10006883 3300026116 Bacteria 13323
400 Ga0207674_10009062 3300026116 Bacteria 11427
401 Ga0207674_10013991 3300026116 Bacteria 8871
402 Ga0207674_10015581 3300026116 Bacteria 8348
403 Ga0207674_10021876 3300026116 Bacteria 6880
404 Ga0207674_10026537 3300026116 Bacteria 6148
405 Ga0207674_10039022 3300026116 Bacteria 4925
406 Ga0207674_10043477 3300026116 Bacteria 4632
407 Ga0207675_100000049 3300026118 Bacteria 84016
408 Ga0207675_100030478 3300026118 Bacteria 5024
409 Ga0207683_10006175 3300026121 Bacteria 10269
410 Ga0207683_10008207 3300026121 Bacteria 8936
411 Ga0207683_10019106 3300026121 Bacteria 5849
412 Ga0207698_10006090 3300026142 Bacteria 7505
413 Ga0207698_10011299 3300026142 Bacteria 5782
414 Ga0207698_10055278 3300026142 Bacteria 3058
415 Ga0268266_10000074 3300028379 Bacteria 230993
416 Ga0268266_10000181 3300028379 Bacteria 112266
417 Ga0268266_10003739 3300028379 Bacteria 14962
418 Ga0268266_10007793 3300028379 Bacteria 9602
419 Ga0268265_10007078 3300028380 Bacteria 7580
420 Ga0268265_10009635 3300028380 Bacteria 6521
421 Ga0268264_10002450 3300028381 Bacteria 16308
422 Ga0268264_10004960 3300028381 Bacteria 11271
423 Ga0307517_10007919 3300028786 Bacteria 15361
424 Ga0307517_10017280 3300028786 Bacteria 9415
425 Ga0316178_1013489 3300030735 Bacteria 3559
426 Ga0316182_1017364 3300030745 Bacteria 5436
427 Ga0307513_10013148 3300031456 Bacteria 10172
428 Ga0307410_10000124 3300031852 Bacteria 27240
429 Ga0307406_10008897 3300031901 Bacteria 5612
430 Ga0307409_100012696 3300031995 Bacteria 5381
431 Ga0307409_100036108 3300031995 Bacteria 3628
432 Ga0307416_100000416 3300032002 Bacteria 21677
433 Ga0307411_10031145 3300032005 Bacteria 3278
434 Ga0307510_10001620 3300033180 Bacteria 24931
435 Ga0307510_10077067 3300033180 Bacteria 3273
436 Ga0395899_0000296 3300037312 Bacteria 64048
437 Ga0395899_0010837 3300037312 Bacteria 6988
438 Ga0395899_0014342 3300037312 Bacteria 6049
439 Ga0395899_0017423 3300037312 Bacteria 5472
440 Ga0395899_0025343 3300037312 Bacteria 4476
441 Ga0395899_0035600 3300037312 Bacteria 3736
442 Ga0395900_0000036 3300037418 Bacteria 250619
443 Ga0395900_0001457 3300037418 Bacteria 28209
444 Ga0395900_0001680 3300037418 Bacteria 25760
445 Ga0395900_0003058 3300037418 Bacteria 18213
446 Ga0395900_0006747 3300037418 Bacteria 11913
447 Ga0395900_0013324 3300037418 Bacteria 8407
448 Ga0395900_0015325 3300037418 Bacteria 7814
449 Ga0395900_0017308 3300037418 Bacteria 7357
450 Ga0395900_0020344 3300037418 Bacteria 6774
451 Ga0395900_0023074 3300037418 Bacteria 6368
452 Ga0395900_0070864 3300037418 Bacteria 3583
453 Ga0395900_0078605 3300037418 Bacteria 3389
454 Ga0395900_0083661 3300037418 Bacteria 3278
455 Ga0395898_0003602 3300037466 Bacteria 17250
456 Ga0395898_0013043 3300037466 Bacteria 8562
457 Ga0395898_0024672 3300037466 Bacteria 6065
458 Ga0395898_0032484 3300037466 Bacteria 5210
459 Ga0395898_0067806 3300037466 Bacteria 3453
460 Ga0395905_0000174 3300037471 Bacteria 104301
461 Ga0395905_0004190 3300037471 Bacteria 15083
462 Ga0395905_0013867 3300037471 Bacteria 7711
463 Ga0395905_0014446 3300037471 Bacteria 7538
464 Ga0395905_0016536 3300037471 Bacteria 7013
465 Ga0395905_0023020 3300037471 Bacteria 5888
466 Ga0395905_0026811 3300037471 Bacteria 5434
467 Ga0395905_0034164 3300037471 Bacteria 4774
468 Ga0395905_0042326 3300037471 Bacteria 4274
469 Ga0395905_0073038 3300037471 Bacteria 3215
470 Ga0395901_0000036 3300038443 Bacteria 214274
471 Ga0395901_0011389 3300038443 Bacteria 9011
472 Ga0395901_0015419 3300038443 Bacteria 7782
473 Ga0395901_0017800 3300038443 Bacteria 7251
474 Ga0395901_0023381 3300038443 Bacteria 6334
475 Ga0395901_0036459 3300038443 Bacteria 5083
476 Ga0395901_0037183 3300038443 Bacteria 5035
477 Ga0395901_0041261 3300038443 Bacteria 4781
478 Ga0395901_0044983 3300038443 Bacteria 4580
479 Ga0395901_0045828 3300038443 Bacteria 4540
480 Ga0395901_0049327 3300038443 Bacteria 4373
481 Ga0395901_0051701 3300038443 Bacteria 4273
482 Ga0395901_0072230 3300038443 Bacteria 3597
483 Ga0450889_000265 3300042144 Bacteria 5810
484 Ga0466969_0010403 3300044656 Bacteria 4932
485 Ga0466972_0011839 3300044658 Bacteria 4382
486 Ga0466966_0000004 3300044684 Bacteria 223594
487 Ga0466966_0024043 3300044684 Bacteria 3988
488 Ga0466966_0028206 3300044684 Bacteria 3658
489 Ga0466961_0013967 3300044693 Bacteria 5146
490 Ga0466963_0005314 3300044694 Bacteria 7529
491 Ga0466963_0012142 3300044694 Bacteria 5265
492 Ga0466963_0023913 3300044694 Bacteria 3885
493 Ga0466971_0000663 3300044719 Bacteria 13700
494 Ga0466971_0015569 3300044719 Bacteria 3350
495 Ga0466970_0002855 3300044765 Bacteria 8350
496 Ga0466970_0005164 3300044765 Bacteria 6456
497 Ga0466970_0024124 3300044765 Bacteria 3180
498 Ga0466957_0008191 3300044842 Bacteria 5934
499 Ga0466960_0021657 3300044901 Bacteria 2865
500 Ga0466960_0028676 3300044901 Bacteria 2549
501 Ga0466959_0000278 3300045049 Bacteria 31260
502 Ga0466959_0004576 3300045049 Bacteria 9286
503 Ga0466958_0005038 3300045836 Bacteria 7054
504 Ga0466958_0015606 3300045836 Bacteria 4356
505 Ga0466958_0045699 3300045836 Bacteria 2642
506 Ga0466967_0012300 3300045976 Bacteria 6538
507 Ga0466967_0019810 3300045976 Bacteria 5420
508 Ga0466967_0025870 3300045976 Bacteria 4847
509 Ga0495650_0000091 3300046471 Bacteria 228697
510 Ga0495585_0017098 3300046492 Bacteria 4197
511 Ga0495583_0000693 3300046506 Bacteria 43601
512 Ga0495583_0006888 3300046506 Bacteria 7312
513 Ga0495583_0015304 3300046506 Bacteria 4177
514 Ga0495606_0000390 3300046507 Bacteria 74253
515 Ga0495606_0000470 3300046507 Bacteria 66278
516 Ga0495637_0009175 3300046520 Bacteria 4829
517 Ga0495643_0000826 3300046522 Bacteria 33765
518 Ga0495643_0002531 3300046522 Bacteria 14336
519 Ga0495648_0000065 3300046524 Bacteria 145024
520 Ga0495642_0004390 3300046528 Bacteria 5475
521 Ga0495621_0000536 3300046539 Bacteria 9408
522 Ga0495621_0001226 3300046539 Bacteria 6613
523 Ga0495633_0002445 3300046558 Bacteria 13114
524 Ga0495633_0003893 3300046558 Bacteria 9738
525 Ga0495668_0000022 3300046616 Bacteria 363999
526 Ga0495668_0000026 3300046616 Bacteria 297287
527 Ga0495668_0033713 3300046616 Bacteria 2875
528 Ga0495625_0000469 3300046660 Bacteria 60635
529 Ga0495625_0005314 3300046660 Bacteria 11796
530 Ga0495625_0013215 3300046660 Bacteria 6648
531 Ga0495669_0000046 3300046684 Bacteria 83405
532 Ga0495669_0000049 3300046684 Bacteria 80766
533 Ga0495669_0000899 3300046684 Bacteria 12508
534 Ga0495670_0000003 3300046691 Bacteria 326779
535 Ga0495670_0007872 3300046691 Bacteria 5242
536 Ga0495670_0013616 3300046691 Bacteria 3999
537 Ga0495687_000043 3300047443 Bacteria 216711
538 Ga0495687_000293 3300047443 Bacteria 65650
539 Ga0495677_0001485 3300047445 Bacteria 9420
540 Ga0495681_0010700 3300047470 Bacteria 5532
541 Ga0495686_0000849 3300047472 Bacteria 39236
542 Ga0496102_0000170 3300048905 Bacteria 88149
543 Ga0496102_0000384 3300048905 Bacteria 52159
544 Ga0496102_0000719 3300048905 Bacteria 32658
545 Ga0496103_0000081 3300048906 Bacteria 109734
546 Ga0496103_0000122 3300048906 Bacteria 84230
547 Ga0496103_0000562 3300048906 Bacteria 29450
548 Ga0496104_0003131 3300048907 Bacteria 14267
549 Ga0496104_0003648 3300048907 Bacteria 13295
550 Ga0496105_0000034 3300048908 Bacteria 127505
551 Ga0496105_0000267 3300048908 Bacteria 34619
552 Ga0496107_0008365 3300048910 Bacteria 7158
553 Ga0496108_0021847 3300048911 Bacteria 5260
554 Ga0496108_0061392 3300048911 Bacteria 3163
555 Ga0496109_0008646 3300048912 Bacteria 8666
556 Ga0496110_0003888 3300048913 Bacteria 11494
557 Ga0496110_0025639 3300048913 Bacteria 5041
558 Ga0496110_0028913 3300048913 Bacteria 4764
559 Ga0496112_0007890 3300048915 Bacteria 9484
560 Ga0496112_0008943 3300048915 Bacteria 8993
561 Ga0496113_0001238 3300048916 Bacteria 14053
562 Ga0496113_0003801 3300048916 Bacteria 9132
563 Ga0496113_0026568 3300048916 Bacteria 4140
564 Ga0496114_0000019 3300048917 Bacteria 244365
565 Ga0496114_0005688 3300048917 Bacteria 9776
566 Ga0496114_0052210 3300048917 Bacteria 3406
567 Ga0496115_0000122 3300048918 Bacteria 70943
568 Ga0496115_0000301 3300048918 Bacteria 42011
569 Ga0496116_0002037 3300048919 Bacteria 21676
570 Ga0496116_0004379 3300048919 Bacteria 13500
571 Ga0496117_0000300 3300048920 Bacteria 87165
572 Ga0496117_0000519 3300048920 Bacteria 63633
573 Ga0496118_0000193 3300048921 Bacteria 107307
574 Ga0496118_0000547 3300048921 Bacteria 61892
575 Ga0496118_0006768 3300048921 Bacteria 12465
576 Ga0496119_0000057 3300048922 Bacteria 173746
577 Ga0496119_0005819 3300048922 Bacteria 11655
578 Ga0496119_0012164 3300048922 Bacteria 7022
579 Ga0496120_0003771 3300048923 Bacteria 13389
580 Ga0496121_0002643 3300048924 Bacteria 26946
581 Ga0496121_0003147 3300048924 Bacteria 23806
582 Ga0496121_0004773 3300048924 Bacteria 17877
583 Ga0496121_0010620 3300048924 Bacteria 10343
584 Ga0496121_0011844 3300048924 Bacteria 9604
585 Ga0496123_0002890 3300048926 Bacteria 20116
586 Ga0496123_0006359 3300048926 Bacteria 11467
587 Ga0496123_0006411 3300048926 Bacteria 11407
588 Ga0496124_0000237 3300048927 Bacteria 107270
589 Ga0496124_0000337 3300048927 Bacteria 86241
590 Ga0496124_0000773 3300048927 Bacteria 52178
591 Ga0496124_0011267 3300048927 Bacteria 8953
592 Ga0496124_0017962 3300048927 Bacteria 6646
593 Ga0496125_0003862 3300048928 Bacteria 17760
594 Ga0496125_0009034 3300048928 Bacteria 10321
595 Ga0496125_0014735 3300048928 Bacteria 7595
596 Ga0496126_0000028 3300048929 Bacteria 394082
597 Ga0496126_0000416 3300048929 Bacteria 86243
598 Ga0496126_0003884 3300048929 Bacteria 18400
599 Ga0496126_0005624 3300048929 Bacteria 14252
600 Ga0501033_0020626 3300049570 Bacteria 4979
601 Ga0501034_0046882 3300049571 Bacteria 4366
602 Ga0501038_0013129 3300049574 Bacteria 7554
603 Ga0501047_0001134 3300049581 Bacteria 26429
604 Ga0501035_0002868 3300049822 Bacteria 16644
605 Ga0501035_0023954 3300049822 Bacteria 5602
606 Ga0501044_0086090 3300049823 Bacteria 3175
607 nmdc:mga06r32_6024_c2 3300050510 Bacteria 5205
608 nmdc:mga08y16_72105_c1 3300050511 Bacteria 3599
609 nmdc:mga0sz30_3520_c1 3300050516 Bacteria 5646
610 Ga0500610_0002791 3300053079 Bacteria 6541
611 Ga0500643_005708 3300053087 Bacteria 5307
612 Ga0500651_0004779 3300053093 Bacteria 7638
613 Ga0500607_000011 3300053121 Bacteria 110773
614 Ga0500608_000169 3300053122 Bacteria 26904
615 Ga0500642_0000939 3300053130 Bacteria 8440
616 Ga0500642_0002192 3300053130 Bacteria 5680
617 Ga0500655_000050 3300053133 Bacteria 32469
618 Ga0500590_000291 3300053148 Bacteria 15918
619 Ga0500616_0000018 3300053153 Bacteria 610976
620 Ga0500622_0010857 3300053156 Bacteria 4976
621 Ga0500624_000032 3300053157 Bacteria 104403
622 Ga0500636_0002492 3300053177 Bacteria 10226
623 Ga0500637_0000019 3300053178 Bacteria 65170
624 Ga0500570_008122 3300053724 Bacteria 5783
625 Ga0500645_000145 3300053730 Bacteria 55153
626 Ga0500645_004233 3300053730 Bacteria 5575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0045699 Ga0466958_0045699_308_2617 711
2 3300053093 Ga0500651_0004779 Ga0500651_0004779_5469_7619 712
3 3300047445 Ga0495677_0001485 Ga0495677_0001485_7104_9404 737
4 3300053153 Ga0500616_0000018 Ga0500616_0000018_321828_324233 743
5 3300053157 Ga0500624_000032 Ga0500624_000032_49562_51958 743
6 3300053178 Ga0500637_0000019 Ga0500637_0000019_10327_12723 743
7 3300048911 Ga0496108_0061392 Ga0496108_0061392_776_3088 744
8 3300046616 Ga0495668_0000026 Ga0495668_0000026_89603_91909 745
9 3300030735 Ga0316178_1013489 Ga0316178_10134892 750
10 3300030745 Ga0316182_1017364 Ga0316182_10173642 750
11 3300013104 Ga0157370_10000020 Ga0157370_1000002093 754
12 3300006186 Ga0075369_10001000 Ga0075369_100010007 757
13 3300048927 Ga0496124_0017962 Ga0496124_0017962_2345_4729 757
14 3300050516 nmdc:mga0sz30_3520_c1 nmdc:mga0sz30_3520_c1_1668_4052 757
15 iso_pu_bacteria 2857504554 2857505418 757
16 iso_pu_bacteria 2585428106 2587918381 758
17 iso_pu_bacteria 2643221640 2644227729 758
18 iso_pu_bacteria 2643221642 2644234010 758
19 iso_pu_bacteria 2884960567 2884962319 758
20 iso_pu_bacteria 2928531327 2928533123 758
21 3300003781 Ga0055536_1004780 Ga0055536_10047804 759
22 3300003791 Ga0055530_10004796 Ga0055530_100047964 759
23 3300003794 Ga0055531_10004028 Ga0055531_100040282 759
24 3300025292 Ga0209676_1000177 Ga0209676_100017738 759
25 3300025298 Ga0209050_1000837 Ga0209050_100083738 759
26 3300025304 Ga0209257_1000253 Ga0209257_100025349 759
27 3300048917 Ga0496114_0000019 Ga0496114_0000019_85648_88203 759
28 3300053122 Ga0500608_000169 Ga0500608_000169_22286_24670 759
29 3300003781 Ga0055536_1004876 Ga0055536_10048764 760
30 3300003791 Ga0055530_10004858 Ga0055530_100048584 760
31 3300025292 Ga0209676_1000171 Ga0209676_100017184 760
32 3300025298 Ga0209050_1001766 Ga0209050_10017667 760
33 3300025303 Ga0209051_1001860 Ga0209051_10018606 760
34 3300025304 Ga0209257_1015520 Ga0209257_10155202 760
35 3300048928 Ga0496125_0014735 Ga0496125_0014735_5203_7566 760
36 3300048929 Ga0496126_0003884 Ga0496126_0003884_4242_6605 760
37 3300049581 Ga0501047_0001134 Ga0501047_0001134_4273_6687 760
38 3300049823 Ga0501044_0086090 Ga0501044_0086090_413_2827 760
39 3300048905 Ga0496102_0000719 Ga0496102_0000719_20006_22528 761
40 3300048906 Ga0496103_0000562 Ga0496103_0000562_16701_19223 761
41 3300048919 Ga0496116_0002037 Ga0496116_0002037_9529_12051 761
42 3300048920 Ga0496117_0000519 Ga0496117_0000519_19972_22494 761
43 3300048921 Ga0496118_0000193 Ga0496118_0000193_19928_22450 761
44 3300048922 Ga0496119_0012164 Ga0496119_0012164_3561_6083 761
45 3300048927 Ga0496124_0000237 Ga0496124_0000237_84858_87380 761
46 3300006847 Ga0075431_100013164 Ga0075431_1000131647 763
47 3300050510 nmdc:mga06r32_6024_c2 nmdc:mga06r32_6024_c2_2434_4929 763
48 3300025907 Ga0207645_10003851 Ga0207645_100038512 764
49 iso_pu_bacteria 2643221541 2643727661 764
50 3300005293 Ga0065715_10091114 Ga0065715_100911143 765
51 3300005331 Ga0070670_100000968 Ga0070670_10000096811 765
52 3300005333 Ga0070677_10003937 Ga0070677_100039373 765
53 3300005347 Ga0070668_100018211 Ga0070668_1000182112 765
54 3300005353 Ga0070669_100005377 Ga0070669_1000053773 765
55 3300005354 Ga0070675_100000229 Ga0070675_10000022912 765
56 3300005356 Ga0070674_100003998 Ga0070674_1000039988 765
57 3300005364 Ga0070673_100005349 Ga0070673_1000053497 765
58 3300005367 Ga0070667_100025654 Ga0070667_1000256543 765
59 3300005455 Ga0070663_100017178 Ga0070663_1000171782 765
60 3300005457 Ga0070662_100001340 Ga0070662_10000134013 765
61 3300005543 Ga0070672_100001475 Ga0070672_10000147512 765
62 3300005617 Ga0068859_100014575 Ga0068859_1000145752 765
63 3300005719 Ga0068861_100005114 Ga0068861_1000051143 765
64 3300005844 Ga0068862_100001874 Ga0068862_1000018744 765
65 3300006931 Ga0097620_100014574 Ga0097620_1000145742 765
66 3300009553 Ga0105249_10052837 Ga0105249_100528372 765
67 3300013306 Ga0163162_10097821 Ga0163162_100978212 765
68 3300014326 Ga0157380_10000410 Ga0157380_1000041023 765
69 3300025315 Ga0207697_10000376 Ga0207697_1000037619 765
70 3300025893 Ga0207682_10007714 Ga0207682_100077142 765
71 3300025923 Ga0207681_10010450 Ga0207681_100104503 765
72 3300025925 Ga0207650_10003374 Ga0207650_1000337410 765
73 3300025926 Ga0207659_10007734 Ga0207659_100077343 765
74 3300025933 Ga0207706_10003464 Ga0207706_100034644 765
75 3300025937 Ga0207669_10011389 Ga0207669_100113892 765
76 3300025940 Ga0207691_10002585 Ga0207691_100025854 765
77 3300025961 Ga0207712_10053822 Ga0207712_100538221 765
78 3300025972 Ga0207668_10012097 Ga0207668_100120973 765
79 3300026067 Ga0207678_10030168 Ga0207678_100301682 765
80 3300026118 Ga0207675_100030478 Ga0207675_1000304783 765
81 3300028380 Ga0268265_10007078 Ga0268265_100070784 765
82 3300025945 Ga0207679_10009643 Ga0207679_100096434 767
83 3300044684 Ga0466966_0024043 Ga0466966_0024043_164_2719 768
84 3300053730 Ga0500645_004233 Ga0500645_004233_1465_3963 768
85 3300005548 Ga0070665_100015800 Ga0070665_1000158004 770
86 3300005367 Ga0070667_100027117 Ga0070667_1000271174 771
87 3300005617 Ga0068859_100045593 Ga0068859_1000455932 771
88 3300005844 Ga0068862_100020346 Ga0068862_1000203463 771
89 3300006931 Ga0097620_100045592 Ga0097620_1000455922 771
90 3300025986 Ga0207658_10007224 Ga0207658_100072244 771
91 3300026035 Ga0207703_10007159 Ga0207703_100071594 771
92 3300028380 Ga0268265_10009635 Ga0268265_100096353 771
93 3300044901 Ga0466960_0028676 Ga0466960_0028676_71_2539 771
94 3300009177 Ga0105248_10000764 Ga0105248_1000076420 772
95 3300046616 Ga0495668_0033713 Ga0495668_0033713_80_2671 775
96 3300025909 Ga0207705_10001405 Ga0207705_1000140510 777
97 3300005614 Ga0068856_100092404 Ga0068856_1000924042 779
98 3300026116 Ga0207674_10043477 Ga0207674_100434773 779
99 3300028381 Ga0268264_10004960 Ga0268264_1000496010 780
100 3300005334 Ga0068869_100002970 Ga0068869_1000029704 781
101 3300005353 Ga0070669_100041028 Ga0070669_1000410282 781
102 3300005844 Ga0068862_100040204 Ga0068862_1000402042 781
103 3300009098 Ga0105245_10016818 Ga0105245_100168183 781
104 3300025942 Ga0207689_10005302 Ga0207689_100053026 781
105 3300026116 Ga0207674_10015581 Ga0207674_100155815 781
106 3300037418 Ga0395900_0078605 Ga0395900_0078605_505_3078 781
107 3300037471 Ga0395905_0034164 Ga0395905_0034164_1475_4048 781
108 3300038443 Ga0395901_0072230 Ga0395901_0072230_384_2957 781
109 iso_pu_bacteria 2643221606 2644041179 781
110 iso_pu_bacteria 2643221671 2644394718 781
111 3300005339 Ga0070660_100003320 Ga0070660_1000033206 782
112 3300005345 Ga0070692_10003449 Ga0070692_100034494 782
113 3300005444 Ga0070694_100005612 Ga0070694_1000056125 782
114 3300005457 Ga0070662_100002358 Ga0070662_1000023582 782
115 3300005577 Ga0068857_100031990 Ga0068857_1000319902 782
116 3300009148 Ga0105243_10033687 Ga0105243_100336872 782
117 3300013306 Ga0163162_10043875 Ga0163162_100438753 782
118 3300025254 Ga0209148_1000934 Ga0209148_10009345 782
119 3300025272 Ga0209455_1000969 Ga0209455_10009695 782
120 3300025904 Ga0207647_10000327 Ga0207647_1000032712 782
121 3300025919 Ga0207657_10004025 Ga0207657_100040257 782
122 3300025933 Ga0207706_10001168 Ga0207706_1000116817 782
123 3300025961 Ga0207712_10002694 Ga0207712_1000269410 782
124 3300026116 Ga0207674_10021876 Ga0207674_100218763 782
125 3300028381 Ga0268264_10002450 Ga0268264_100024506 782
126 3300048921 Ga0496118_0006768 Ga0496118_0006768_5464_7974 782
127 3300050511 nmdc:mga08y16_72105_c1 nmdc:mga08y16_72105_c1_1036_3537 783
128 3300025254 Ga0209148_1000171 Ga0209148_100017192 784
129 3300048924 Ga0496121_0003147 Ga0496121_0003147_12658_15255 786
130 3300048928 Ga0496125_0009034 Ga0496125_0009034_2481_4991 787
131 3300005327 Ga0070658_10000809 Ga0070658_1000080910 788
132 3300005339 Ga0070660_100000558 Ga0070660_10000055823 788
133 3300005563 Ga0068855_100000140 Ga0068855_10000014020 788
134 3300013102 Ga0157371_10003832 Ga0157371_100038326 788
135 3300025909 Ga0207705_10000061 Ga0207705_10000061152 788
136 3300025919 Ga0207657_10007475 Ga0207657_100074758 788
137 3300025949 Ga0207667_10000282 Ga0207667_1000028274 788
138 3300037471 Ga0395905_0000174 Ga0395905_0000174_80972_83509 788
139 3300005843 Ga0068860_100069398 Ga0068860_1000693982 789
140 3300038443 Ga0395901_0044983 Ga0395901_0044983_72_2582 789
141 3300005331 Ga0070670_100011660 Ga0070670_1000116602 790
142 3300005338 Ga0068868_100005974 Ga0068868_1000059745 790
143 3300009098 Ga0105245_10015390 Ga0105245_100153903 790
144 3300025927 Ga0207687_10018339 Ga0207687_100183393 790
145 3300026023 Ga0207677_10002473 Ga0207677_100024736 790
146 3300049822 Ga0501035_0002868 Ga0501035_0002868_826_3426 790
147 3300005347 Ga0070668_100001032 Ga0070668_10000103215 791
148 3300005356 Ga0070674_100004843 Ga0070674_1000048435 791
149 3300005364 Ga0070673_100046010 Ga0070673_1000460102 791
150 3300005367 Ga0070667_100005475 Ga0070667_1000054757 791
151 3300005459 Ga0068867_100002596 Ga0068867_1000025966 791
152 3300010375 Ga0105239_10058205 Ga0105239_100582052 791
153 3300025909 Ga0207705_10009812 Ga0207705_100098123 791
154 3300025909 Ga0207705_10013123 Ga0207705_100131234 791
155 3300025919 Ga0207657_10002527 Ga0207657_1000252714 791
156 3300025919 Ga0207657_10022997 Ga0207657_100229974 791
157 3300025923 Ga0207681_10006440 Ga0207681_100064406 791
158 3300025972 Ga0207668_10007021 Ga0207668_100070212 791
159 3300025986 Ga0207658_10009620 Ga0207658_100096203 791
160 3300026089 Ga0207648_10000962 Ga0207648_100009622 791
161 3300037312 Ga0395899_0000296 Ga0395899_0000296_6699_9329 791
162 3300037418 Ga0395900_0000036 Ga0395900_0000036_197937_200567 791
163 3300037466 Ga0395898_0024672 Ga0395898_0024672_1663_4293 791
164 3300038443 Ga0395901_0000036 Ga0395901_0000036_19331_21961 791
165 3300005345 Ga0070692_10002664 Ga0070692_100026645 792
166 3300005616 Ga0068852_100009838 Ga0068852_1000098382 792
167 3300013104 Ga0157370_10007681 Ga0157370_100076819 792
168 3300025909 Ga0207705_10044181 Ga0207705_100441812 792
169 3300005543 Ga0070672_100008584 Ga0070672_1000085844 794
170 3300005544 Ga0070686_100000465 Ga0070686_10000046516 794
171 3300005366 Ga0070659_100044475 Ga0070659_1000444752 795
172 3300005457 Ga0070662_100012530 Ga0070662_1000125303 795
173 3300025904 Ga0207647_10035732 Ga0207647_100357321 795
174 3300025933 Ga0207706_10017933 Ga0207706_100179333 795
175 3300025933 Ga0207706_10018415 Ga0207706_100184154 795
176 3300026116 Ga0207674_10006883 Ga0207674_100068835 795
177 3300044684 Ga0466966_0000004 Ga0466966_0000004_212249_214948 795
178 3300002075 JGI24738J21930_10001669 JGI24738J21930_100016693 797
179 3300005578 Ga0068854_100000103 Ga0068854_10000010339 797
180 3300006358 Ga0068871_100003159 Ga0068871_1000031593 797
181 3300025981 Ga0207640_10000332 Ga0207640_100003328 797
182 3300026067 Ga0207678_10001889 Ga0207678_100018894 797
183 3300046507 Ga0495606_0000470 Ga0495606_0000470_24744_27296 797
184 3300005345 Ga0070692_10005692 Ga0070692_100056925 798
185 3300005366 Ga0070659_100027625 Ga0070659_1000276252 798
186 3300005842 Ga0068858_100025525 Ga0068858_1000255252 798
187 3300013102 Ga0157371_10024820 Ga0157371_100248202 798
188 3300013105 Ga0157369_10042165 Ga0157369_100421652 798
189 3300014968 Ga0157379_10024736 Ga0157379_100247364 798
190 3300025909 Ga0207705_10037233 Ga0207705_100372332 798
191 3300026078 Ga0207702_10013120 Ga0207702_100131203 798
192 3300026088 Ga0207641_10017090 Ga0207641_100170902 798
193 3300026095 Ga0207676_10018132 Ga0207676_100181322 798
194 3300026116 Ga0207674_10000626 Ga0207674_1000062636 798
195 3300044719 Ga0466971_0015569 Ga0466971_0015569_613_3294 798
196 3300048913 Ga0496110_0025639 Ga0496110_0025639_1716_4409 798
197 3300048916 Ga0496113_0026568 Ga0496113_0026568_163_2856 798
198 3300048924 Ga0496121_0011844 Ga0496121_0011844_2378_4864 798
199 3300048926 Ga0496123_0006411 Ga0496123_0006411_6809_9295 798
200 3300048927 Ga0496124_0000773 Ga0496124_0000773_3004_5559 798
201 3300001989 JGI24739J22299_10007032 JGI24739J22299_100070321 799
202 3300002067 JGI24735J21928_10003862 JGI24735J21928_100038622 799
203 3300002077 JGI24744J21845_10000306 JGI24744J21845_100003064 799
204 3300005356 Ga0070674_100029362 Ga0070674_1000293622 799
205 3300005366 Ga0070659_100003704 Ga0070659_1000037043 799
206 3300005543 Ga0070672_100007220 Ga0070672_1000072202 799
207 3300013104 Ga0157370_10040877 Ga0157370_100408772 799
208 3300025932 Ga0207690_10015670 Ga0207690_100156702 799
209 3300037418 Ga0395900_0001457 Ga0395900_0001457_17557_20178 799
210 3300044656 Ga0466969_0010403 Ga0466969_0010403_443_3031 799
211 3300044719 Ga0466971_0000663 Ga0466971_0000663_7839_10427 799
212 3300044765 Ga0466970_0002855 Ga0466970_0002855_3185_5773 799
213 3300045049 Ga0466959_0000278 Ga0466959_0000278_27799_30387 799
214 3300045836 Ga0466958_0015606 Ga0466958_0015606_1176_3764 799
215 3300009545 Ga0105237_10004174 Ga0105237_1000417411 800
216 3300025914 Ga0207671_10022956 Ga0207671_100229563 800
217 3300001979 JGI24740J21852_10007092 JGI24740J21852_100070922 801
218 3300001989 JGI24739J22299_10006537 JGI24739J22299_100065372 801
219 3300005327 Ga0070658_10004262 Ga0070658_1000426210 801
220 3300005335 Ga0070666_10013070 Ga0070666_100130702 801
221 3300005355 Ga0070671_100024959 Ga0070671_1000249592 801
222 3300005367 Ga0070667_100037217 Ga0070667_1000372172 801
223 3300005547 Ga0070693_100017967 Ga0070693_1000179672 801
224 3300005548 Ga0070665_100079750 Ga0070665_1000797502 801
225 3300005616 Ga0068852_100036536 Ga0068852_1000365364 801
226 3300005834 Ga0068851_10009179 Ga0068851_100091792 801
227 3300013102 Ga0157371_10013683 Ga0157371_100136832 801
228 3300025903 Ga0207680_10007208 Ga0207680_100072083 801
229 3300025907 Ga0207645_10009540 Ga0207645_100095405 801
230 3300025909 Ga0207705_10018592 Ga0207705_100185923 801
231 3300025919 Ga0207657_10002626 Ga0207657_100026262 801
232 3300025919 Ga0207657_10017525 Ga0207657_100175253 801
233 3300025920 Ga0207649_10027995 Ga0207649_100279952 801
234 3300025932 Ga0207690_10013353 Ga0207690_100133533 801
235 3300025933 Ga0207706_10013967 Ga0207706_100139674 801
236 3300025942 Ga0207689_10029198 Ga0207689_100291984 801
237 3300025945 Ga0207679_10019691 Ga0207679_100196912 801
238 3300026041 Ga0207639_10054311 Ga0207639_100543112 801
239 3300026067 Ga0207678_10013912 Ga0207678_100139124 801
240 3300026116 Ga0207674_10039022 Ga0207674_100390224 801
241 3300038443 Ga0395901_0037183 Ga0395901_0037183_337_2955 801
242 3300044694 Ga0466963_0012142 Ga0466963_0012142_2087_4705 801
243 3300045976 Ga0466967_0012300 Ga0466967_0012300_2002_4620 801
244 3300046539 Ga0495621_0000536 Ga0495621_0000536_6524_9187 802
245 3300046691 Ga0495670_0013616 Ga0495670_0013616_1046_3709 802
246 3300037418 Ga0395900_0020344 Ga0395900_0020344_4079_6715 803
247 3300044694 Ga0466963_0023913 Ga0466963_0023913_156_2792 803
248 3300005719 Ga0068861_100001690 Ga0068861_10000169015 804
249 3300025941 Ga0207711_10004111 Ga0207711_100041115 804
250 3300026118 Ga0207675_100000049 Ga0207675_10000004980 804
251 3300037418 Ga0395900_0003058 Ga0395900_0003058_11085_13721 804
252 3300037471 Ga0395905_0004190 Ga0395905_0004190_5090_7726 804
253 3300038443 Ga0395901_0051701 Ga0395901_0051701_1664_4216 804
254 3300044693 Ga0466961_0013967 Ga0466961_0013967_96_2771 805
255 3300044694 Ga0466963_0005314 Ga0466963_0005314_1987_4662 805
256 3300044765 Ga0466970_0005164 Ga0466970_0005164_1220_3895 805
257 3300044842 Ga0466957_0008191 Ga0466957_0008191_1576_4251 805
258 3300005353 Ga0070669_100052095 Ga0070669_1000520952 806
259 3300005456 Ga0070678_100003165 Ga0070678_1000031652 806
260 3300005548 Ga0070665_100000493 Ga0070665_10000049328 806
261 3300005577 Ga0068857_100061112 Ga0068857_1000611122 806
262 3300005842 Ga0068858_100011918 Ga0068858_1000119186 806
263 3300013306 Ga0163162_10016336 Ga0163162_100163363 806
264 3300025931 Ga0207644_10014208 Ga0207644_100142084 806
265 3300025933 Ga0207706_10062616 Ga0207706_100626162 806
266 3300026035 Ga0207703_10019631 Ga0207703_100196313 806
267 3300026095 Ga0207676_10023779 Ga0207676_100237792 806
268 3300026116 Ga0207674_10009062 Ga0207674_100090626 806
269 3300026121 Ga0207683_10008207 Ga0207683_100082078 806
270 3300028379 Ga0268266_10000181 Ga0268266_10000181113 806
271 3300037312 Ga0395899_0025343 Ga0395899_0025343_704_3331 806
272 3300037418 Ga0395900_0013324 Ga0395900_0013324_5205_7832 806
273 3300037466 Ga0395898_0003602 Ga0395898_0003602_11864_14491 806
274 3300038443 Ga0395901_0023381 Ga0395901_0023381_425_3052 806
275 3300044684 Ga0466966_0028206 Ga0466966_0028206_191_2776 806
276 3300049571 Ga0501034_0046882 Ga0501034_0046882_1037_3511 806
277 3300005328 Ga0070676_10022560 Ga0070676_100225602 807
278 3300005329 Ga0070683_100030680 Ga0070683_1000306802 807
279 3300005546 Ga0070696_100015462 Ga0070696_1000154624 807
280 3300005548 Ga0070665_100004800 Ga0070665_1000048008 807
281 3300005564 Ga0070664_100041505 Ga0070664_1000415052 807
282 3300026116 Ga0207674_10013991 Ga0207674_100139916 807
283 3300028379 Ga0268266_10003739 Ga0268266_100037399 807
284 3300005262 Ga0065165_1001810 Ga0065165_100181016 808
285 3300005345 Ga0070692_10002193 Ga0070692_100021934 808
286 3300005353 Ga0070669_100035785 Ga0070669_1000357852 808
287 3300005843 Ga0068860_100002208 Ga0068860_1000022087 808
288 3300005844 Ga0068862_100034239 Ga0068862_1000342391 808
289 3300013100 Ga0157373_10019689 Ga0157373_100196894 808
290 3300013296 Ga0157374_10032783 Ga0157374_100327832 808
291 3300013308 Ga0157375_10074822 Ga0157375_100748222 808
292 3300033180 Ga0307510_10001620 Ga0307510_100016207 808
293 3300037312 Ga0395899_0014342 Ga0395899_0014342_3008_5662 808
294 3300037312 Ga0395899_0017423 Ga0395899_0017423_2104_4818 808
295 3300037418 Ga0395900_0015325 Ga0395900_0015325_3535_6249 808
296 3300037466 Ga0395898_0013043 Ga0395898_0013043_4604_7258 808
297 3300037466 Ga0395898_0032484 Ga0395898_0032484_1203_3917 808
298 3300037471 Ga0395905_0026811 Ga0395905_0026811_756_3449 808
299 3300038443 Ga0395901_0017800 Ga0395901_0017800_2847_5561 808
300 3300001979 JGI24740J21852_10000840 JGI24740J21852_1000084011 809
301 3300001989 JGI24739J22299_10004250 JGI24739J22299_100042502 809
302 3300002067 JGI24735J21928_10003334 JGI24735J21928_100033344 809
303 3300005329 Ga0070683_100024730 Ga0070683_1000247302 809
304 3300005457 Ga0070662_100048701 Ga0070662_1000487012 809
305 3300005546 Ga0070696_100003138 Ga0070696_1000031389 809
306 3300005564 Ga0070664_100038689 Ga0070664_1000386892 809
307 3300005616 Ga0068852_100015112 Ga0068852_1000151122 809
308 3300009094 Ga0111539_10017555 Ga0111539_100175554 809
309 3300009551 Ga0105238_10021536 Ga0105238_100215364 809
310 3300013105 Ga0157369_10004778 Ga0157369_100047787 809
311 3300025909 Ga0207705_10007615 Ga0207705_100076154 809
312 3300025909 Ga0207705_10036747 Ga0207705_100367472 809
313 3300025912 Ga0207707_10022928 Ga0207707_100229282 809
314 3300025917 Ga0207660_10017087 Ga0207660_100170872 809
315 3300025920 Ga0207649_10019224 Ga0207649_100192242 809
316 3300026067 Ga0207678_10001226 Ga0207678_1000122611 809
317 3300026116 Ga0207674_10005315 Ga0207674_100053154 809
318 3300026142 Ga0207698_10011299 Ga0207698_100112992 809
319 3300037312 Ga0395899_0010837 Ga0395899_0010837_4303_6963 809
320 3300037418 Ga0395900_0023074 Ga0395900_0023074_2518_5178 809
321 3300037471 Ga0395905_0013867 Ga0395905_0013867_4413_7073 809
322 3300038443 Ga0395901_0011389 Ga0395901_0011389_4487_7147 809
323 3300042144 Ga0450889_000265 Ga0450889_000265_135_2768 809
324 3300053087 Ga0500643_005708 Ga0500643_005708_814_3408 809
325 3300003323 rootH1_10043878 rootH1_100438783 810
326 3300026089 Ga0207648_10037095 Ga0207648_100370952 810
327 iso_pu_bacteria 2643221560 2643820323 810
328 3300005331 Ga0070670_100002741 Ga0070670_1000027416 811
329 3300005366 Ga0070659_100005033 Ga0070659_1000050333 811
330 3300005618 Ga0068864_100000509 Ga0068864_10000050915 811
331 3300025925 Ga0207650_10002730 Ga0207650_1000273012 811
332 3300025932 Ga0207690_10002956 Ga0207690_100029562 811
333 3300048927 Ga0496124_0011267 Ga0496124_0011267_4321_6876 811
334 3300005355 Ga0070671_100024136 Ga0070671_1000241362 812
335 3300006358 Ga0068871_100017669 Ga0068871_1000176693 812
336 3300009177 Ga0105248_10038975 Ga0105248_100389753 812
337 3300025931 Ga0207644_10033594 Ga0207644_100335942 812
338 3300037471 Ga0395905_0016536 Ga0395905_0016536_3642_6236 812
339 3300048910 Ga0496107_0008365 Ga0496107_0008365_3511_6141 812
340 3300048917 Ga0496114_0005688 Ga0496114_0005688_6968_9598 812
341 3300005327 Ga0070658_10000033 Ga0070658_1000003355 813
342 3300005327 Ga0070658_10009299 Ga0070658_100092994 813
343 3300005339 Ga0070660_100001018 Ga0070660_10000101814 813
344 3300005355 Ga0070671_100054299 Ga0070671_1000542992 813
345 3300025909 Ga0207705_10000002 Ga0207705_100000021939 813
346 3300025909 Ga0207705_10001217 Ga0207705_1000121713 813
347 3300025919 Ga0207657_10004892 Ga0207657_100048923 813
348 3300026067 Ga0207678_10048645 Ga0207678_100486452 813
349 3300037418 Ga0395900_0001680 Ga0395900_0001680_6782_9430 813
350 3300038443 Ga0395901_0036459 Ga0395901_0036459_823_3471 813
351 3300046506 Ga0495583_0006888 Ga0495583_0006888_1835_4390 813
352 3300046660 Ga0495625_0005314 Ga0495625_0005314_7855_10410 813
353 3300048915 Ga0496112_0007890 Ga0496112_0007890_3969_6617 813
354 3300049570 Ga0501033_0020626 Ga0501033_0020626_1763_4282 813
355 3300049574 Ga0501038_0013129 Ga0501038_0013129_4612_7131 813
356 3300049822 Ga0501035_0023954 Ga0501035_0023954_946_3465 813
357 3300053121 Ga0500607_000011 Ga0500607_000011_73317_75953 813
358 3300005434 Ga0070709_10012379 Ga0070709_100123792 814
359 3300005435 Ga0070714_100010083 Ga0070714_1000100835 814
360 3300006173 Ga0070716_100011392 Ga0070716_1000113922 814
361 3300006175 Ga0070712_100010919 Ga0070712_1000109194 814
362 3300025915 Ga0207693_10009547 Ga0207693_100095472 814
363 3300025939 Ga0207665_10013292 Ga0207665_100132924 814
364 3300026142 Ga0207698_10055278 Ga0207698_100552781 814
365 3300031995 Ga0307409_100012696 Ga0307409_1000126963 814
366 3300005331 Ga0070670_100011685 Ga0070670_1000116855 815
367 3300005335 Ga0070666_10008188 Ga0070666_100081885 815
368 3300005338 Ga0068868_100000007 Ga0068868_100000007132 815
369 3300005339 Ga0070660_100000405 Ga0070660_10000040521 815
370 3300005364 Ga0070673_100007945 Ga0070673_1000079452 815
371 3300005366 Ga0070659_100000004 Ga0070659_100000004111 815
372 3300005367 Ga0070667_100024637 Ga0070667_1000246374 815
373 3300005456 Ga0070678_100006758 Ga0070678_1000067585 815
374 3300005457 Ga0070662_100007374 Ga0070662_1000073742 815
375 3300005543 Ga0070672_100008855 Ga0070672_1000088554 815
376 3300005564 Ga0070664_100012186 Ga0070664_1000121866 815
377 3300005618 Ga0068864_100026843 Ga0068864_1000268432 815
378 3300005842 Ga0068858_100013290 Ga0068858_1000132904 815
379 3300005843 Ga0068860_100027009 Ga0068860_1000270094 815
380 3300005985 Ga0081539_10022127 Ga0081539_100221272 815
381 3300006237 Ga0097621_100010698 Ga0097621_1000106985 815
382 3300006358 Ga0068871_100010978 Ga0068871_1000109785 815
383 3300013296 Ga0157374_10039077 Ga0157374_100390774 815
384 3300013306 Ga0163162_10010617 Ga0163162_100106175 815
385 3300013308 Ga0157375_10074288 Ga0157375_100742882 815
386 3300014325 Ga0163163_10043269 Ga0163163_100432694 815
387 3300025919 Ga0207657_10004207 Ga0207657_100042072 815
388 3300025932 Ga0207690_10000001 Ga0207690_10000001474 815
389 3300025932 Ga0207690_10000002 Ga0207690_10000002474 815
390 3300025932 Ga0207690_10000003 Ga0207690_10000003474 815
391 3300025932 Ga0207690_10000004 Ga0207690_10000004474 815
392 3300025933 Ga0207706_10000480 Ga0207706_100004806 815
393 3300025940 Ga0207691_10007026 Ga0207691_100070264 815
394 3300025960 Ga0207651_10024115 Ga0207651_100241152 815
395 3300026023 Ga0207677_10000014 Ga0207677_10000014102 815
396 3300026035 Ga0207703_10009181 Ga0207703_100091811 815
397 3300026095 Ga0207676_10006804 Ga0207676_100068042 815
398 3300026121 Ga0207683_10006175 Ga0207683_100061756 815
399 3300037312 Ga0395899_0035600 Ga0395899_0035600_527_3175 815
400 3300037418 Ga0395900_0017308 Ga0395900_0017308_3162_5879 815
401 3300037466 Ga0395898_0067806 Ga0395898_0067806_552_3200 815
402 3300038443 Ga0395901_0041261 Ga0395901_0041261_361_3009 815
403 3300038443 Ga0395901_0045828 Ga0395901_0045828_524_3241 815
404 3300046522 Ga0495643_0000826 Ga0495643_0000826_13543_16182 815
405 3300046616 Ga0495668_0000022 Ga0495668_0000022_198165_200804 815
406 3300047443 Ga0495687_000293 Ga0495687_000293_31180_33765 815
407 3300048912 Ga0496109_0008646 Ga0496109_0008646_633_3278 815
408 3300048913 Ga0496110_0028913 Ga0496110_0028913_622_3267 815
409 3300053130 Ga0500642_0000939 Ga0500642_0000939_3712_6237 815
410 3300053133 Ga0500655_000050 Ga0500655_000050_20073_22598 815
411 3300053148 Ga0500590_000291 Ga0500590_000291_2687_5212 815
412 3300053156 Ga0500622_0010857 Ga0500622_0010857_157_2682 815
413 3300053724 Ga0500570_008122 Ga0500570_008122_2333_4858 815
414 3300005327 Ga0070658_10011699 Ga0070658_100116996 816
415 3300005354 Ga0070675_100020437 Ga0070675_1000204374 816
416 3300005535 Ga0070684_100006000 Ga0070684_1000060003 816
417 3300009177 Ga0105248_10001586 Ga0105248_1000158619 816
418 3300025926 Ga0207659_10006793 Ga0207659_100067933 816
419 3300025931 Ga0207644_10006667 Ga0207644_100066674 816
420 3300025941 Ga0207711_10006891 Ga0207711_100068916 816
421 3300026067 Ga0207678_10011456 Ga0207678_100114563 816
422 3300048911 Ga0496108_0021847 Ga0496108_0021847_1066_3702 816
423 3300048915 Ga0496112_0008943 Ga0496112_0008943_4020_6656 816
424 3300048916 Ga0496113_0003801 Ga0496113_0003801_3063_5699 816
425 3300003215 JGI25153J46596_10000034 JGI25153J46596_1000003463 817
426 3300003215 JGI25153J46596_10000097 JGI25153J46596_1000009792 817
427 3300025297 Ga0209758_1000007 Ga0209758_1000007534 817
428 3300048924 Ga0496121_0010620 Ga0496121_0010620_7272_9824 817
429 3300001990 JGI24737J22298_10006718 JGI24737J22298_100067182 818
430 3300003759 Ga0055525_1000058 Ga0055525_1000058168 818
431 3300005331 Ga0070670_100006851 Ga0070670_1000068515 818
432 3300005333 Ga0070677_10000312 Ga0070677_100003126 818
433 3300005333 Ga0070677_10004136 Ga0070677_100041362 818
434 3300005356 Ga0070674_100036160 Ga0070674_1000361602 818
435 3300005841 Ga0068863_100039037 Ga0068863_1000390372 818
436 3300025230 Ga0209563_100024 Ga0209563_100024265 818
437 3300025893 Ga0207682_10000533 Ga0207682_100005337 818
438 3300025925 Ga0207650_10022295 Ga0207650_100222953 818
439 3300025933 Ga0207706_10006622 Ga0207706_100066226 818
440 3300026088 Ga0207641_10042329 Ga0207641_100423292 818
441 3300037418 Ga0395900_0070864 Ga0395900_0070864_351_2984 818
442 3300037471 Ga0395905_0014446 Ga0395905_0014446_2865_5525 818
443 3300037471 Ga0395905_0042326 Ga0395905_0042326_842_3475 818
444 3300037471 Ga0395905_0073038 Ga0395905_0073038_469_3102 818
445 3300046660 Ga0495625_0000469 Ga0495625_0000469_32333_34933 818
446 3300003762 Ga0055542_1000041 Ga0055542_100004174 819
447 3300003763 Ga0055529_1000040 Ga0055529_100004099 819
448 3300025254 Ga0209148_1000008 Ga0209148_1000008221 819
449 3300025272 Ga0209455_1000002 Ga0209455_10000021202 819
450 3300028786 Ga0307517_10017280 Ga0307517_100172804 819
451 3300037418 Ga0395900_0083661 Ga0395900_0083661_248_2968 819
452 3300044658 Ga0466972_0011839 Ga0466972_0011839_321_2963 819
453 3300044765 Ga0466970_0024124 Ga0466970_0024124_151_2868 819
454 3300044901 Ga0466960_0021657 Ga0466960_0021657_183_2825 819
455 3300045049 Ga0466959_0004576 Ga0466959_0004576_5839_8556 819
456 3300045836 Ga0466958_0005038 Ga0466958_0005038_448_3165 819
457 3300046492 Ga0495585_0017098 Ga0495585_0017098_1539_4136 819
458 3300046520 Ga0495637_0009175 Ga0495637_0009175_1301_3901 819
459 3300046684 Ga0495669_0000046 Ga0495669_0000046_7651_10323 819
460 3300046684 Ga0495669_0000049 Ga0495669_0000049_49603_52203 819
461 3300046691 Ga0495670_0007872 Ga0495670_0007872_167_2770 819
462 3300047443 Ga0495687_000043 Ga0495687_000043_139919_142570 819
463 3300053079 Ga0500610_0002791 Ga0500610_0002791_1115_3766 819
464 3300053730 Ga0500645_000145 Ga0500645_000145_28584_31184 819
465 3300037418 Ga0395900_0006747 Ga0395900_0006747_722_3439 820
466 3300037471 Ga0395905_0023020 Ga0395905_0023020_2170_4887 820
467 3300046471 Ga0495650_0000091 Ga0495650_0000091_132158_134761 820
468 3300046691 Ga0495670_0000003 Ga0495670_0000003_312767_315325 820
469 3300046507 Ga0495606_0000390 Ga0495606_0000390_20247_22892 821
470 3300005331 Ga0070670_100012862 Ga0070670_1000128622 822
471 3300005344 Ga0070661_100013928 Ga0070661_1000139282 822
472 3300005436 Ga0070713_100033381 Ga0070713_1000333812 822
473 3300005459 Ga0068867_100018239 Ga0068867_1000182393 822
474 3300005543 Ga0070672_100010560 Ga0070672_1000105606 822
475 3300005564 Ga0070664_100000247 Ga0070664_10000024726 822
476 3300025901 Ga0207688_10016533 Ga0207688_100165333 822
477 3300025925 Ga0207650_10004763 Ga0207650_100047632 822
478 3300025933 Ga0207706_10005186 Ga0207706_1000518610 822
479 3300025935 Ga0207709_10000005 Ga0207709_10000005221 822
480 3300025940 Ga0207691_10014963 Ga0207691_100149634 822
481 3300026089 Ga0207648_10023761 Ga0207648_100237612 822
482 3300026121 Ga0207683_10019106 Ga0207683_100191062 822
483 3300031995 Ga0307409_100036108 Ga0307409_1000361082 822
484 3300038443 Ga0395901_0015419 Ga0395901_0015419_260_2956 822
485 3300046528 Ga0495642_0004390 Ga0495642_0004390_2769_5426 823
486 3300005355 Ga0070671_100006028 Ga0070671_1000060286 824
487 3300013296 Ga0157374_10024065 Ga0157374_100240654 824
488 3300025931 Ga0207644_10018036 Ga0207644_100180364 824
489 3300033180 Ga0307510_10077067 Ga0307510_100770672 824
490 3300045976 Ga0466967_0019810 Ga0466967_0019810_647_3328 824
491 3300045976 Ga0466967_0025870 Ga0466967_0025870_1030_3687 824
492 3300046506 Ga0495583_0000693 Ga0495583_0000693_20318_22966 824
493 3300048917 Ga0496114_0052210 Ga0496114_0052210_110_2782 824
494 3300048918 Ga0496115_0000301 Ga0496115_0000301_16248_18920 824
495 3300009176 Ga0105242_10058866 Ga0105242_100588662 825
496 3300046522 Ga0495643_0002531 Ga0495643_0002531_4676_7333 825
497 3300053177 Ga0500636_0002492 Ga0500636_0002492_2538_5138 825
498 3300002067 JGI24735J21928_10006678 JGI24735J21928_100066783 826
499 3300005336 Ga0070680_100005032 Ga0070680_1000050325 826
500 3300005339 Ga0070660_100003945 Ga0070660_1000039458 826
501 3300005564 Ga0070664_100036818 Ga0070664_1000368182 826
502 3300013100 Ga0157373_10026144 Ga0157373_100261442 826
503 3300013104 Ga0157370_10018175 Ga0157370_100181752 826
504 3300025923 Ga0207681_10011670 Ga0207681_100116702 826
505 3300025945 Ga0207679_10039835 Ga0207679_100398352 826
506 3300031456 Ga0307513_10013148 Ga0307513_100131485 826
507 3300048926 Ga0496123_0006359 Ga0496123_0006359_6974_9619 826
508 3300005327 Ga0070658_10041711 Ga0070658_100417112 827
509 3300005614 Ga0068856_100068799 Ga0068856_1000687992 827
510 3300005616 Ga0068852_100038415 Ga0068852_1000384152 827
511 3300013100 Ga0157373_10012888 Ga0157373_100128884 827
512 3300025919 Ga0207657_10011611 Ga0207657_100116114 827
513 3300025920 Ga0207649_10030433 Ga0207649_100304331 827
514 3300025932 Ga0207690_10014590 Ga0207690_100145904 827
515 3300026078 Ga0207702_10064217 Ga0207702_100642172 827
516 3300046539 Ga0495621_0001226 Ga0495621_0001226_1132_3852 827
517 3300046558 Ga0495633_0003893 Ga0495633_0003893_1750_4470 827
518 iso_pu_bacteria 2599185359 2600228193 827
519 iso_pu_bacteria 2818991466 2819716238 827
520 iso_pu_bacteria 2928526807 2928528959 827
521 iso_pu_bacteria 2928968154 2928971194 827
522 3300005336 Ga0070680_100013651 Ga0070680_1000136514 828
523 3300025917 Ga0207660_10000492 Ga0207660_1000049221 828
524 3300025921 Ga0207652_10016169 Ga0207652_100161694 828
525 3300005367 Ga0070667_100022077 Ga0070667_1000220772 829
526 3300046506 Ga0495583_0015304 Ga0495583_0015304_648_3251 829
527 3300046660 Ga0495625_0013215 Ga0495625_0013215_561_3164 829
528 3300053130 Ga0500642_0002192 Ga0500642_0002192_1099_3702 829
529 3300005327 Ga0070658_10033383 Ga0070658_100333832 830
530 3300005331 Ga0070670_100000716 Ga0070670_10000071625 830
531 3300005344 Ga0070661_100026881 Ga0070661_1000268814 830
532 3300005353 Ga0070669_100004211 Ga0070669_1000042116 830
533 3300005355 Ga0070671_100000407 Ga0070671_10000040724 830
534 3300005457 Ga0070662_100002550 Ga0070662_1000025502 830
535 3300005564 Ga0070664_100002842 Ga0070664_1000028423 830
536 3300005842 Ga0068858_100000181 Ga0068858_10000018129 830
537 3300009177 Ga0105248_10014710 Ga0105248_100147104 830
538 3300009177 Ga0105248_10055497 Ga0105248_100554973 830
539 3300013306 Ga0163162_10007146 Ga0163162_100071463 830
540 3300025909 Ga0207705_10026911 Ga0207705_100269112 830
541 3300025920 Ga0207649_10016349 Ga0207649_100163492 830
542 3300025925 Ga0207650_10000200 Ga0207650_1000020037 830
543 3300025931 Ga0207644_10001728 Ga0207644_100017288 830
544 3300025933 Ga0207706_10005358 Ga0207706_100053583 830
545 3300025941 Ga0207711_10008462 Ga0207711_100084623 830
546 3300025945 Ga0207679_10020156 Ga0207679_100201564 830
547 3300026035 Ga0207703_10000135 Ga0207703_1000013535 830
548 3300026067 Ga0207678_10053405 Ga0207678_100534052 830
549 3300031901 Ga0307406_10008897 Ga0307406_100088972 830
550 3300046524 Ga0495648_0000065 Ga0495648_0000065_23261_25864 830
551 3300046684 Ga0495669_0000899 Ga0495669_0000899_1180_3903 830
552 3300048905 Ga0496102_0000384 Ga0496102_0000384_22364_25015 830
553 3300048906 Ga0496103_0000122 Ga0496103_0000122_59216_61867 830
554 3300048907 Ga0496104_0003131 Ga0496104_0003131_3872_6523 830
555 3300048908 Ga0496105_0000267 Ga0496105_0000267_807_3458 830
556 3300048913 Ga0496110_0003888 Ga0496110_0003888_4875_7526 830
557 3300048918 Ga0496115_0000122 Ga0496115_0000122_22182_24833 830
558 3300048919 Ga0496116_0004379 Ga0496116_0004379_841_3492 830
559 3300048920 Ga0496117_0000300 Ga0496117_0000300_22364_25015 830
560 3300048921 Ga0496118_0000547 Ga0496118_0000547_36559_39210 830
561 3300048922 Ga0496119_0005819 Ga0496119_0005819_4972_7623 830
562 3300048924 Ga0496121_0002643 Ga0496121_0002643_22351_25002 830
563 3300048927 Ga0496124_0000337 Ga0496124_0000337_61227_63878 830
564 3300048929 Ga0496126_0000416 Ga0496126_0000416_61229_63880 830
565 3300005336 Ga0070680_100011326 Ga0070680_1000113264 831
566 3300005337 Ga0070682_100002792 Ga0070682_1000027926 831
567 3300005341 Ga0070691_10002673 Ga0070691_100026735 831
568 3300005535 Ga0070684_100001781 Ga0070684_1000017819 831
569 3300005564 Ga0070664_100016155 Ga0070664_1000161553 831
570 3300005577 Ga0068857_100049656 Ga0068857_1000496562 831
571 3300009093 Ga0105240_10002534 Ga0105240_1000253412 831
572 3300009545 Ga0105237_10003027 Ga0105237_100030276 831
573 3300010375 Ga0105239_10000156 Ga0105239_1000015631 831
574 3300013100 Ga0157373_10008085 Ga0157373_100080855 831
575 3300013307 Ga0157372_10035366 Ga0157372_100353662 831
576 3300025904 Ga0207647_10001105 Ga0207647_100011059 831
577 3300025913 Ga0207695_10000521 Ga0207695_1000052114 831
578 3300025913 Ga0207695_10028754 Ga0207695_100287546 831
579 3300025914 Ga0207671_10000607 Ga0207671_1000060739 831
580 3300025932 Ga0207690_10013525 Ga0207690_100135251 831
581 3300025944 Ga0207661_10006376 Ga0207661_100063762 831
582 3300025981 Ga0207640_10008872 Ga0207640_100088721 831
583 3300026067 Ga0207678_10021226 Ga0207678_100212263 831
584 3300026116 Ga0207674_10003891 Ga0207674_100038919 831
585 3300032002 Ga0307416_100000416 Ga0307416_1000004167 831
586 3300047472 Ga0495686_0000849 Ga0495686_0000849_3597_6212 831
587 3300048924 Ga0496121_0004773 Ga0496121_0004773_15156_17762 831
588 3300048929 Ga0496126_0005624 Ga0496126_0005624_9940_12546 831
589 3300031852 Ga0307410_10000124 Ga0307410_1000012418 832
590 3300032005 Ga0307411_10031145 Ga0307411_100311452 832
591 3300046558 Ga0495633_0002445 Ga0495633_0002445_6429_9032 832
592 3300001915 JGI24741J21665_1001079 JGI24741J21665_10010793 833
593 3300001990 JGI24737J22298_10006121 JGI24737J22298_100061211 833
594 3300005327 Ga0070658_10004264 Ga0070658_100042644 833
595 3300005339 Ga0070660_100009744 Ga0070660_1000097443 833
596 3300005344 Ga0070661_100019002 Ga0070661_1000190022 833
597 3300005366 Ga0070659_100031048 Ga0070659_1000310482 833
598 3300005564 Ga0070664_100016097 Ga0070664_1000160973 833
599 3300009174 Ga0105241_10001067 Ga0105241_1000106712 833
600 3300025321 Ga0207656_10000677 Ga0207656_100006772 833
601 3300025904 Ga0207647_10032113 Ga0207647_100321131 833
602 3300025909 Ga0207705_10000253 Ga0207705_1000025313 833
603 3300025911 Ga0207654_10000449 Ga0207654_100004499 833
604 3300025913 Ga0207695_10047602 Ga0207695_100476022 833
605 3300025914 Ga0207671_10008025 Ga0207671_100080252 833
606 3300025919 Ga0207657_10010998 Ga0207657_100109986 833
607 3300025920 Ga0207649_10000850 Ga0207649_100008505 833
608 3300025932 Ga0207690_10008543 Ga0207690_100085432 833
609 3300025945 Ga0207679_10030427 Ga0207679_100304272 833
610 3300025949 Ga0207667_10000001 Ga0207667_10000001768 833
611 3300025981 Ga0207640_10007833 Ga0207640_100078333 833
612 3300026041 Ga0207639_10001401 Ga0207639_100014016 833
613 3300026078 Ga0207702_10030679 Ga0207702_100306792 833
614 3300026116 Ga0207674_10026537 Ga0207674_100265373 833
615 3300026142 Ga0207698_10006090 Ga0207698_100060904 833
616 3300038443 Ga0395901_0049327 Ga0395901_0049327_12_2717 833
617 iso_pu_bacteria 2738541275 2738709432 833
618 iso_pu_bacteria 2738541301 2738847857 833
619 iso_pu_bacteria 2738541304 2738863586 833
620 iso_pu_bacteria 2738543022 2739296104 833
621 iso_pu_bacteria 2738543033 2739357782 833
622 iso_pu_bacteria 2928100450 2928102569 833
623 iso_pu_bacteria 2928959182 2928959345 833
624 3300047470 Ga0495681_0010700 Ga0495681_0010700_1250_3910 836
625 3300025940 Ga0207691_10013911 Ga0207691_100139115 837
626 3300028786 Ga0307517_10007919 Ga0307517_1000791911 838
627 3300005548 Ga0070665_100000537 Ga0070665_10000053720 845
628 3300028379 Ga0268266_10000074 Ga0268266_10000074176 845
629 2162886007 SwRhRL2b_contig_1875504 SwRhRL2b_0698.00007500 860
630 3300005289 Ga0065704_10000358 Ga0065704_1000035819 860
631 3300005353 Ga0070669_100002756 Ga0070669_1000027565 860
632 3300005355 Ga0070671_100006646 Ga0070671_1000066464 860
633 3300005548 Ga0070665_100004116 Ga0070665_1000041169 860
634 3300009177 Ga0105248_10023141 Ga0105248_100231414 860
635 3300025923 Ga0207681_10000926 Ga0207681_1000092615 860
636 3300025931 Ga0207644_10005709 Ga0207644_100057094 860
637 3300028379 Ga0268266_10007793 Ga0268266_100077934 860
638 3300048905 Ga0496102_0000170 Ga0496102_0000170_25243_27924 860
639 3300048906 Ga0496103_0000081 Ga0496103_0000081_17263_19944 860
640 3300048907 Ga0496104_0003648 Ga0496104_0003648_7892_10573 860
641 3300048908 Ga0496105_0000034 Ga0496105_0000034_7891_10572 860
642 3300048916 Ga0496113_0001238 Ga0496113_0001238_7823_10504 860
643 3300048922 Ga0496119_0000057 Ga0496119_0000057_163175_165856 860
644 3300048923 Ga0496120_0003771 Ga0496120_0003771_6042_8723 860
645 3300048926 Ga0496123_0002890 Ga0496123_0002890_3564_6245 860
646 3300048928 Ga0496125_0003862 Ga0496125_0003862_3564_6245 860
647 3300048929 Ga0496126_0000028 Ga0496126_0000028_181534_184215 860

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

82

197

0.96

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

261

877

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4epa-assembly1.cif.gz_A the crystal structure of the ferric yersiniabactin uptake receptor fyua from yersinia pestis 0.8691 49 860
4epa-assembly1.cif.gz_A the crystal structure of the ferric yersiniabactin uptake receptor fyua from yersinia pestis 0.8496 49 860
3m8b-assembly1.cif.gz_A crystal structure of spin-labeled btub v10r1 in the apo state 0.8425 39 860
1nqg-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli, with bound calcium 0.8318 48 860
1nqe-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli 0.8291 48 860
ID Description Score Start End Superfamily
4epaA00 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8716 49 860 2.40.170.20
4epaA00 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8512 49 860 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8283 173 860 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.8139 173 860 2.40.170.20
1kmpA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7999 169 860 2.40.170.20
ID Description Score Start End GO Terms
AF-A0A418WJQ9-F1-model_v4 TonB-dependent receptor 0.8906 586 860 GO:0006826
GO:0009279
AF-A0A0F3IK49-F1-model_v4 TonB-dependent receptor-like beta-barrel domain-containing protein 0.8787 586 860 GO:0006826
GO:0009279
AF-A0A6M1Y956-F1-model_v4 TonB-dependent receptor 0.8711 42 860 GO:0006826
GO:0009279
AF-A0A7W7B491-F1-model_v4 Outer membrane receptor protein involved in Fe transport 0.8682 132 860 GO:0006826
GO:0009279
AF-A0A660P0W3-F1-model_v4 TonB-dependent receptor 0.8667 109 860 GO:0006826
GO:0009279

Feature Viewer

pLDDT pTM Quality
86.27 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map