F472257
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 273 | 626 | 850 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100013651|Ga0070680_1000136514 |
| Length | 914 |
| Sequence | MGAFAMTNRTVRALTVGFLASTALAPPLWAADSQPQTTGQSPAPATNATDVTAPPPKVQQAQQGQVPDQSEIIITATKREENLQNVPISVQVLGNRRLDQLNISNFEQFTKQLPSVSFLEYQPGQTTVYMRGISSSGGSNSEGNHSGPLPQVGFYLDEQPITTIGGTLDVHIYDIARIENLSGPQGTLYGASSEAGTIRIITNKPELGRTYGRVDAEVNSVDHGGIGGKLEGMINLPLTSRIAFRGVAFDQRDAGFIDNVFGSRTYCGTTITDPVTQAAIGCVLDGPTVTNAGLVKKNFNYQDVYGGRAALKIDLDDNWTAEPTFMYQKSYANGVFFYDPKLGDLKIDRFRHEWSKDRFWQAALTLQGKIANFDVTYAGAYMDRPNKGINDYADYTDQYDRLYQSVGGLAYYFYLQDAAGNFVANPQQWIKGSNHFRKLSQELRFASPIENPFRVIAGAFYQRQSNFIHQDYKVDDLGPQVSVNGHTGTLWLTQQERVDRDYALFGEASWDVLPKVTLTAGARAFRYDNSLVGFFGFGRNPAGDFTSKPFNAAGSSHTGVVSCFLNNGETLGQAVANGEDVTGIGFAPAVVPGSPCTNLGVFSNGNVLPKHAKGSGVTWRFNGQWKPRNNLMFYATWSKGFRPGGINRRGDIGPYAPDFLYNVEAGWKTTFGPIRWNGAIYHELWQAFQFAFLGANSFTEIHNGKNARVNGLETDINYIHRGLTLNATAAYTDAKTKGNICSISSDTDPNCAGVIEVDPGDFVQDFISAPSGTRLPVTPKFKGSASARYSWPAWANVMAHVQGVVSYQGSAPSSLRTQVQLVGTDATAVCAAAGALLPDGLCDPNKFQGKLRSATLVDLYAGLDWANWNFEIFGTNIFDKRNDLSRFTACGSCTRALVVPGRPRTIGIRAGLKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 6 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 7 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 8 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 9 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 10 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 11 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 12 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 13 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 14 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 15 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 16 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 17 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 18 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 19 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 20 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 21 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 22 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 23 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 27 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 28 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 29 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 30 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 47 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 184 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 187 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 241 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 242 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 246 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 247 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 248 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 249 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 260 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 261 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 262 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 263 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 264 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 265 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 266 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 267 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 269 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 272 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 273 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.75 |
| Metatranscriptomes | 0 |
| Isolates | 3.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.8 |
| Nodule | 0 |
| Rhizoplane | 4.33 |
| Rhizosphere | 80.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1875504 | 2162886007 | Bacteria | 7481 |
| 2 | JGI24741J21665_1001079 | 3300001915 | Bacteria | 8149 |
| 3 | JGI24740J21852_10000840 | 3300001979 | Bacteria | 13577 |
| 4 | JGI24740J21852_10007092 | 3300001979 | Bacteria | 4588 |
| 5 | JGI24739J22299_10004250 | 3300001989 | Bacteria | 5484 |
| 6 | JGI24739J22299_10006537 | 3300001989 | Bacteria | 4390 |
| 7 | JGI24739J22299_10007032 | 3300001989 | Bacteria | 4236 |
| 8 | JGI24737J22298_10006121 | 3300001990 | Bacteria | 4122 |
| 9 | JGI24737J22298_10006718 | 3300001990 | Bacteria | 3914 |
| 10 | JGI24735J21928_10003334 | 3300002067 | Bacteria | 5479 |
| 11 | JGI24735J21928_10003862 | 3300002067 | Bacteria | 5071 |
| 12 | JGI24735J21928_10006678 | 3300002067 | Bacteria | 3787 |
| 13 | JGI24738J21930_10001669 | 3300002075 | Bacteria | 6074 |
| 14 | JGI24744J21845_10000306 | 3300002077 | Bacteria | 8226 |
| 15 | JGI25153J46596_10000034 | 3300003215 | Bacteria | 192215 |
| 16 | JGI25153J46596_10000097 | 3300003215 | Bacteria | 101627 |
| 17 | rootH1_10043878 | 3300003323 | Bacteria | 6581 |
| 18 | Ga0055525_1000058 | 3300003759 | Bacteria | 210367 |
| 19 | Ga0055542_1000041 | 3300003762 | Bacteria | 208892 |
| 20 | Ga0055529_1000040 | 3300003763 | Bacteria | 230562 |
| 21 | Ga0055536_1004780 | 3300003781 | Bacteria | 6793 |
| 22 | Ga0055536_1004876 | 3300003781 | Bacteria | 6697 |
| 23 | Ga0055530_10004796 | 3300003791 | Bacteria | 6785 |
| 24 | Ga0055530_10004858 | 3300003791 | Bacteria | 6708 |
| 25 | Ga0055531_10004028 | 3300003794 | Bacteria | 9116 |
| 26 | Ga0065165_1001810 | 3300005262 | Bacteria | 20963 |
| 27 | Ga0065704_10000358 | 3300005289 | Bacteria | 27729 |
| 28 | Ga0065715_10091114 | 3300005293 | Bacteria | 6098 |
| 29 | Ga0070658_10000033 | 3300005327 | Bacteria | 147380 |
| 30 | Ga0070658_10000809 | 3300005327 | Bacteria | 26763 |
| 31 | Ga0070658_10004262 | 3300005327 | Bacteria | 11685 |
| 32 | Ga0070658_10004264 | 3300005327 | Bacteria | 11685 |
| 33 | Ga0070658_10009299 | 3300005327 | Bacteria | 7905 |
| 34 | Ga0070658_10011699 | 3300005327 | Bacteria | 7039 |
| 35 | Ga0070658_10033383 | 3300005327 | Bacteria | 4140 |
| 36 | Ga0070658_10041711 | 3300005327 | Bacteria | 3703 |
| 37 | Ga0070676_10022560 | 3300005328 | Bacteria | 3530 |
| 38 | Ga0070683_100024730 | 3300005329 | Bacteria | 5383 |
| 39 | Ga0070683_100030680 | 3300005329 | Bacteria | 4883 |
| 40 | Ga0070670_100000716 | 3300005331 | Bacteria | 25784 |
| 41 | Ga0070670_100000968 | 3300005331 | Bacteria | 22548 |
| 42 | Ga0070670_100002741 | 3300005331 | Bacteria | 14548 |
| 43 | Ga0070670_100006851 | 3300005331 | Bacteria | 9653 |
| 44 | Ga0070670_100011660 | 3300005331 | Bacteria | 7517 |
| 45 | Ga0070670_100011685 | 3300005331 | Bacteria | 7510 |
| 46 | Ga0070670_100012862 | 3300005331 | Bacteria | 7164 |
| 47 | Ga0070677_10000312 | 3300005333 | Bacteria | 16970 |
| 48 | Ga0070677_10003937 | 3300005333 | Bacteria | 4819 |
| 49 | Ga0070677_10004136 | 3300005333 | Bacteria | 4713 |
| 50 | Ga0068869_100002970 | 3300005334 | Bacteria | 10301 |
| 51 | Ga0070666_10008188 | 3300005335 | Bacteria | 6478 |
| 52 | Ga0070666_10013070 | 3300005335 | Bacteria | 5259 |
| 53 | Ga0070680_100005032 | 3300005336 | Bacteria | 9971 |
| 54 | Ga0070680_100011326 | 3300005336 | Bacteria | 6897 |
| 55 | Ga0070680_100013651 | 3300005336 | Bacteria | 6333 |
| 56 | Ga0070682_100002792 | 3300005337 | Bacteria | 9674 |
| 57 | Ga0068868_100000007 | 3300005338 | Bacteria | 123028 |
| 58 | Ga0068868_100005974 | 3300005338 | Bacteria | 8590 |
| 59 | Ga0070660_100000405 | 3300005339 | Bacteria | 28752 |
| 60 | Ga0070660_100000558 | 3300005339 | Bacteria | 25015 |
| 61 | Ga0070660_100001018 | 3300005339 | Bacteria | 18836 |
| 62 | Ga0070660_100003320 | 3300005339 | Bacteria | 11057 |
| 63 | Ga0070660_100003945 | 3300005339 | Bacteria | 10254 |
| 64 | Ga0070660_100009744 | 3300005339 | Bacteria | 6770 |
| 65 | Ga0070691_10002673 | 3300005341 | Bacteria | 7942 |
| 66 | Ga0070661_100013928 | 3300005344 | Bacteria | 5652 |
| 67 | Ga0070661_100019002 | 3300005344 | Bacteria | 4892 |
| 68 | Ga0070661_100026881 | 3300005344 | Bacteria | 4142 |
| 69 | Ga0070692_10002193 | 3300005345 | Bacteria | 7477 |
| 70 | Ga0070692_10002664 | 3300005345 | Bacteria | 6991 |
| 71 | Ga0070692_10003449 | 3300005345 | Bacteria | 6413 |
| 72 | Ga0070692_10005692 | 3300005345 | Bacteria | 5347 |
| 73 | Ga0070668_100001032 | 3300005347 | Bacteria | 19554 |
| 74 | Ga0070668_100018211 | 3300005347 | Bacteria | 5270 |
| 75 | Ga0070669_100002756 | 3300005353 | Bacteria | 12679 |
| 76 | Ga0070669_100004211 | 3300005353 | Bacteria | 10406 |
| 77 | Ga0070669_100005377 | 3300005353 | Bacteria | 9241 |
| 78 | Ga0070669_100035785 | 3300005353 | Bacteria | 3597 |
| 79 | Ga0070669_100041028 | 3300005353 | Bacteria | 3365 |
| 80 | Ga0070669_100052095 | 3300005353 | Bacteria | 2993 |
| 81 | Ga0070675_100000229 | 3300005354 | Bacteria | 36015 |
| 82 | Ga0070675_100020437 | 3300005354 | Bacteria | 5284 |
| 83 | Ga0070671_100000407 | 3300005355 | Bacteria | 29738 |
| 84 | Ga0070671_100006028 | 3300005355 | Bacteria | 9659 |
| 85 | Ga0070671_100006646 | 3300005355 | Bacteria | 9244 |
| 86 | Ga0070671_100024136 | 3300005355 | Bacteria | 4977 |
| 87 | Ga0070671_100024959 | 3300005355 | Bacteria | 4898 |
| 88 | Ga0070671_100054299 | 3300005355 | Bacteria | 3331 |
| 89 | Ga0070674_100003998 | 3300005356 | Bacteria | 8358 |
| 90 | Ga0070674_100004843 | 3300005356 | Bacteria | 7716 |
| 91 | Ga0070674_100029362 | 3300005356 | Bacteria | 3621 |
| 92 | Ga0070674_100036160 | 3300005356 | Bacteria | 3312 |
| 93 | Ga0070673_100005349 | 3300005364 | Bacteria | 8202 |
| 94 | Ga0070673_100007945 | 3300005364 | Bacteria | 7030 |
| 95 | Ga0070673_100046010 | 3300005364 | Bacteria | 3387 |
| 96 | Ga0070659_100000004 | 3300005366 | Bacteria | 267958 |
| 97 | Ga0070659_100003704 | 3300005366 | Bacteria | 10904 |
| 98 | Ga0070659_100005033 | 3300005366 | Bacteria | 9473 |
| 99 | Ga0070659_100027625 | 3300005366 | Bacteria | 4375 |
| 100 | Ga0070659_100031048 | 3300005366 | Bacteria | 4136 |
| 101 | Ga0070659_100044475 | 3300005366 | Bacteria | 3477 |
| 102 | Ga0070667_100005475 | 3300005367 | Bacteria | 10597 |
| 103 | Ga0070667_100022077 | 3300005367 | Bacteria | 5281 |
| 104 | Ga0070667_100024637 | 3300005367 | Bacteria | 4999 |
| 105 | Ga0070667_100025654 | 3300005367 | Bacteria | 4901 |
| 106 | Ga0070667_100027117 | 3300005367 | Bacteria | 4767 |
| 107 | Ga0070667_100037217 | 3300005367 | Bacteria | 4079 |
| 108 | Ga0070709_10012379 | 3300005434 | Bacteria | 4774 |
| 109 | Ga0070714_100010083 | 3300005435 | Bacteria | 7456 |
| 110 | Ga0070713_100033381 | 3300005436 | Bacteria | 4121 |
| 111 | Ga0070694_100005612 | 3300005444 | Bacteria | 7605 |
| 112 | Ga0070663_100017178 | 3300005455 | Bacteria | 4716 |
| 113 | Ga0070678_100003165 | 3300005456 | Bacteria | 9116 |
| 114 | Ga0070678_100006758 | 3300005456 | Bacteria | 6759 |
| 115 | Ga0070662_100001340 | 3300005457 | Bacteria | 15141 |
| 116 | Ga0070662_100002358 | 3300005457 | Bacteria | 11608 |
| 117 | Ga0070662_100002550 | 3300005457 | Bacteria | 11217 |
| 118 | Ga0070662_100007374 | 3300005457 | Bacteria | 7126 |
| 119 | Ga0070662_100012530 | 3300005457 | Bacteria | 5624 |
| 120 | Ga0070662_100048701 | 3300005457 | Bacteria | 3053 |
| 121 | Ga0068867_100002596 | 3300005459 | Bacteria | 12739 |
| 122 | Ga0068867_100018239 | 3300005459 | Bacteria | 4986 |
| 123 | Ga0070684_100001781 | 3300005535 | Bacteria | 15732 |
| 124 | Ga0070684_100006000 | 3300005535 | Bacteria | 9359 |
| 125 | Ga0070672_100001475 | 3300005543 | Bacteria | 14600 |
| 126 | Ga0070672_100007220 | 3300005543 | Bacteria | 7526 |
| 127 | Ga0070672_100008584 | 3300005543 | Bacteria | 6998 |
| 128 | Ga0070672_100008855 | 3300005543 | Bacteria | 6912 |
| 129 | Ga0070672_100010560 | 3300005543 | Bacteria | 6409 |
| 130 | Ga0070686_100000465 | 3300005544 | Bacteria | 24524 |
| 131 | Ga0070696_100003138 | 3300005546 | Bacteria | 11006 |
| 132 | Ga0070696_100015462 | 3300005546 | Bacteria | 5124 |
| 133 | Ga0070693_100017967 | 3300005547 | Bacteria | 3687 |
| 134 | Ga0070665_100000493 | 3300005548 | Bacteria | 56564 |
| 135 | Ga0070665_100000537 | 3300005548 | Bacteria | 53369 |
| 136 | Ga0070665_100004116 | 3300005548 | Bacteria | 15300 |
| 137 | Ga0070665_100004800 | 3300005548 | Bacteria | 14058 |
| 138 | Ga0070665_100015800 | 3300005548 | Bacteria | 7582 |
| 139 | Ga0070665_100079750 | 3300005548 | Bacteria | 3279 |
| 140 | Ga0068855_100000140 | 3300005563 | Bacteria | 92525 |
| 141 | Ga0070664_100000247 | 3300005564 | Bacteria | 38997 |
| 142 | Ga0070664_100002842 | 3300005564 | Bacteria | 14008 |
| 143 | Ga0070664_100012186 | 3300005564 | Bacteria | 6987 |
| 144 | Ga0070664_100016097 | 3300005564 | Bacteria | 6129 |
| 145 | Ga0070664_100016155 | 3300005564 | Bacteria | 6117 |
| 146 | Ga0070664_100036818 | 3300005564 | Bacteria | 4111 |
| 147 | Ga0070664_100038689 | 3300005564 | Bacteria | 4016 |
| 148 | Ga0070664_100041505 | 3300005564 | Bacteria | 3882 |
| 149 | Ga0068857_100031990 | 3300005577 | Bacteria | 4650 |
| 150 | Ga0068857_100049656 | 3300005577 | Bacteria | 3722 |
| 151 | Ga0068857_100061112 | 3300005577 | Bacteria | 3347 |
| 152 | Ga0068854_100000103 | 3300005578 | Bacteria | 59186 |
| 153 | Ga0068856_100068799 | 3300005614 | Bacteria | 3500 |
| 154 | Ga0068856_100092404 | 3300005614 | Bacteria | 3011 |
| 155 | Ga0068852_100009838 | 3300005616 | Bacteria | 7113 |
| 156 | Ga0068852_100015112 | 3300005616 | Bacteria | 5972 |
| 157 | Ga0068852_100036536 | 3300005616 | Bacteria | 4111 |
| 158 | Ga0068852_100038415 | 3300005616 | Bacteria | 4023 |
| 159 | Ga0068859_100014575 | 3300005617 | Bacteria | 7895 |
| 160 | Ga0068859_100045593 | 3300005617 | Bacteria | 4404 |
| 161 | Ga0068864_100000509 | 3300005618 | Bacteria | 33512 |
| 162 | Ga0068864_100026843 | 3300005618 | Bacteria | 4857 |
| 163 | Ga0068861_100001690 | 3300005719 | Bacteria | 14160 |
| 164 | Ga0068861_100005114 | 3300005719 | Bacteria | 8845 |
| 165 | Ga0068851_10009179 | 3300005834 | Bacteria | 4592 |
| 166 | Ga0068863_100039037 | 3300005841 | Bacteria | 4518 |
| 167 | Ga0068858_100000181 | 3300005842 | Bacteria | 66254 |
| 168 | Ga0068858_100011918 | 3300005842 | Bacteria | 8194 |
| 169 | Ga0068858_100013290 | 3300005842 | Bacteria | 7762 |
| 170 | Ga0068858_100025525 | 3300005842 | Bacteria | 5497 |
| 171 | Ga0068860_100002208 | 3300005843 | Bacteria | 20485 |
| 172 | Ga0068860_100027009 | 3300005843 | Bacteria | 5531 |
| 173 | Ga0068860_100069398 | 3300005843 | Bacteria | 3350 |
| 174 | Ga0068862_100001874 | 3300005844 | Bacteria | 19050 |
| 175 | Ga0068862_100020346 | 3300005844 | Bacteria | 5543 |
| 176 | Ga0068862_100034239 | 3300005844 | Bacteria | 4296 |
| 177 | Ga0068862_100040204 | 3300005844 | Bacteria | 3975 |
| 178 | Ga0081539_10022127 | 3300005985 | Bacteria | 4218 |
| 179 | Ga0070716_100011392 | 3300006173 | Bacteria | 4475 |
| 180 | Ga0070712_100010919 | 3300006175 | Bacteria | 5743 |
| 181 | Ga0075369_10001000 | 3300006186 | Bacteria | 9425 |
| 182 | Ga0097621_100010698 | 3300006237 | Bacteria | 6724 |
| 183 | Ga0068871_100003159 | 3300006358 | Bacteria | 11312 |
| 184 | Ga0068871_100010978 | 3300006358 | Bacteria | 6634 |
| 185 | Ga0068871_100017669 | 3300006358 | Bacteria | 5402 |
| 186 | Ga0075431_100013164 | 3300006847 | Bacteria | 8358 |
| 187 | Ga0097620_100014574 | 3300006931 | Bacteria | 7895 |
| 188 | Ga0097620_100045592 | 3300006931 | Bacteria | 4404 |
| 189 | Ga0105240_10002534 | 3300009093 | Bacteria | 29308 |
| 190 | Ga0111539_10017555 | 3300009094 | Bacteria | 8857 |
| 191 | Ga0105245_10015390 | 3300009098 | Bacteria | 6668 |
| 192 | Ga0105245_10016818 | 3300009098 | Bacteria | 6386 |
| 193 | Ga0105243_10033687 | 3300009148 | Bacteria | 3962 |
| 194 | Ga0105241_10001067 | 3300009174 | Bacteria | 20901 |
| 195 | Ga0105242_10058866 | 3300009176 | Bacteria | 3151 |
| 196 | Ga0105248_10000764 | 3300009177 | Bacteria | 36109 |
| 197 | Ga0105248_10001586 | 3300009177 | Bacteria | 25332 |
| 198 | Ga0105248_10014710 | 3300009177 | Bacteria | 8613 |
| 199 | Ga0105248_10023141 | 3300009177 | Bacteria | 6901 |
| 200 | Ga0105248_10038975 | 3300009177 | Bacteria | 5320 |
| 201 | Ga0105248_10055497 | 3300009177 | Bacteria | 4443 |
| 202 | Ga0105237_10003027 | 3300009545 | Bacteria | 20272 |
| 203 | Ga0105237_10004174 | 3300009545 | Bacteria | 16820 |
| 204 | Ga0105238_10021536 | 3300009551 | Bacteria | 6566 |
| 205 | Ga0105249_10052837 | 3300009553 | Bacteria | 3712 |
| 206 | Ga0105239_10000156 | 3300010375 | Bacteria | 98400 |
| 207 | Ga0105239_10058205 | 3300010375 | Bacteria | 4241 |
| 208 | Ga0157373_10008085 | 3300013100 | Bacteria | 7818 |
| 209 | Ga0157373_10012888 | 3300013100 | Bacteria | 6139 |
| 210 | Ga0157373_10019689 | 3300013100 | Bacteria | 4909 |
| 211 | Ga0157373_10026144 | 3300013100 | Bacteria | 4219 |
| 212 | Ga0157371_10003832 | 3300013102 | Bacteria | 13423 |
| 213 | Ga0157371_10013683 | 3300013102 | Bacteria | 6156 |
| 214 | Ga0157371_10024820 | 3300013102 | Bacteria | 4375 |
| 215 | Ga0157370_10000020 | 3300013104 | Bacteria | 166524 |
| 216 | Ga0157370_10007681 | 3300013104 | Bacteria | 11703 |
| 217 | Ga0157370_10018175 | 3300013104 | Bacteria | 7076 |
| 218 | Ga0157370_10040877 | 3300013104 | Bacteria | 4476 |
| 219 | Ga0157369_10004778 | 3300013105 | Bacteria | 15925 |
| 220 | Ga0157369_10042165 | 3300013105 | Bacteria | 4979 |
| 221 | Ga0157374_10024065 | 3300013296 | Bacteria | 5455 |
| 222 | Ga0157374_10032783 | 3300013296 | Bacteria | 4734 |
| 223 | Ga0157374_10039077 | 3300013296 | Bacteria | 4365 |
| 224 | Ga0163162_10007146 | 3300013306 | Bacteria | 10838 |
| 225 | Ga0163162_10010617 | 3300013306 | Bacteria | 8955 |
| 226 | Ga0163162_10016336 | 3300013306 | Bacteria | 7255 |
| 227 | Ga0163162_10043875 | 3300013306 | Bacteria | 4477 |
| 228 | Ga0163162_10097821 | 3300013306 | Bacteria | 3023 |
| 229 | Ga0157372_10035366 | 3300013307 | Bacteria | 5499 |
| 230 | Ga0157375_10074288 | 3300013308 | Bacteria | 3421 |
| 231 | Ga0157375_10074822 | 3300013308 | Bacteria | 3409 |
| 232 | Ga0163163_10043269 | 3300014325 | Bacteria | 4414 |
| 233 | Ga0157380_10000410 | 3300014326 | Bacteria | 26058 |
| 234 | Ga0157379_10024736 | 3300014968 | Bacteria | 5330 |
| 235 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 236 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 237 | Ga0209148_1000171 | 3300025254 | Bacteria | 131700 |
| 238 | Ga0209148_1000934 | 3300025254 | Bacteria | 19245 |
| 239 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 240 | Ga0209455_1000969 | 3300025272 | Bacteria | 14556 |
| 241 | Ga0209676_1000171 | 3300025292 | Bacteria | 154045 |
| 242 | Ga0209676_1000177 | 3300025292 | Bacteria | 151589 |
| 243 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 244 | Ga0209050_1000837 | 3300025298 | Bacteria | 42462 |
| 245 | Ga0209050_1001766 | 3300025298 | Bacteria | 21350 |
| 246 | Ga0209051_1001860 | 3300025303 | Bacteria | 16592 |
| 247 | Ga0209257_1000253 | 3300025304 | Bacteria | 123508 |
| 248 | Ga0209257_1015520 | 3300025304 | Bacteria | 3162 |
| 249 | Ga0207697_10000376 | 3300025315 | Bacteria | 24993 |
| 250 | Ga0207656_10000677 | 3300025321 | Bacteria | 11171 |
| 251 | Ga0207682_10000533 | 3300025893 | Bacteria | 17501 |
| 252 | Ga0207682_10007714 | 3300025893 | Bacteria | 4279 |
| 253 | Ga0207688_10016533 | 3300025901 | Bacteria | 4002 |
| 254 | Ga0207680_10007208 | 3300025903 | Bacteria | 5406 |
| 255 | Ga0207647_10000327 | 3300025904 | Bacteria | 38973 |
| 256 | Ga0207647_10001105 | 3300025904 | Bacteria | 20793 |
| 257 | Ga0207647_10032113 | 3300025904 | Bacteria | 3376 |
| 258 | Ga0207647_10035732 | 3300025904 | Bacteria | 3164 |
| 259 | Ga0207645_10003851 | 3300025907 | Bacteria | 11228 |
| 260 | Ga0207645_10009540 | 3300025907 | Bacteria | 6706 |
| 261 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 262 | Ga0207705_10000061 | 3300025909 | Bacteria | 150179 |
| 263 | Ga0207705_10000253 | 3300025909 | Bacteria | 52359 |
| 264 | Ga0207705_10001217 | 3300025909 | Bacteria | 20815 |
| 265 | Ga0207705_10001405 | 3300025909 | Bacteria | 19182 |
| 266 | Ga0207705_10007615 | 3300025909 | Bacteria | 7962 |
| 267 | Ga0207705_10009812 | 3300025909 | Bacteria | 6969 |
| 268 | Ga0207705_10013123 | 3300025909 | Bacteria | 5980 |
| 269 | Ga0207705_10018592 | 3300025909 | Bacteria | 4967 |
| 270 | Ga0207705_10026911 | 3300025909 | Bacteria | 4099 |
| 271 | Ga0207705_10036747 | 3300025909 | Bacteria | 3504 |
| 272 | Ga0207705_10037233 | 3300025909 | Bacteria | 3481 |
| 273 | Ga0207705_10044181 | 3300025909 | Bacteria | 3202 |
| 274 | Ga0207654_10000449 | 3300025911 | Bacteria | 23541 |
| 275 | Ga0207707_10022928 | 3300025912 | Bacteria | 5460 |
| 276 | Ga0207695_10000521 | 3300025913 | Bacteria | 81496 |
| 277 | Ga0207695_10028754 | 3300025913 | Bacteria | 6155 |
| 278 | Ga0207695_10047602 | 3300025913 | Bacteria | 4536 |
| 279 | Ga0207671_10000607 | 3300025914 | Bacteria | 47542 |
| 280 | Ga0207671_10008025 | 3300025914 | Bacteria | 9032 |
| 281 | Ga0207671_10022956 | 3300025914 | Bacteria | 4711 |
| 282 | Ga0207693_10009547 | 3300025915 | Bacteria | 7900 |
| 283 | Ga0207660_10000492 | 3300025917 | Bacteria | 26361 |
| 284 | Ga0207660_10017087 | 3300025917 | Bacteria | 4814 |
| 285 | Ga0207657_10002527 | 3300025919 | Bacteria | 19795 |
| 286 | Ga0207657_10002626 | 3300025919 | Bacteria | 19417 |
| 287 | Ga0207657_10004025 | 3300025919 | Bacteria | 15608 |
| 288 | Ga0207657_10004207 | 3300025919 | Bacteria | 15239 |
| 289 | Ga0207657_10004892 | 3300025919 | Bacteria | 14088 |
| 290 | Ga0207657_10007475 | 3300025919 | Bacteria | 11195 |
| 291 | Ga0207657_10010998 | 3300025919 | Bacteria | 8995 |
| 292 | Ga0207657_10011611 | 3300025919 | Bacteria | 8735 |
| 293 | Ga0207657_10017525 | 3300025919 | Bacteria | 6863 |
| 294 | Ga0207657_10022997 | 3300025919 | Bacteria | 5815 |
| 295 | Ga0207649_10000850 | 3300025920 | Bacteria | 19631 |
| 296 | Ga0207649_10016349 | 3300025920 | Bacteria | 4181 |
| 297 | Ga0207649_10019224 | 3300025920 | Bacteria | 3901 |
| 298 | Ga0207649_10027995 | 3300025920 | Bacteria | 3314 |
| 299 | Ga0207649_10030433 | 3300025920 | Bacteria | 3197 |
| 300 | Ga0207652_10016169 | 3300025921 | Bacteria | 6086 |
| 301 | Ga0207681_10000926 | 3300025923 | Bacteria | 19145 |
| 302 | Ga0207681_10006440 | 3300025923 | Bacteria | 7207 |
| 303 | Ga0207681_10010450 | 3300025923 | Bacteria | 5680 |
| 304 | Ga0207681_10011670 | 3300025923 | Bacteria | 5402 |
| 305 | Ga0207650_10000200 | 3300025925 | Bacteria | 69213 |
| 306 | Ga0207650_10002730 | 3300025925 | Bacteria | 12190 |
| 307 | Ga0207650_10003374 | 3300025925 | Bacteria | 10996 |
| 308 | Ga0207650_10004763 | 3300025925 | Bacteria | 9268 |
| 309 | Ga0207650_10022295 | 3300025925 | Bacteria | 4481 |
| 310 | Ga0207659_10006793 | 3300025926 | Bacteria | 7034 |
| 311 | Ga0207659_10007734 | 3300025926 | Bacteria | 6634 |
| 312 | Ga0207687_10018339 | 3300025927 | Bacteria | 4617 |
| 313 | Ga0207644_10001728 | 3300025931 | Bacteria | 14123 |
| 314 | Ga0207644_10005709 | 3300025931 | Bacteria | 8100 |
| 315 | Ga0207644_10006667 | 3300025931 | Bacteria | 7524 |
| 316 | Ga0207644_10014208 | 3300025931 | Bacteria | 5324 |
| 317 | Ga0207644_10018036 | 3300025931 | Bacteria | 4771 |
| 318 | Ga0207644_10033594 | 3300025931 | Bacteria | 3586 |
| 319 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 320 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 321 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 322 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 323 | Ga0207690_10002956 | 3300025932 | Bacteria | 10241 |
| 324 | Ga0207690_10008543 | 3300025932 | Bacteria | 6077 |
| 325 | Ga0207690_10013353 | 3300025932 | Bacteria | 4935 |
| 326 | Ga0207690_10013525 | 3300025932 | Bacteria | 4904 |
| 327 | Ga0207690_10014590 | 3300025932 | Bacteria | 4746 |
| 328 | Ga0207690_10015670 | 3300025932 | Bacteria | 4599 |
| 329 | Ga0207706_10000480 | 3300025933 | Bacteria | 42754 |
| 330 | Ga0207706_10001168 | 3300025933 | Bacteria | 26635 |
| 331 | Ga0207706_10003464 | 3300025933 | Bacteria | 15067 |
| 332 | Ga0207706_10005186 | 3300025933 | Bacteria | 12161 |
| 333 | Ga0207706_10005358 | 3300025933 | Bacteria | 11954 |
| 334 | Ga0207706_10006622 | 3300025933 | Bacteria | 10722 |
| 335 | Ga0207706_10013967 | 3300025933 | Bacteria | 7282 |
| 336 | Ga0207706_10017933 | 3300025933 | Bacteria | 6372 |
| 337 | Ga0207706_10018415 | 3300025933 | Bacteria | 6284 |
| 338 | Ga0207706_10062616 | 3300025933 | Bacteria | 3276 |
| 339 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 340 | Ga0207669_10011389 | 3300025937 | Bacteria | 4325 |
| 341 | Ga0207665_10013292 | 3300025939 | Bacteria | 5411 |
| 342 | Ga0207691_10002585 | 3300025940 | Bacteria | 17684 |
| 343 | Ga0207691_10007026 | 3300025940 | Bacteria | 10861 |
| 344 | Ga0207691_10013911 | 3300025940 | Bacteria | 7677 |
| 345 | Ga0207691_10014963 | 3300025940 | Bacteria | 7389 |
| 346 | Ga0207711_10004111 | 3300025941 | Bacteria | 12473 |
| 347 | Ga0207711_10006891 | 3300025941 | Bacteria | 9542 |
| 348 | Ga0207711_10008462 | 3300025941 | Bacteria | 8607 |
| 349 | Ga0207689_10005302 | 3300025942 | Bacteria | 11550 |
| 350 | Ga0207689_10029198 | 3300025942 | Bacteria | 4608 |
| 351 | Ga0207661_10006376 | 3300025944 | Bacteria | 8343 |
| 352 | Ga0207679_10009643 | 3300025945 | Bacteria | 6189 |
| 353 | Ga0207679_10019691 | 3300025945 | Bacteria | 4540 |
| 354 | Ga0207679_10020156 | 3300025945 | Bacteria | 4496 |
| 355 | Ga0207679_10030427 | 3300025945 | Bacteria | 3769 |
| 356 | Ga0207679_10039835 | 3300025945 | Bacteria | 3359 |
| 357 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 358 | Ga0207667_10000282 | 3300025949 | Bacteria | 69790 |
| 359 | Ga0207651_10024115 | 3300025960 | Bacteria | 3756 |
| 360 | Ga0207712_10002694 | 3300025961 | Bacteria | 11336 |
| 361 | Ga0207712_10053822 | 3300025961 | Bacteria | 2825 |
| 362 | Ga0207668_10007021 | 3300025972 | Bacteria | 6679 |
| 363 | Ga0207668_10012097 | 3300025972 | Bacteria | 5271 |
| 364 | Ga0207640_10000332 | 3300025981 | Bacteria | 31426 |
| 365 | Ga0207640_10007833 | 3300025981 | Bacteria | 5897 |
| 366 | Ga0207640_10008872 | 3300025981 | Bacteria | 5600 |
| 367 | Ga0207658_10007224 | 3300025986 | Bacteria | 7574 |
| 368 | Ga0207658_10009620 | 3300025986 | Bacteria | 6561 |
| 369 | Ga0207677_10000014 | 3300026023 | Bacteria | 181712 |
| 370 | Ga0207677_10002473 | 3300026023 | Bacteria | 9698 |
| 371 | Ga0207703_10000135 | 3300026035 | Bacteria | 89779 |
| 372 | Ga0207703_10007159 | 3300026035 | Bacteria | 8873 |
| 373 | Ga0207703_10009181 | 3300026035 | Bacteria | 7782 |
| 374 | Ga0207703_10019631 | 3300026035 | Bacteria | 5282 |
| 375 | Ga0207639_10001401 | 3300026041 | Bacteria | 16275 |
| 376 | Ga0207639_10054311 | 3300026041 | Bacteria | 3061 |
| 377 | Ga0207678_10001226 | 3300026067 | Bacteria | 23602 |
| 378 | Ga0207678_10001889 | 3300026067 | Bacteria | 19110 |
| 379 | Ga0207678_10011456 | 3300026067 | Bacteria | 7786 |
| 380 | Ga0207678_10013912 | 3300026067 | Bacteria | 7071 |
| 381 | Ga0207678_10021226 | 3300026067 | Bacteria | 5692 |
| 382 | Ga0207678_10030168 | 3300026067 | Bacteria | 4733 |
| 383 | Ga0207678_10048645 | 3300026067 | Bacteria | 3665 |
| 384 | Ga0207678_10053405 | 3300026067 | Bacteria | 3482 |
| 385 | Ga0207702_10013120 | 3300026078 | Bacteria | 6889 |
| 386 | Ga0207702_10030679 | 3300026078 | Bacteria | 4478 |
| 387 | Ga0207702_10064217 | 3300026078 | Bacteria | 3141 |
| 388 | Ga0207641_10017090 | 3300026088 | Bacteria | 5935 |
| 389 | Ga0207641_10042329 | 3300026088 | Bacteria | 3820 |
| 390 | Ga0207648_10000962 | 3300026089 | Bacteria | 32576 |
| 391 | Ga0207648_10023761 | 3300026089 | Bacteria | 5483 |
| 392 | Ga0207648_10037095 | 3300026089 | Bacteria | 4293 |
| 393 | Ga0207676_10006804 | 3300026095 | Bacteria | 8092 |
| 394 | Ga0207676_10018132 | 3300026095 | Bacteria | 5112 |
| 395 | Ga0207676_10023779 | 3300026095 | Bacteria | 4526 |
| 396 | Ga0207674_10000626 | 3300026116 | Bacteria | 46240 |
| 397 | Ga0207674_10003891 | 3300026116 | Bacteria | 18169 |
| 398 | Ga0207674_10005315 | 3300026116 | Bacteria | 15320 |
| 399 | Ga0207674_10006883 | 3300026116 | Bacteria | 13323 |
| 400 | Ga0207674_10009062 | 3300026116 | Bacteria | 11427 |
| 401 | Ga0207674_10013991 | 3300026116 | Bacteria | 8871 |
| 402 | Ga0207674_10015581 | 3300026116 | Bacteria | 8348 |
| 403 | Ga0207674_10021876 | 3300026116 | Bacteria | 6880 |
| 404 | Ga0207674_10026537 | 3300026116 | Bacteria | 6148 |
| 405 | Ga0207674_10039022 | 3300026116 | Bacteria | 4925 |
| 406 | Ga0207674_10043477 | 3300026116 | Bacteria | 4632 |
| 407 | Ga0207675_100000049 | 3300026118 | Bacteria | 84016 |
| 408 | Ga0207675_100030478 | 3300026118 | Bacteria | 5024 |
| 409 | Ga0207683_10006175 | 3300026121 | Bacteria | 10269 |
| 410 | Ga0207683_10008207 | 3300026121 | Bacteria | 8936 |
| 411 | Ga0207683_10019106 | 3300026121 | Bacteria | 5849 |
| 412 | Ga0207698_10006090 | 3300026142 | Bacteria | 7505 |
| 413 | Ga0207698_10011299 | 3300026142 | Bacteria | 5782 |
| 414 | Ga0207698_10055278 | 3300026142 | Bacteria | 3058 |
| 415 | Ga0268266_10000074 | 3300028379 | Bacteria | 230993 |
| 416 | Ga0268266_10000181 | 3300028379 | Bacteria | 112266 |
| 417 | Ga0268266_10003739 | 3300028379 | Bacteria | 14962 |
| 418 | Ga0268266_10007793 | 3300028379 | Bacteria | 9602 |
| 419 | Ga0268265_10007078 | 3300028380 | Bacteria | 7580 |
| 420 | Ga0268265_10009635 | 3300028380 | Bacteria | 6521 |
| 421 | Ga0268264_10002450 | 3300028381 | Bacteria | 16308 |
| 422 | Ga0268264_10004960 | 3300028381 | Bacteria | 11271 |
| 423 | Ga0307517_10007919 | 3300028786 | Bacteria | 15361 |
| 424 | Ga0307517_10017280 | 3300028786 | Bacteria | 9415 |
| 425 | Ga0316178_1013489 | 3300030735 | Bacteria | 3559 |
| 426 | Ga0316182_1017364 | 3300030745 | Bacteria | 5436 |
| 427 | Ga0307513_10013148 | 3300031456 | Bacteria | 10172 |
| 428 | Ga0307410_10000124 | 3300031852 | Bacteria | 27240 |
| 429 | Ga0307406_10008897 | 3300031901 | Bacteria | 5612 |
| 430 | Ga0307409_100012696 | 3300031995 | Bacteria | 5381 |
| 431 | Ga0307409_100036108 | 3300031995 | Bacteria | 3628 |
| 432 | Ga0307416_100000416 | 3300032002 | Bacteria | 21677 |
| 433 | Ga0307411_10031145 | 3300032005 | Bacteria | 3278 |
| 434 | Ga0307510_10001620 | 3300033180 | Bacteria | 24931 |
| 435 | Ga0307510_10077067 | 3300033180 | Bacteria | 3273 |
| 436 | Ga0395899_0000296 | 3300037312 | Bacteria | 64048 |
| 437 | Ga0395899_0010837 | 3300037312 | Bacteria | 6988 |
| 438 | Ga0395899_0014342 | 3300037312 | Bacteria | 6049 |
| 439 | Ga0395899_0017423 | 3300037312 | Bacteria | 5472 |
| 440 | Ga0395899_0025343 | 3300037312 | Bacteria | 4476 |
| 441 | Ga0395899_0035600 | 3300037312 | Bacteria | 3736 |
| 442 | Ga0395900_0000036 | 3300037418 | Bacteria | 250619 |
| 443 | Ga0395900_0001457 | 3300037418 | Bacteria | 28209 |
| 444 | Ga0395900_0001680 | 3300037418 | Bacteria | 25760 |
| 445 | Ga0395900_0003058 | 3300037418 | Bacteria | 18213 |
| 446 | Ga0395900_0006747 | 3300037418 | Bacteria | 11913 |
| 447 | Ga0395900_0013324 | 3300037418 | Bacteria | 8407 |
| 448 | Ga0395900_0015325 | 3300037418 | Bacteria | 7814 |
| 449 | Ga0395900_0017308 | 3300037418 | Bacteria | 7357 |
| 450 | Ga0395900_0020344 | 3300037418 | Bacteria | 6774 |
| 451 | Ga0395900_0023074 | 3300037418 | Bacteria | 6368 |
| 452 | Ga0395900_0070864 | 3300037418 | Bacteria | 3583 |
| 453 | Ga0395900_0078605 | 3300037418 | Bacteria | 3389 |
| 454 | Ga0395900_0083661 | 3300037418 | Bacteria | 3278 |
| 455 | Ga0395898_0003602 | 3300037466 | Bacteria | 17250 |
| 456 | Ga0395898_0013043 | 3300037466 | Bacteria | 8562 |
| 457 | Ga0395898_0024672 | 3300037466 | Bacteria | 6065 |
| 458 | Ga0395898_0032484 | 3300037466 | Bacteria | 5210 |
| 459 | Ga0395898_0067806 | 3300037466 | Bacteria | 3453 |
| 460 | Ga0395905_0000174 | 3300037471 | Bacteria | 104301 |
| 461 | Ga0395905_0004190 | 3300037471 | Bacteria | 15083 |
| 462 | Ga0395905_0013867 | 3300037471 | Bacteria | 7711 |
| 463 | Ga0395905_0014446 | 3300037471 | Bacteria | 7538 |
| 464 | Ga0395905_0016536 | 3300037471 | Bacteria | 7013 |
| 465 | Ga0395905_0023020 | 3300037471 | Bacteria | 5888 |
| 466 | Ga0395905_0026811 | 3300037471 | Bacteria | 5434 |
| 467 | Ga0395905_0034164 | 3300037471 | Bacteria | 4774 |
| 468 | Ga0395905_0042326 | 3300037471 | Bacteria | 4274 |
| 469 | Ga0395905_0073038 | 3300037471 | Bacteria | 3215 |
| 470 | Ga0395901_0000036 | 3300038443 | Bacteria | 214274 |
| 471 | Ga0395901_0011389 | 3300038443 | Bacteria | 9011 |
| 472 | Ga0395901_0015419 | 3300038443 | Bacteria | 7782 |
| 473 | Ga0395901_0017800 | 3300038443 | Bacteria | 7251 |
| 474 | Ga0395901_0023381 | 3300038443 | Bacteria | 6334 |
| 475 | Ga0395901_0036459 | 3300038443 | Bacteria | 5083 |
| 476 | Ga0395901_0037183 | 3300038443 | Bacteria | 5035 |
| 477 | Ga0395901_0041261 | 3300038443 | Bacteria | 4781 |
| 478 | Ga0395901_0044983 | 3300038443 | Bacteria | 4580 |
| 479 | Ga0395901_0045828 | 3300038443 | Bacteria | 4540 |
| 480 | Ga0395901_0049327 | 3300038443 | Bacteria | 4373 |
| 481 | Ga0395901_0051701 | 3300038443 | Bacteria | 4273 |
| 482 | Ga0395901_0072230 | 3300038443 | Bacteria | 3597 |
| 483 | Ga0450889_000265 | 3300042144 | Bacteria | 5810 |
| 484 | Ga0466969_0010403 | 3300044656 | Bacteria | 4932 |
| 485 | Ga0466972_0011839 | 3300044658 | Bacteria | 4382 |
| 486 | Ga0466966_0000004 | 3300044684 | Bacteria | 223594 |
| 487 | Ga0466966_0024043 | 3300044684 | Bacteria | 3988 |
| 488 | Ga0466966_0028206 | 3300044684 | Bacteria | 3658 |
| 489 | Ga0466961_0013967 | 3300044693 | Bacteria | 5146 |
| 490 | Ga0466963_0005314 | 3300044694 | Bacteria | 7529 |
| 491 | Ga0466963_0012142 | 3300044694 | Bacteria | 5265 |
| 492 | Ga0466963_0023913 | 3300044694 | Bacteria | 3885 |
| 493 | Ga0466971_0000663 | 3300044719 | Bacteria | 13700 |
| 494 | Ga0466971_0015569 | 3300044719 | Bacteria | 3350 |
| 495 | Ga0466970_0002855 | 3300044765 | Bacteria | 8350 |
| 496 | Ga0466970_0005164 | 3300044765 | Bacteria | 6456 |
| 497 | Ga0466970_0024124 | 3300044765 | Bacteria | 3180 |
| 498 | Ga0466957_0008191 | 3300044842 | Bacteria | 5934 |
| 499 | Ga0466960_0021657 | 3300044901 | Bacteria | 2865 |
| 500 | Ga0466960_0028676 | 3300044901 | Bacteria | 2549 |
| 501 | Ga0466959_0000278 | 3300045049 | Bacteria | 31260 |
| 502 | Ga0466959_0004576 | 3300045049 | Bacteria | 9286 |
| 503 | Ga0466958_0005038 | 3300045836 | Bacteria | 7054 |
| 504 | Ga0466958_0015606 | 3300045836 | Bacteria | 4356 |
| 505 | Ga0466958_0045699 | 3300045836 | Bacteria | 2642 |
| 506 | Ga0466967_0012300 | 3300045976 | Bacteria | 6538 |
| 507 | Ga0466967_0019810 | 3300045976 | Bacteria | 5420 |
| 508 | Ga0466967_0025870 | 3300045976 | Bacteria | 4847 |
| 509 | Ga0495650_0000091 | 3300046471 | Bacteria | 228697 |
| 510 | Ga0495585_0017098 | 3300046492 | Bacteria | 4197 |
| 511 | Ga0495583_0000693 | 3300046506 | Bacteria | 43601 |
| 512 | Ga0495583_0006888 | 3300046506 | Bacteria | 7312 |
| 513 | Ga0495583_0015304 | 3300046506 | Bacteria | 4177 |
| 514 | Ga0495606_0000390 | 3300046507 | Bacteria | 74253 |
| 515 | Ga0495606_0000470 | 3300046507 | Bacteria | 66278 |
| 516 | Ga0495637_0009175 | 3300046520 | Bacteria | 4829 |
| 517 | Ga0495643_0000826 | 3300046522 | Bacteria | 33765 |
| 518 | Ga0495643_0002531 | 3300046522 | Bacteria | 14336 |
| 519 | Ga0495648_0000065 | 3300046524 | Bacteria | 145024 |
| 520 | Ga0495642_0004390 | 3300046528 | Bacteria | 5475 |
| 521 | Ga0495621_0000536 | 3300046539 | Bacteria | 9408 |
| 522 | Ga0495621_0001226 | 3300046539 | Bacteria | 6613 |
| 523 | Ga0495633_0002445 | 3300046558 | Bacteria | 13114 |
| 524 | Ga0495633_0003893 | 3300046558 | Bacteria | 9738 |
| 525 | Ga0495668_0000022 | 3300046616 | Bacteria | 363999 |
| 526 | Ga0495668_0000026 | 3300046616 | Bacteria | 297287 |
| 527 | Ga0495668_0033713 | 3300046616 | Bacteria | 2875 |
| 528 | Ga0495625_0000469 | 3300046660 | Bacteria | 60635 |
| 529 | Ga0495625_0005314 | 3300046660 | Bacteria | 11796 |
| 530 | Ga0495625_0013215 | 3300046660 | Bacteria | 6648 |
| 531 | Ga0495669_0000046 | 3300046684 | Bacteria | 83405 |
| 532 | Ga0495669_0000049 | 3300046684 | Bacteria | 80766 |
| 533 | Ga0495669_0000899 | 3300046684 | Bacteria | 12508 |
| 534 | Ga0495670_0000003 | 3300046691 | Bacteria | 326779 |
| 535 | Ga0495670_0007872 | 3300046691 | Bacteria | 5242 |
| 536 | Ga0495670_0013616 | 3300046691 | Bacteria | 3999 |
| 537 | Ga0495687_000043 | 3300047443 | Bacteria | 216711 |
| 538 | Ga0495687_000293 | 3300047443 | Bacteria | 65650 |
| 539 | Ga0495677_0001485 | 3300047445 | Bacteria | 9420 |
| 540 | Ga0495681_0010700 | 3300047470 | Bacteria | 5532 |
| 541 | Ga0495686_0000849 | 3300047472 | Bacteria | 39236 |
| 542 | Ga0496102_0000170 | 3300048905 | Bacteria | 88149 |
| 543 | Ga0496102_0000384 | 3300048905 | Bacteria | 52159 |
| 544 | Ga0496102_0000719 | 3300048905 | Bacteria | 32658 |
| 545 | Ga0496103_0000081 | 3300048906 | Bacteria | 109734 |
| 546 | Ga0496103_0000122 | 3300048906 | Bacteria | 84230 |
| 547 | Ga0496103_0000562 | 3300048906 | Bacteria | 29450 |
| 548 | Ga0496104_0003131 | 3300048907 | Bacteria | 14267 |
| 549 | Ga0496104_0003648 | 3300048907 | Bacteria | 13295 |
| 550 | Ga0496105_0000034 | 3300048908 | Bacteria | 127505 |
| 551 | Ga0496105_0000267 | 3300048908 | Bacteria | 34619 |
| 552 | Ga0496107_0008365 | 3300048910 | Bacteria | 7158 |
| 553 | Ga0496108_0021847 | 3300048911 | Bacteria | 5260 |
| 554 | Ga0496108_0061392 | 3300048911 | Bacteria | 3163 |
| 555 | Ga0496109_0008646 | 3300048912 | Bacteria | 8666 |
| 556 | Ga0496110_0003888 | 3300048913 | Bacteria | 11494 |
| 557 | Ga0496110_0025639 | 3300048913 | Bacteria | 5041 |
| 558 | Ga0496110_0028913 | 3300048913 | Bacteria | 4764 |
| 559 | Ga0496112_0007890 | 3300048915 | Bacteria | 9484 |
| 560 | Ga0496112_0008943 | 3300048915 | Bacteria | 8993 |
| 561 | Ga0496113_0001238 | 3300048916 | Bacteria | 14053 |
| 562 | Ga0496113_0003801 | 3300048916 | Bacteria | 9132 |
| 563 | Ga0496113_0026568 | 3300048916 | Bacteria | 4140 |
| 564 | Ga0496114_0000019 | 3300048917 | Bacteria | 244365 |
| 565 | Ga0496114_0005688 | 3300048917 | Bacteria | 9776 |
| 566 | Ga0496114_0052210 | 3300048917 | Bacteria | 3406 |
| 567 | Ga0496115_0000122 | 3300048918 | Bacteria | 70943 |
| 568 | Ga0496115_0000301 | 3300048918 | Bacteria | 42011 |
| 569 | Ga0496116_0002037 | 3300048919 | Bacteria | 21676 |
| 570 | Ga0496116_0004379 | 3300048919 | Bacteria | 13500 |
| 571 | Ga0496117_0000300 | 3300048920 | Bacteria | 87165 |
| 572 | Ga0496117_0000519 | 3300048920 | Bacteria | 63633 |
| 573 | Ga0496118_0000193 | 3300048921 | Bacteria | 107307 |
| 574 | Ga0496118_0000547 | 3300048921 | Bacteria | 61892 |
| 575 | Ga0496118_0006768 | 3300048921 | Bacteria | 12465 |
| 576 | Ga0496119_0000057 | 3300048922 | Bacteria | 173746 |
| 577 | Ga0496119_0005819 | 3300048922 | Bacteria | 11655 |
| 578 | Ga0496119_0012164 | 3300048922 | Bacteria | 7022 |
| 579 | Ga0496120_0003771 | 3300048923 | Bacteria | 13389 |
| 580 | Ga0496121_0002643 | 3300048924 | Bacteria | 26946 |
| 581 | Ga0496121_0003147 | 3300048924 | Bacteria | 23806 |
| 582 | Ga0496121_0004773 | 3300048924 | Bacteria | 17877 |
| 583 | Ga0496121_0010620 | 3300048924 | Bacteria | 10343 |
| 584 | Ga0496121_0011844 | 3300048924 | Bacteria | 9604 |
| 585 | Ga0496123_0002890 | 3300048926 | Bacteria | 20116 |
| 586 | Ga0496123_0006359 | 3300048926 | Bacteria | 11467 |
| 587 | Ga0496123_0006411 | 3300048926 | Bacteria | 11407 |
| 588 | Ga0496124_0000237 | 3300048927 | Bacteria | 107270 |
| 589 | Ga0496124_0000337 | 3300048927 | Bacteria | 86241 |
| 590 | Ga0496124_0000773 | 3300048927 | Bacteria | 52178 |
| 591 | Ga0496124_0011267 | 3300048927 | Bacteria | 8953 |
| 592 | Ga0496124_0017962 | 3300048927 | Bacteria | 6646 |
| 593 | Ga0496125_0003862 | 3300048928 | Bacteria | 17760 |
| 594 | Ga0496125_0009034 | 3300048928 | Bacteria | 10321 |
| 595 | Ga0496125_0014735 | 3300048928 | Bacteria | 7595 |
| 596 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 597 | Ga0496126_0000416 | 3300048929 | Bacteria | 86243 |
| 598 | Ga0496126_0003884 | 3300048929 | Bacteria | 18400 |
| 599 | Ga0496126_0005624 | 3300048929 | Bacteria | 14252 |
| 600 | Ga0501033_0020626 | 3300049570 | Bacteria | 4979 |
| 601 | Ga0501034_0046882 | 3300049571 | Bacteria | 4366 |
| 602 | Ga0501038_0013129 | 3300049574 | Bacteria | 7554 |
| 603 | Ga0501047_0001134 | 3300049581 | Bacteria | 26429 |
| 604 | Ga0501035_0002868 | 3300049822 | Bacteria | 16644 |
| 605 | Ga0501035_0023954 | 3300049822 | Bacteria | 5602 |
| 606 | Ga0501044_0086090 | 3300049823 | Bacteria | 3175 |
| 607 | nmdc:mga06r32_6024_c2 | 3300050510 | Bacteria | 5205 |
| 608 | nmdc:mga08y16_72105_c1 | 3300050511 | Bacteria | 3599 |
| 609 | nmdc:mga0sz30_3520_c1 | 3300050516 | Bacteria | 5646 |
| 610 | Ga0500610_0002791 | 3300053079 | Bacteria | 6541 |
| 611 | Ga0500643_005708 | 3300053087 | Bacteria | 5307 |
| 612 | Ga0500651_0004779 | 3300053093 | Bacteria | 7638 |
| 613 | Ga0500607_000011 | 3300053121 | Bacteria | 110773 |
| 614 | Ga0500608_000169 | 3300053122 | Bacteria | 26904 |
| 615 | Ga0500642_0000939 | 3300053130 | Bacteria | 8440 |
| 616 | Ga0500642_0002192 | 3300053130 | Bacteria | 5680 |
| 617 | Ga0500655_000050 | 3300053133 | Bacteria | 32469 |
| 618 | Ga0500590_000291 | 3300053148 | Bacteria | 15918 |
| 619 | Ga0500616_0000018 | 3300053153 | Bacteria | 610976 |
| 620 | Ga0500622_0010857 | 3300053156 | Bacteria | 4976 |
| 621 | Ga0500624_000032 | 3300053157 | Bacteria | 104403 |
| 622 | Ga0500636_0002492 | 3300053177 | Bacteria | 10226 |
| 623 | Ga0500637_0000019 | 3300053178 | Bacteria | 65170 |
| 624 | Ga0500570_008122 | 3300053724 | Bacteria | 5783 |
| 625 | Ga0500645_000145 | 3300053730 | Bacteria | 55153 |
| 626 | Ga0500645_004233 | 3300053730 | Bacteria | 5575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0045699 | Ga0466958_0045699_308_2617 | 711 |
| 2 | 3300053093 | Ga0500651_0004779 | Ga0500651_0004779_5469_7619 | 712 |
| 3 | 3300047445 | Ga0495677_0001485 | Ga0495677_0001485_7104_9404 | 737 |
| 4 | 3300053153 | Ga0500616_0000018 | Ga0500616_0000018_321828_324233 | 743 |
| 5 | 3300053157 | Ga0500624_000032 | Ga0500624_000032_49562_51958 | 743 |
| 6 | 3300053178 | Ga0500637_0000019 | Ga0500637_0000019_10327_12723 | 743 |
| 7 | 3300048911 | Ga0496108_0061392 | Ga0496108_0061392_776_3088 | 744 |
| 8 | 3300046616 | Ga0495668_0000026 | Ga0495668_0000026_89603_91909 | 745 |
| 9 | 3300030735 | Ga0316178_1013489 | Ga0316178_10134892 | 750 |
| 10 | 3300030745 | Ga0316182_1017364 | Ga0316182_10173642 | 750 |
| 11 | 3300013104 | Ga0157370_10000020 | Ga0157370_1000002093 | 754 |
| 12 | 3300006186 | Ga0075369_10001000 | Ga0075369_100010007 | 757 |
| 13 | 3300048927 | Ga0496124_0017962 | Ga0496124_0017962_2345_4729 | 757 |
| 14 | 3300050516 | nmdc:mga0sz30_3520_c1 | nmdc:mga0sz30_3520_c1_1668_4052 | 757 |
| 15 | iso_pu_bacteria | 2857504554 | 2857505418 | 757 |
| 16 | iso_pu_bacteria | 2585428106 | 2587918381 | 758 |
| 17 | iso_pu_bacteria | 2643221640 | 2644227729 | 758 |
| 18 | iso_pu_bacteria | 2643221642 | 2644234010 | 758 |
| 19 | iso_pu_bacteria | 2884960567 | 2884962319 | 758 |
| 20 | iso_pu_bacteria | 2928531327 | 2928533123 | 758 |
| 21 | 3300003781 | Ga0055536_1004780 | Ga0055536_10047804 | 759 |
| 22 | 3300003791 | Ga0055530_10004796 | Ga0055530_100047964 | 759 |
| 23 | 3300003794 | Ga0055531_10004028 | Ga0055531_100040282 | 759 |
| 24 | 3300025292 | Ga0209676_1000177 | Ga0209676_100017738 | 759 |
| 25 | 3300025298 | Ga0209050_1000837 | Ga0209050_100083738 | 759 |
| 26 | 3300025304 | Ga0209257_1000253 | Ga0209257_100025349 | 759 |
| 27 | 3300048917 | Ga0496114_0000019 | Ga0496114_0000019_85648_88203 | 759 |
| 28 | 3300053122 | Ga0500608_000169 | Ga0500608_000169_22286_24670 | 759 |
| 29 | 3300003781 | Ga0055536_1004876 | Ga0055536_10048764 | 760 |
| 30 | 3300003791 | Ga0055530_10004858 | Ga0055530_100048584 | 760 |
| 31 | 3300025292 | Ga0209676_1000171 | Ga0209676_100017184 | 760 |
| 32 | 3300025298 | Ga0209050_1001766 | Ga0209050_10017667 | 760 |
| 33 | 3300025303 | Ga0209051_1001860 | Ga0209051_10018606 | 760 |
| 34 | 3300025304 | Ga0209257_1015520 | Ga0209257_10155202 | 760 |
| 35 | 3300048928 | Ga0496125_0014735 | Ga0496125_0014735_5203_7566 | 760 |
| 36 | 3300048929 | Ga0496126_0003884 | Ga0496126_0003884_4242_6605 | 760 |
| 37 | 3300049581 | Ga0501047_0001134 | Ga0501047_0001134_4273_6687 | 760 |
| 38 | 3300049823 | Ga0501044_0086090 | Ga0501044_0086090_413_2827 | 760 |
| 39 | 3300048905 | Ga0496102_0000719 | Ga0496102_0000719_20006_22528 | 761 |
| 40 | 3300048906 | Ga0496103_0000562 | Ga0496103_0000562_16701_19223 | 761 |
| 41 | 3300048919 | Ga0496116_0002037 | Ga0496116_0002037_9529_12051 | 761 |
| 42 | 3300048920 | Ga0496117_0000519 | Ga0496117_0000519_19972_22494 | 761 |
| 43 | 3300048921 | Ga0496118_0000193 | Ga0496118_0000193_19928_22450 | 761 |
| 44 | 3300048922 | Ga0496119_0012164 | Ga0496119_0012164_3561_6083 | 761 |
| 45 | 3300048927 | Ga0496124_0000237 | Ga0496124_0000237_84858_87380 | 761 |
| 46 | 3300006847 | Ga0075431_100013164 | Ga0075431_1000131647 | 763 |
| 47 | 3300050510 | nmdc:mga06r32_6024_c2 | nmdc:mga06r32_6024_c2_2434_4929 | 763 |
| 48 | 3300025907 | Ga0207645_10003851 | Ga0207645_100038512 | 764 |
| 49 | iso_pu_bacteria | 2643221541 | 2643727661 | 764 |
| 50 | 3300005293 | Ga0065715_10091114 | Ga0065715_100911143 | 765 |
| 51 | 3300005331 | Ga0070670_100000968 | Ga0070670_10000096811 | 765 |
| 52 | 3300005333 | Ga0070677_10003937 | Ga0070677_100039373 | 765 |
| 53 | 3300005347 | Ga0070668_100018211 | Ga0070668_1000182112 | 765 |
| 54 | 3300005353 | Ga0070669_100005377 | Ga0070669_1000053773 | 765 |
| 55 | 3300005354 | Ga0070675_100000229 | Ga0070675_10000022912 | 765 |
| 56 | 3300005356 | Ga0070674_100003998 | Ga0070674_1000039988 | 765 |
| 57 | 3300005364 | Ga0070673_100005349 | Ga0070673_1000053497 | 765 |
| 58 | 3300005367 | Ga0070667_100025654 | Ga0070667_1000256543 | 765 |
| 59 | 3300005455 | Ga0070663_100017178 | Ga0070663_1000171782 | 765 |
| 60 | 3300005457 | Ga0070662_100001340 | Ga0070662_10000134013 | 765 |
| 61 | 3300005543 | Ga0070672_100001475 | Ga0070672_10000147512 | 765 |
| 62 | 3300005617 | Ga0068859_100014575 | Ga0068859_1000145752 | 765 |
| 63 | 3300005719 | Ga0068861_100005114 | Ga0068861_1000051143 | 765 |
| 64 | 3300005844 | Ga0068862_100001874 | Ga0068862_1000018744 | 765 |
| 65 | 3300006931 | Ga0097620_100014574 | Ga0097620_1000145742 | 765 |
| 66 | 3300009553 | Ga0105249_10052837 | Ga0105249_100528372 | 765 |
| 67 | 3300013306 | Ga0163162_10097821 | Ga0163162_100978212 | 765 |
| 68 | 3300014326 | Ga0157380_10000410 | Ga0157380_1000041023 | 765 |
| 69 | 3300025315 | Ga0207697_10000376 | Ga0207697_1000037619 | 765 |
| 70 | 3300025893 | Ga0207682_10007714 | Ga0207682_100077142 | 765 |
| 71 | 3300025923 | Ga0207681_10010450 | Ga0207681_100104503 | 765 |
| 72 | 3300025925 | Ga0207650_10003374 | Ga0207650_1000337410 | 765 |
| 73 | 3300025926 | Ga0207659_10007734 | Ga0207659_100077343 | 765 |
| 74 | 3300025933 | Ga0207706_10003464 | Ga0207706_100034644 | 765 |
| 75 | 3300025937 | Ga0207669_10011389 | Ga0207669_100113892 | 765 |
| 76 | 3300025940 | Ga0207691_10002585 | Ga0207691_100025854 | 765 |
| 77 | 3300025961 | Ga0207712_10053822 | Ga0207712_100538221 | 765 |
| 78 | 3300025972 | Ga0207668_10012097 | Ga0207668_100120973 | 765 |
| 79 | 3300026067 | Ga0207678_10030168 | Ga0207678_100301682 | 765 |
| 80 | 3300026118 | Ga0207675_100030478 | Ga0207675_1000304783 | 765 |
| 81 | 3300028380 | Ga0268265_10007078 | Ga0268265_100070784 | 765 |
| 82 | 3300025945 | Ga0207679_10009643 | Ga0207679_100096434 | 767 |
| 83 | 3300044684 | Ga0466966_0024043 | Ga0466966_0024043_164_2719 | 768 |
| 84 | 3300053730 | Ga0500645_004233 | Ga0500645_004233_1465_3963 | 768 |
| 85 | 3300005548 | Ga0070665_100015800 | Ga0070665_1000158004 | 770 |
| 86 | 3300005367 | Ga0070667_100027117 | Ga0070667_1000271174 | 771 |
| 87 | 3300005617 | Ga0068859_100045593 | Ga0068859_1000455932 | 771 |
| 88 | 3300005844 | Ga0068862_100020346 | Ga0068862_1000203463 | 771 |
| 89 | 3300006931 | Ga0097620_100045592 | Ga0097620_1000455922 | 771 |
| 90 | 3300025986 | Ga0207658_10007224 | Ga0207658_100072244 | 771 |
| 91 | 3300026035 | Ga0207703_10007159 | Ga0207703_100071594 | 771 |
| 92 | 3300028380 | Ga0268265_10009635 | Ga0268265_100096353 | 771 |
| 93 | 3300044901 | Ga0466960_0028676 | Ga0466960_0028676_71_2539 | 771 |
| 94 | 3300009177 | Ga0105248_10000764 | Ga0105248_1000076420 | 772 |
| 95 | 3300046616 | Ga0495668_0033713 | Ga0495668_0033713_80_2671 | 775 |
| 96 | 3300025909 | Ga0207705_10001405 | Ga0207705_1000140510 | 777 |
| 97 | 3300005614 | Ga0068856_100092404 | Ga0068856_1000924042 | 779 |
| 98 | 3300026116 | Ga0207674_10043477 | Ga0207674_100434773 | 779 |
| 99 | 3300028381 | Ga0268264_10004960 | Ga0268264_1000496010 | 780 |
| 100 | 3300005334 | Ga0068869_100002970 | Ga0068869_1000029704 | 781 |
| 101 | 3300005353 | Ga0070669_100041028 | Ga0070669_1000410282 | 781 |
| 102 | 3300005844 | Ga0068862_100040204 | Ga0068862_1000402042 | 781 |
| 103 | 3300009098 | Ga0105245_10016818 | Ga0105245_100168183 | 781 |
| 104 | 3300025942 | Ga0207689_10005302 | Ga0207689_100053026 | 781 |
| 105 | 3300026116 | Ga0207674_10015581 | Ga0207674_100155815 | 781 |
| 106 | 3300037418 | Ga0395900_0078605 | Ga0395900_0078605_505_3078 | 781 |
| 107 | 3300037471 | Ga0395905_0034164 | Ga0395905_0034164_1475_4048 | 781 |
| 108 | 3300038443 | Ga0395901_0072230 | Ga0395901_0072230_384_2957 | 781 |
| 109 | iso_pu_bacteria | 2643221606 | 2644041179 | 781 |
| 110 | iso_pu_bacteria | 2643221671 | 2644394718 | 781 |
| 111 | 3300005339 | Ga0070660_100003320 | Ga0070660_1000033206 | 782 |
| 112 | 3300005345 | Ga0070692_10003449 | Ga0070692_100034494 | 782 |
| 113 | 3300005444 | Ga0070694_100005612 | Ga0070694_1000056125 | 782 |
| 114 | 3300005457 | Ga0070662_100002358 | Ga0070662_1000023582 | 782 |
| 115 | 3300005577 | Ga0068857_100031990 | Ga0068857_1000319902 | 782 |
| 116 | 3300009148 | Ga0105243_10033687 | Ga0105243_100336872 | 782 |
| 117 | 3300013306 | Ga0163162_10043875 | Ga0163162_100438753 | 782 |
| 118 | 3300025254 | Ga0209148_1000934 | Ga0209148_10009345 | 782 |
| 119 | 3300025272 | Ga0209455_1000969 | Ga0209455_10009695 | 782 |
| 120 | 3300025904 | Ga0207647_10000327 | Ga0207647_1000032712 | 782 |
| 121 | 3300025919 | Ga0207657_10004025 | Ga0207657_100040257 | 782 |
| 122 | 3300025933 | Ga0207706_10001168 | Ga0207706_1000116817 | 782 |
| 123 | 3300025961 | Ga0207712_10002694 | Ga0207712_1000269410 | 782 |
| 124 | 3300026116 | Ga0207674_10021876 | Ga0207674_100218763 | 782 |
| 125 | 3300028381 | Ga0268264_10002450 | Ga0268264_100024506 | 782 |
| 126 | 3300048921 | Ga0496118_0006768 | Ga0496118_0006768_5464_7974 | 782 |
| 127 | 3300050511 | nmdc:mga08y16_72105_c1 | nmdc:mga08y16_72105_c1_1036_3537 | 783 |
| 128 | 3300025254 | Ga0209148_1000171 | Ga0209148_100017192 | 784 |
| 129 | 3300048924 | Ga0496121_0003147 | Ga0496121_0003147_12658_15255 | 786 |
| 130 | 3300048928 | Ga0496125_0009034 | Ga0496125_0009034_2481_4991 | 787 |
| 131 | 3300005327 | Ga0070658_10000809 | Ga0070658_1000080910 | 788 |
| 132 | 3300005339 | Ga0070660_100000558 | Ga0070660_10000055823 | 788 |
| 133 | 3300005563 | Ga0068855_100000140 | Ga0068855_10000014020 | 788 |
| 134 | 3300013102 | Ga0157371_10003832 | Ga0157371_100038326 | 788 |
| 135 | 3300025909 | Ga0207705_10000061 | Ga0207705_10000061152 | 788 |
| 136 | 3300025919 | Ga0207657_10007475 | Ga0207657_100074758 | 788 |
| 137 | 3300025949 | Ga0207667_10000282 | Ga0207667_1000028274 | 788 |
| 138 | 3300037471 | Ga0395905_0000174 | Ga0395905_0000174_80972_83509 | 788 |
| 139 | 3300005843 | Ga0068860_100069398 | Ga0068860_1000693982 | 789 |
| 140 | 3300038443 | Ga0395901_0044983 | Ga0395901_0044983_72_2582 | 789 |
| 141 | 3300005331 | Ga0070670_100011660 | Ga0070670_1000116602 | 790 |
| 142 | 3300005338 | Ga0068868_100005974 | Ga0068868_1000059745 | 790 |
| 143 | 3300009098 | Ga0105245_10015390 | Ga0105245_100153903 | 790 |
| 144 | 3300025927 | Ga0207687_10018339 | Ga0207687_100183393 | 790 |
| 145 | 3300026023 | Ga0207677_10002473 | Ga0207677_100024736 | 790 |
| 146 | 3300049822 | Ga0501035_0002868 | Ga0501035_0002868_826_3426 | 790 |
| 147 | 3300005347 | Ga0070668_100001032 | Ga0070668_10000103215 | 791 |
| 148 | 3300005356 | Ga0070674_100004843 | Ga0070674_1000048435 | 791 |
| 149 | 3300005364 | Ga0070673_100046010 | Ga0070673_1000460102 | 791 |
| 150 | 3300005367 | Ga0070667_100005475 | Ga0070667_1000054757 | 791 |
| 151 | 3300005459 | Ga0068867_100002596 | Ga0068867_1000025966 | 791 |
| 152 | 3300010375 | Ga0105239_10058205 | Ga0105239_100582052 | 791 |
| 153 | 3300025909 | Ga0207705_10009812 | Ga0207705_100098123 | 791 |
| 154 | 3300025909 | Ga0207705_10013123 | Ga0207705_100131234 | 791 |
| 155 | 3300025919 | Ga0207657_10002527 | Ga0207657_1000252714 | 791 |
| 156 | 3300025919 | Ga0207657_10022997 | Ga0207657_100229974 | 791 |
| 157 | 3300025923 | Ga0207681_10006440 | Ga0207681_100064406 | 791 |
| 158 | 3300025972 | Ga0207668_10007021 | Ga0207668_100070212 | 791 |
| 159 | 3300025986 | Ga0207658_10009620 | Ga0207658_100096203 | 791 |
| 160 | 3300026089 | Ga0207648_10000962 | Ga0207648_100009622 | 791 |
| 161 | 3300037312 | Ga0395899_0000296 | Ga0395899_0000296_6699_9329 | 791 |
| 162 | 3300037418 | Ga0395900_0000036 | Ga0395900_0000036_197937_200567 | 791 |
| 163 | 3300037466 | Ga0395898_0024672 | Ga0395898_0024672_1663_4293 | 791 |
| 164 | 3300038443 | Ga0395901_0000036 | Ga0395901_0000036_19331_21961 | 791 |
| 165 | 3300005345 | Ga0070692_10002664 | Ga0070692_100026645 | 792 |
| 166 | 3300005616 | Ga0068852_100009838 | Ga0068852_1000098382 | 792 |
| 167 | 3300013104 | Ga0157370_10007681 | Ga0157370_100076819 | 792 |
| 168 | 3300025909 | Ga0207705_10044181 | Ga0207705_100441812 | 792 |
| 169 | 3300005543 | Ga0070672_100008584 | Ga0070672_1000085844 | 794 |
| 170 | 3300005544 | Ga0070686_100000465 | Ga0070686_10000046516 | 794 |
| 171 | 3300005366 | Ga0070659_100044475 | Ga0070659_1000444752 | 795 |
| 172 | 3300005457 | Ga0070662_100012530 | Ga0070662_1000125303 | 795 |
| 173 | 3300025904 | Ga0207647_10035732 | Ga0207647_100357321 | 795 |
| 174 | 3300025933 | Ga0207706_10017933 | Ga0207706_100179333 | 795 |
| 175 | 3300025933 | Ga0207706_10018415 | Ga0207706_100184154 | 795 |
| 176 | 3300026116 | Ga0207674_10006883 | Ga0207674_100068835 | 795 |
| 177 | 3300044684 | Ga0466966_0000004 | Ga0466966_0000004_212249_214948 | 795 |
| 178 | 3300002075 | JGI24738J21930_10001669 | JGI24738J21930_100016693 | 797 |
| 179 | 3300005578 | Ga0068854_100000103 | Ga0068854_10000010339 | 797 |
| 180 | 3300006358 | Ga0068871_100003159 | Ga0068871_1000031593 | 797 |
| 181 | 3300025981 | Ga0207640_10000332 | Ga0207640_100003328 | 797 |
| 182 | 3300026067 | Ga0207678_10001889 | Ga0207678_100018894 | 797 |
| 183 | 3300046507 | Ga0495606_0000470 | Ga0495606_0000470_24744_27296 | 797 |
| 184 | 3300005345 | Ga0070692_10005692 | Ga0070692_100056925 | 798 |
| 185 | 3300005366 | Ga0070659_100027625 | Ga0070659_1000276252 | 798 |
| 186 | 3300005842 | Ga0068858_100025525 | Ga0068858_1000255252 | 798 |
| 187 | 3300013102 | Ga0157371_10024820 | Ga0157371_100248202 | 798 |
| 188 | 3300013105 | Ga0157369_10042165 | Ga0157369_100421652 | 798 |
| 189 | 3300014968 | Ga0157379_10024736 | Ga0157379_100247364 | 798 |
| 190 | 3300025909 | Ga0207705_10037233 | Ga0207705_100372332 | 798 |
| 191 | 3300026078 | Ga0207702_10013120 | Ga0207702_100131203 | 798 |
| 192 | 3300026088 | Ga0207641_10017090 | Ga0207641_100170902 | 798 |
| 193 | 3300026095 | Ga0207676_10018132 | Ga0207676_100181322 | 798 |
| 194 | 3300026116 | Ga0207674_10000626 | Ga0207674_1000062636 | 798 |
| 195 | 3300044719 | Ga0466971_0015569 | Ga0466971_0015569_613_3294 | 798 |
| 196 | 3300048913 | Ga0496110_0025639 | Ga0496110_0025639_1716_4409 | 798 |
| 197 | 3300048916 | Ga0496113_0026568 | Ga0496113_0026568_163_2856 | 798 |
| 198 | 3300048924 | Ga0496121_0011844 | Ga0496121_0011844_2378_4864 | 798 |
| 199 | 3300048926 | Ga0496123_0006411 | Ga0496123_0006411_6809_9295 | 798 |
| 200 | 3300048927 | Ga0496124_0000773 | Ga0496124_0000773_3004_5559 | 798 |
| 201 | 3300001989 | JGI24739J22299_10007032 | JGI24739J22299_100070321 | 799 |
| 202 | 3300002067 | JGI24735J21928_10003862 | JGI24735J21928_100038622 | 799 |
| 203 | 3300002077 | JGI24744J21845_10000306 | JGI24744J21845_100003064 | 799 |
| 204 | 3300005356 | Ga0070674_100029362 | Ga0070674_1000293622 | 799 |
| 205 | 3300005366 | Ga0070659_100003704 | Ga0070659_1000037043 | 799 |
| 206 | 3300005543 | Ga0070672_100007220 | Ga0070672_1000072202 | 799 |
| 207 | 3300013104 | Ga0157370_10040877 | Ga0157370_100408772 | 799 |
| 208 | 3300025932 | Ga0207690_10015670 | Ga0207690_100156702 | 799 |
| 209 | 3300037418 | Ga0395900_0001457 | Ga0395900_0001457_17557_20178 | 799 |
| 210 | 3300044656 | Ga0466969_0010403 | Ga0466969_0010403_443_3031 | 799 |
| 211 | 3300044719 | Ga0466971_0000663 | Ga0466971_0000663_7839_10427 | 799 |
| 212 | 3300044765 | Ga0466970_0002855 | Ga0466970_0002855_3185_5773 | 799 |
| 213 | 3300045049 | Ga0466959_0000278 | Ga0466959_0000278_27799_30387 | 799 |
| 214 | 3300045836 | Ga0466958_0015606 | Ga0466958_0015606_1176_3764 | 799 |
| 215 | 3300009545 | Ga0105237_10004174 | Ga0105237_1000417411 | 800 |
| 216 | 3300025914 | Ga0207671_10022956 | Ga0207671_100229563 | 800 |
| 217 | 3300001979 | JGI24740J21852_10007092 | JGI24740J21852_100070922 | 801 |
| 218 | 3300001989 | JGI24739J22299_10006537 | JGI24739J22299_100065372 | 801 |
| 219 | 3300005327 | Ga0070658_10004262 | Ga0070658_1000426210 | 801 |
| 220 | 3300005335 | Ga0070666_10013070 | Ga0070666_100130702 | 801 |
| 221 | 3300005355 | Ga0070671_100024959 | Ga0070671_1000249592 | 801 |
| 222 | 3300005367 | Ga0070667_100037217 | Ga0070667_1000372172 | 801 |
| 223 | 3300005547 | Ga0070693_100017967 | Ga0070693_1000179672 | 801 |
| 224 | 3300005548 | Ga0070665_100079750 | Ga0070665_1000797502 | 801 |
| 225 | 3300005616 | Ga0068852_100036536 | Ga0068852_1000365364 | 801 |
| 226 | 3300005834 | Ga0068851_10009179 | Ga0068851_100091792 | 801 |
| 227 | 3300013102 | Ga0157371_10013683 | Ga0157371_100136832 | 801 |
| 228 | 3300025903 | Ga0207680_10007208 | Ga0207680_100072083 | 801 |
| 229 | 3300025907 | Ga0207645_10009540 | Ga0207645_100095405 | 801 |
| 230 | 3300025909 | Ga0207705_10018592 | Ga0207705_100185923 | 801 |
| 231 | 3300025919 | Ga0207657_10002626 | Ga0207657_100026262 | 801 |
| 232 | 3300025919 | Ga0207657_10017525 | Ga0207657_100175253 | 801 |
| 233 | 3300025920 | Ga0207649_10027995 | Ga0207649_100279952 | 801 |
| 234 | 3300025932 | Ga0207690_10013353 | Ga0207690_100133533 | 801 |
| 235 | 3300025933 | Ga0207706_10013967 | Ga0207706_100139674 | 801 |
| 236 | 3300025942 | Ga0207689_10029198 | Ga0207689_100291984 | 801 |
| 237 | 3300025945 | Ga0207679_10019691 | Ga0207679_100196912 | 801 |
| 238 | 3300026041 | Ga0207639_10054311 | Ga0207639_100543112 | 801 |
| 239 | 3300026067 | Ga0207678_10013912 | Ga0207678_100139124 | 801 |
| 240 | 3300026116 | Ga0207674_10039022 | Ga0207674_100390224 | 801 |
| 241 | 3300038443 | Ga0395901_0037183 | Ga0395901_0037183_337_2955 | 801 |
| 242 | 3300044694 | Ga0466963_0012142 | Ga0466963_0012142_2087_4705 | 801 |
| 243 | 3300045976 | Ga0466967_0012300 | Ga0466967_0012300_2002_4620 | 801 |
| 244 | 3300046539 | Ga0495621_0000536 | Ga0495621_0000536_6524_9187 | 802 |
| 245 | 3300046691 | Ga0495670_0013616 | Ga0495670_0013616_1046_3709 | 802 |
| 246 | 3300037418 | Ga0395900_0020344 | Ga0395900_0020344_4079_6715 | 803 |
| 247 | 3300044694 | Ga0466963_0023913 | Ga0466963_0023913_156_2792 | 803 |
| 248 | 3300005719 | Ga0068861_100001690 | Ga0068861_10000169015 | 804 |
| 249 | 3300025941 | Ga0207711_10004111 | Ga0207711_100041115 | 804 |
| 250 | 3300026118 | Ga0207675_100000049 | Ga0207675_10000004980 | 804 |
| 251 | 3300037418 | Ga0395900_0003058 | Ga0395900_0003058_11085_13721 | 804 |
| 252 | 3300037471 | Ga0395905_0004190 | Ga0395905_0004190_5090_7726 | 804 |
| 253 | 3300038443 | Ga0395901_0051701 | Ga0395901_0051701_1664_4216 | 804 |
| 254 | 3300044693 | Ga0466961_0013967 | Ga0466961_0013967_96_2771 | 805 |
| 255 | 3300044694 | Ga0466963_0005314 | Ga0466963_0005314_1987_4662 | 805 |
| 256 | 3300044765 | Ga0466970_0005164 | Ga0466970_0005164_1220_3895 | 805 |
| 257 | 3300044842 | Ga0466957_0008191 | Ga0466957_0008191_1576_4251 | 805 |
| 258 | 3300005353 | Ga0070669_100052095 | Ga0070669_1000520952 | 806 |
| 259 | 3300005456 | Ga0070678_100003165 | Ga0070678_1000031652 | 806 |
| 260 | 3300005548 | Ga0070665_100000493 | Ga0070665_10000049328 | 806 |
| 261 | 3300005577 | Ga0068857_100061112 | Ga0068857_1000611122 | 806 |
| 262 | 3300005842 | Ga0068858_100011918 | Ga0068858_1000119186 | 806 |
| 263 | 3300013306 | Ga0163162_10016336 | Ga0163162_100163363 | 806 |
| 264 | 3300025931 | Ga0207644_10014208 | Ga0207644_100142084 | 806 |
| 265 | 3300025933 | Ga0207706_10062616 | Ga0207706_100626162 | 806 |
| 266 | 3300026035 | Ga0207703_10019631 | Ga0207703_100196313 | 806 |
| 267 | 3300026095 | Ga0207676_10023779 | Ga0207676_100237792 | 806 |
| 268 | 3300026116 | Ga0207674_10009062 | Ga0207674_100090626 | 806 |
| 269 | 3300026121 | Ga0207683_10008207 | Ga0207683_100082078 | 806 |
| 270 | 3300028379 | Ga0268266_10000181 | Ga0268266_10000181113 | 806 |
| 271 | 3300037312 | Ga0395899_0025343 | Ga0395899_0025343_704_3331 | 806 |
| 272 | 3300037418 | Ga0395900_0013324 | Ga0395900_0013324_5205_7832 | 806 |
| 273 | 3300037466 | Ga0395898_0003602 | Ga0395898_0003602_11864_14491 | 806 |
| 274 | 3300038443 | Ga0395901_0023381 | Ga0395901_0023381_425_3052 | 806 |
| 275 | 3300044684 | Ga0466966_0028206 | Ga0466966_0028206_191_2776 | 806 |
| 276 | 3300049571 | Ga0501034_0046882 | Ga0501034_0046882_1037_3511 | 806 |
| 277 | 3300005328 | Ga0070676_10022560 | Ga0070676_100225602 | 807 |
| 278 | 3300005329 | Ga0070683_100030680 | Ga0070683_1000306802 | 807 |
| 279 | 3300005546 | Ga0070696_100015462 | Ga0070696_1000154624 | 807 |
| 280 | 3300005548 | Ga0070665_100004800 | Ga0070665_1000048008 | 807 |
| 281 | 3300005564 | Ga0070664_100041505 | Ga0070664_1000415052 | 807 |
| 282 | 3300026116 | Ga0207674_10013991 | Ga0207674_100139916 | 807 |
| 283 | 3300028379 | Ga0268266_10003739 | Ga0268266_100037399 | 807 |
| 284 | 3300005262 | Ga0065165_1001810 | Ga0065165_100181016 | 808 |
| 285 | 3300005345 | Ga0070692_10002193 | Ga0070692_100021934 | 808 |
| 286 | 3300005353 | Ga0070669_100035785 | Ga0070669_1000357852 | 808 |
| 287 | 3300005843 | Ga0068860_100002208 | Ga0068860_1000022087 | 808 |
| 288 | 3300005844 | Ga0068862_100034239 | Ga0068862_1000342391 | 808 |
| 289 | 3300013100 | Ga0157373_10019689 | Ga0157373_100196894 | 808 |
| 290 | 3300013296 | Ga0157374_10032783 | Ga0157374_100327832 | 808 |
| 291 | 3300013308 | Ga0157375_10074822 | Ga0157375_100748222 | 808 |
| 292 | 3300033180 | Ga0307510_10001620 | Ga0307510_100016207 | 808 |
| 293 | 3300037312 | Ga0395899_0014342 | Ga0395899_0014342_3008_5662 | 808 |
| 294 | 3300037312 | Ga0395899_0017423 | Ga0395899_0017423_2104_4818 | 808 |
| 295 | 3300037418 | Ga0395900_0015325 | Ga0395900_0015325_3535_6249 | 808 |
| 296 | 3300037466 | Ga0395898_0013043 | Ga0395898_0013043_4604_7258 | 808 |
| 297 | 3300037466 | Ga0395898_0032484 | Ga0395898_0032484_1203_3917 | 808 |
| 298 | 3300037471 | Ga0395905_0026811 | Ga0395905_0026811_756_3449 | 808 |
| 299 | 3300038443 | Ga0395901_0017800 | Ga0395901_0017800_2847_5561 | 808 |
| 300 | 3300001979 | JGI24740J21852_10000840 | JGI24740J21852_1000084011 | 809 |
| 301 | 3300001989 | JGI24739J22299_10004250 | JGI24739J22299_100042502 | 809 |
| 302 | 3300002067 | JGI24735J21928_10003334 | JGI24735J21928_100033344 | 809 |
| 303 | 3300005329 | Ga0070683_100024730 | Ga0070683_1000247302 | 809 |
| 304 | 3300005457 | Ga0070662_100048701 | Ga0070662_1000487012 | 809 |
| 305 | 3300005546 | Ga0070696_100003138 | Ga0070696_1000031389 | 809 |
| 306 | 3300005564 | Ga0070664_100038689 | Ga0070664_1000386892 | 809 |
| 307 | 3300005616 | Ga0068852_100015112 | Ga0068852_1000151122 | 809 |
| 308 | 3300009094 | Ga0111539_10017555 | Ga0111539_100175554 | 809 |
| 309 | 3300009551 | Ga0105238_10021536 | Ga0105238_100215364 | 809 |
| 310 | 3300013105 | Ga0157369_10004778 | Ga0157369_100047787 | 809 |
| 311 | 3300025909 | Ga0207705_10007615 | Ga0207705_100076154 | 809 |
| 312 | 3300025909 | Ga0207705_10036747 | Ga0207705_100367472 | 809 |
| 313 | 3300025912 | Ga0207707_10022928 | Ga0207707_100229282 | 809 |
| 314 | 3300025917 | Ga0207660_10017087 | Ga0207660_100170872 | 809 |
| 315 | 3300025920 | Ga0207649_10019224 | Ga0207649_100192242 | 809 |
| 316 | 3300026067 | Ga0207678_10001226 | Ga0207678_1000122611 | 809 |
| 317 | 3300026116 | Ga0207674_10005315 | Ga0207674_100053154 | 809 |
| 318 | 3300026142 | Ga0207698_10011299 | Ga0207698_100112992 | 809 |
| 319 | 3300037312 | Ga0395899_0010837 | Ga0395899_0010837_4303_6963 | 809 |
| 320 | 3300037418 | Ga0395900_0023074 | Ga0395900_0023074_2518_5178 | 809 |
| 321 | 3300037471 | Ga0395905_0013867 | Ga0395905_0013867_4413_7073 | 809 |
| 322 | 3300038443 | Ga0395901_0011389 | Ga0395901_0011389_4487_7147 | 809 |
| 323 | 3300042144 | Ga0450889_000265 | Ga0450889_000265_135_2768 | 809 |
| 324 | 3300053087 | Ga0500643_005708 | Ga0500643_005708_814_3408 | 809 |
| 325 | 3300003323 | rootH1_10043878 | rootH1_100438783 | 810 |
| 326 | 3300026089 | Ga0207648_10037095 | Ga0207648_100370952 | 810 |
| 327 | iso_pu_bacteria | 2643221560 | 2643820323 | 810 |
| 328 | 3300005331 | Ga0070670_100002741 | Ga0070670_1000027416 | 811 |
| 329 | 3300005366 | Ga0070659_100005033 | Ga0070659_1000050333 | 811 |
| 330 | 3300005618 | Ga0068864_100000509 | Ga0068864_10000050915 | 811 |
| 331 | 3300025925 | Ga0207650_10002730 | Ga0207650_1000273012 | 811 |
| 332 | 3300025932 | Ga0207690_10002956 | Ga0207690_100029562 | 811 |
| 333 | 3300048927 | Ga0496124_0011267 | Ga0496124_0011267_4321_6876 | 811 |
| 334 | 3300005355 | Ga0070671_100024136 | Ga0070671_1000241362 | 812 |
| 335 | 3300006358 | Ga0068871_100017669 | Ga0068871_1000176693 | 812 |
| 336 | 3300009177 | Ga0105248_10038975 | Ga0105248_100389753 | 812 |
| 337 | 3300025931 | Ga0207644_10033594 | Ga0207644_100335942 | 812 |
| 338 | 3300037471 | Ga0395905_0016536 | Ga0395905_0016536_3642_6236 | 812 |
| 339 | 3300048910 | Ga0496107_0008365 | Ga0496107_0008365_3511_6141 | 812 |
| 340 | 3300048917 | Ga0496114_0005688 | Ga0496114_0005688_6968_9598 | 812 |
| 341 | 3300005327 | Ga0070658_10000033 | Ga0070658_1000003355 | 813 |
| 342 | 3300005327 | Ga0070658_10009299 | Ga0070658_100092994 | 813 |
| 343 | 3300005339 | Ga0070660_100001018 | Ga0070660_10000101814 | 813 |
| 344 | 3300005355 | Ga0070671_100054299 | Ga0070671_1000542992 | 813 |
| 345 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021939 | 813 |
| 346 | 3300025909 | Ga0207705_10001217 | Ga0207705_1000121713 | 813 |
| 347 | 3300025919 | Ga0207657_10004892 | Ga0207657_100048923 | 813 |
| 348 | 3300026067 | Ga0207678_10048645 | Ga0207678_100486452 | 813 |
| 349 | 3300037418 | Ga0395900_0001680 | Ga0395900_0001680_6782_9430 | 813 |
| 350 | 3300038443 | Ga0395901_0036459 | Ga0395901_0036459_823_3471 | 813 |
| 351 | 3300046506 | Ga0495583_0006888 | Ga0495583_0006888_1835_4390 | 813 |
| 352 | 3300046660 | Ga0495625_0005314 | Ga0495625_0005314_7855_10410 | 813 |
| 353 | 3300048915 | Ga0496112_0007890 | Ga0496112_0007890_3969_6617 | 813 |
| 354 | 3300049570 | Ga0501033_0020626 | Ga0501033_0020626_1763_4282 | 813 |
| 355 | 3300049574 | Ga0501038_0013129 | Ga0501038_0013129_4612_7131 | 813 |
| 356 | 3300049822 | Ga0501035_0023954 | Ga0501035_0023954_946_3465 | 813 |
| 357 | 3300053121 | Ga0500607_000011 | Ga0500607_000011_73317_75953 | 813 |
| 358 | 3300005434 | Ga0070709_10012379 | Ga0070709_100123792 | 814 |
| 359 | 3300005435 | Ga0070714_100010083 | Ga0070714_1000100835 | 814 |
| 360 | 3300006173 | Ga0070716_100011392 | Ga0070716_1000113922 | 814 |
| 361 | 3300006175 | Ga0070712_100010919 | Ga0070712_1000109194 | 814 |
| 362 | 3300025915 | Ga0207693_10009547 | Ga0207693_100095472 | 814 |
| 363 | 3300025939 | Ga0207665_10013292 | Ga0207665_100132924 | 814 |
| 364 | 3300026142 | Ga0207698_10055278 | Ga0207698_100552781 | 814 |
| 365 | 3300031995 | Ga0307409_100012696 | Ga0307409_1000126963 | 814 |
| 366 | 3300005331 | Ga0070670_100011685 | Ga0070670_1000116855 | 815 |
| 367 | 3300005335 | Ga0070666_10008188 | Ga0070666_100081885 | 815 |
| 368 | 3300005338 | Ga0068868_100000007 | Ga0068868_100000007132 | 815 |
| 369 | 3300005339 | Ga0070660_100000405 | Ga0070660_10000040521 | 815 |
| 370 | 3300005364 | Ga0070673_100007945 | Ga0070673_1000079452 | 815 |
| 371 | 3300005366 | Ga0070659_100000004 | Ga0070659_100000004111 | 815 |
| 372 | 3300005367 | Ga0070667_100024637 | Ga0070667_1000246374 | 815 |
| 373 | 3300005456 | Ga0070678_100006758 | Ga0070678_1000067585 | 815 |
| 374 | 3300005457 | Ga0070662_100007374 | Ga0070662_1000073742 | 815 |
| 375 | 3300005543 | Ga0070672_100008855 | Ga0070672_1000088554 | 815 |
| 376 | 3300005564 | Ga0070664_100012186 | Ga0070664_1000121866 | 815 |
| 377 | 3300005618 | Ga0068864_100026843 | Ga0068864_1000268432 | 815 |
| 378 | 3300005842 | Ga0068858_100013290 | Ga0068858_1000132904 | 815 |
| 379 | 3300005843 | Ga0068860_100027009 | Ga0068860_1000270094 | 815 |
| 380 | 3300005985 | Ga0081539_10022127 | Ga0081539_100221272 | 815 |
| 381 | 3300006237 | Ga0097621_100010698 | Ga0097621_1000106985 | 815 |
| 382 | 3300006358 | Ga0068871_100010978 | Ga0068871_1000109785 | 815 |
| 383 | 3300013296 | Ga0157374_10039077 | Ga0157374_100390774 | 815 |
| 384 | 3300013306 | Ga0163162_10010617 | Ga0163162_100106175 | 815 |
| 385 | 3300013308 | Ga0157375_10074288 | Ga0157375_100742882 | 815 |
| 386 | 3300014325 | Ga0163163_10043269 | Ga0163163_100432694 | 815 |
| 387 | 3300025919 | Ga0207657_10004207 | Ga0207657_100042072 | 815 |
| 388 | 3300025932 | Ga0207690_10000001 | Ga0207690_10000001474 | 815 |
| 389 | 3300025932 | Ga0207690_10000002 | Ga0207690_10000002474 | 815 |
| 390 | 3300025932 | Ga0207690_10000003 | Ga0207690_10000003474 | 815 |
| 391 | 3300025932 | Ga0207690_10000004 | Ga0207690_10000004474 | 815 |
| 392 | 3300025933 | Ga0207706_10000480 | Ga0207706_100004806 | 815 |
| 393 | 3300025940 | Ga0207691_10007026 | Ga0207691_100070264 | 815 |
| 394 | 3300025960 | Ga0207651_10024115 | Ga0207651_100241152 | 815 |
| 395 | 3300026023 | Ga0207677_10000014 | Ga0207677_10000014102 | 815 |
| 396 | 3300026035 | Ga0207703_10009181 | Ga0207703_100091811 | 815 |
| 397 | 3300026095 | Ga0207676_10006804 | Ga0207676_100068042 | 815 |
| 398 | 3300026121 | Ga0207683_10006175 | Ga0207683_100061756 | 815 |
| 399 | 3300037312 | Ga0395899_0035600 | Ga0395899_0035600_527_3175 | 815 |
| 400 | 3300037418 | Ga0395900_0017308 | Ga0395900_0017308_3162_5879 | 815 |
| 401 | 3300037466 | Ga0395898_0067806 | Ga0395898_0067806_552_3200 | 815 |
| 402 | 3300038443 | Ga0395901_0041261 | Ga0395901_0041261_361_3009 | 815 |
| 403 | 3300038443 | Ga0395901_0045828 | Ga0395901_0045828_524_3241 | 815 |
| 404 | 3300046522 | Ga0495643_0000826 | Ga0495643_0000826_13543_16182 | 815 |
| 405 | 3300046616 | Ga0495668_0000022 | Ga0495668_0000022_198165_200804 | 815 |
| 406 | 3300047443 | Ga0495687_000293 | Ga0495687_000293_31180_33765 | 815 |
| 407 | 3300048912 | Ga0496109_0008646 | Ga0496109_0008646_633_3278 | 815 |
| 408 | 3300048913 | Ga0496110_0028913 | Ga0496110_0028913_622_3267 | 815 |
| 409 | 3300053130 | Ga0500642_0000939 | Ga0500642_0000939_3712_6237 | 815 |
| 410 | 3300053133 | Ga0500655_000050 | Ga0500655_000050_20073_22598 | 815 |
| 411 | 3300053148 | Ga0500590_000291 | Ga0500590_000291_2687_5212 | 815 |
| 412 | 3300053156 | Ga0500622_0010857 | Ga0500622_0010857_157_2682 | 815 |
| 413 | 3300053724 | Ga0500570_008122 | Ga0500570_008122_2333_4858 | 815 |
| 414 | 3300005327 | Ga0070658_10011699 | Ga0070658_100116996 | 816 |
| 415 | 3300005354 | Ga0070675_100020437 | Ga0070675_1000204374 | 816 |
| 416 | 3300005535 | Ga0070684_100006000 | Ga0070684_1000060003 | 816 |
| 417 | 3300009177 | Ga0105248_10001586 | Ga0105248_1000158619 | 816 |
| 418 | 3300025926 | Ga0207659_10006793 | Ga0207659_100067933 | 816 |
| 419 | 3300025931 | Ga0207644_10006667 | Ga0207644_100066674 | 816 |
| 420 | 3300025941 | Ga0207711_10006891 | Ga0207711_100068916 | 816 |
| 421 | 3300026067 | Ga0207678_10011456 | Ga0207678_100114563 | 816 |
| 422 | 3300048911 | Ga0496108_0021847 | Ga0496108_0021847_1066_3702 | 816 |
| 423 | 3300048915 | Ga0496112_0008943 | Ga0496112_0008943_4020_6656 | 816 |
| 424 | 3300048916 | Ga0496113_0003801 | Ga0496113_0003801_3063_5699 | 816 |
| 425 | 3300003215 | JGI25153J46596_10000034 | JGI25153J46596_1000003463 | 817 |
| 426 | 3300003215 | JGI25153J46596_10000097 | JGI25153J46596_1000009792 | 817 |
| 427 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007534 | 817 |
| 428 | 3300048924 | Ga0496121_0010620 | Ga0496121_0010620_7272_9824 | 817 |
| 429 | 3300001990 | JGI24737J22298_10006718 | JGI24737J22298_100067182 | 818 |
| 430 | 3300003759 | Ga0055525_1000058 | Ga0055525_1000058168 | 818 |
| 431 | 3300005331 | Ga0070670_100006851 | Ga0070670_1000068515 | 818 |
| 432 | 3300005333 | Ga0070677_10000312 | Ga0070677_100003126 | 818 |
| 433 | 3300005333 | Ga0070677_10004136 | Ga0070677_100041362 | 818 |
| 434 | 3300005356 | Ga0070674_100036160 | Ga0070674_1000361602 | 818 |
| 435 | 3300005841 | Ga0068863_100039037 | Ga0068863_1000390372 | 818 |
| 436 | 3300025230 | Ga0209563_100024 | Ga0209563_100024265 | 818 |
| 437 | 3300025893 | Ga0207682_10000533 | Ga0207682_100005337 | 818 |
| 438 | 3300025925 | Ga0207650_10022295 | Ga0207650_100222953 | 818 |
| 439 | 3300025933 | Ga0207706_10006622 | Ga0207706_100066226 | 818 |
| 440 | 3300026088 | Ga0207641_10042329 | Ga0207641_100423292 | 818 |
| 441 | 3300037418 | Ga0395900_0070864 | Ga0395900_0070864_351_2984 | 818 |
| 442 | 3300037471 | Ga0395905_0014446 | Ga0395905_0014446_2865_5525 | 818 |
| 443 | 3300037471 | Ga0395905_0042326 | Ga0395905_0042326_842_3475 | 818 |
| 444 | 3300037471 | Ga0395905_0073038 | Ga0395905_0073038_469_3102 | 818 |
| 445 | 3300046660 | Ga0495625_0000469 | Ga0495625_0000469_32333_34933 | 818 |
| 446 | 3300003762 | Ga0055542_1000041 | Ga0055542_100004174 | 819 |
| 447 | 3300003763 | Ga0055529_1000040 | Ga0055529_100004099 | 819 |
| 448 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008221 | 819 |
| 449 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021202 | 819 |
| 450 | 3300028786 | Ga0307517_10017280 | Ga0307517_100172804 | 819 |
| 451 | 3300037418 | Ga0395900_0083661 | Ga0395900_0083661_248_2968 | 819 |
| 452 | 3300044658 | Ga0466972_0011839 | Ga0466972_0011839_321_2963 | 819 |
| 453 | 3300044765 | Ga0466970_0024124 | Ga0466970_0024124_151_2868 | 819 |
| 454 | 3300044901 | Ga0466960_0021657 | Ga0466960_0021657_183_2825 | 819 |
| 455 | 3300045049 | Ga0466959_0004576 | Ga0466959_0004576_5839_8556 | 819 |
| 456 | 3300045836 | Ga0466958_0005038 | Ga0466958_0005038_448_3165 | 819 |
| 457 | 3300046492 | Ga0495585_0017098 | Ga0495585_0017098_1539_4136 | 819 |
| 458 | 3300046520 | Ga0495637_0009175 | Ga0495637_0009175_1301_3901 | 819 |
| 459 | 3300046684 | Ga0495669_0000046 | Ga0495669_0000046_7651_10323 | 819 |
| 460 | 3300046684 | Ga0495669_0000049 | Ga0495669_0000049_49603_52203 | 819 |
| 461 | 3300046691 | Ga0495670_0007872 | Ga0495670_0007872_167_2770 | 819 |
| 462 | 3300047443 | Ga0495687_000043 | Ga0495687_000043_139919_142570 | 819 |
| 463 | 3300053079 | Ga0500610_0002791 | Ga0500610_0002791_1115_3766 | 819 |
| 464 | 3300053730 | Ga0500645_000145 | Ga0500645_000145_28584_31184 | 819 |
| 465 | 3300037418 | Ga0395900_0006747 | Ga0395900_0006747_722_3439 | 820 |
| 466 | 3300037471 | Ga0395905_0023020 | Ga0395905_0023020_2170_4887 | 820 |
| 467 | 3300046471 | Ga0495650_0000091 | Ga0495650_0000091_132158_134761 | 820 |
| 468 | 3300046691 | Ga0495670_0000003 | Ga0495670_0000003_312767_315325 | 820 |
| 469 | 3300046507 | Ga0495606_0000390 | Ga0495606_0000390_20247_22892 | 821 |
| 470 | 3300005331 | Ga0070670_100012862 | Ga0070670_1000128622 | 822 |
| 471 | 3300005344 | Ga0070661_100013928 | Ga0070661_1000139282 | 822 |
| 472 | 3300005436 | Ga0070713_100033381 | Ga0070713_1000333812 | 822 |
| 473 | 3300005459 | Ga0068867_100018239 | Ga0068867_1000182393 | 822 |
| 474 | 3300005543 | Ga0070672_100010560 | Ga0070672_1000105606 | 822 |
| 475 | 3300005564 | Ga0070664_100000247 | Ga0070664_10000024726 | 822 |
| 476 | 3300025901 | Ga0207688_10016533 | Ga0207688_100165333 | 822 |
| 477 | 3300025925 | Ga0207650_10004763 | Ga0207650_100047632 | 822 |
| 478 | 3300025933 | Ga0207706_10005186 | Ga0207706_1000518610 | 822 |
| 479 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005221 | 822 |
| 480 | 3300025940 | Ga0207691_10014963 | Ga0207691_100149634 | 822 |
| 481 | 3300026089 | Ga0207648_10023761 | Ga0207648_100237612 | 822 |
| 482 | 3300026121 | Ga0207683_10019106 | Ga0207683_100191062 | 822 |
| 483 | 3300031995 | Ga0307409_100036108 | Ga0307409_1000361082 | 822 |
| 484 | 3300038443 | Ga0395901_0015419 | Ga0395901_0015419_260_2956 | 822 |
| 485 | 3300046528 | Ga0495642_0004390 | Ga0495642_0004390_2769_5426 | 823 |
| 486 | 3300005355 | Ga0070671_100006028 | Ga0070671_1000060286 | 824 |
| 487 | 3300013296 | Ga0157374_10024065 | Ga0157374_100240654 | 824 |
| 488 | 3300025931 | Ga0207644_10018036 | Ga0207644_100180364 | 824 |
| 489 | 3300033180 | Ga0307510_10077067 | Ga0307510_100770672 | 824 |
| 490 | 3300045976 | Ga0466967_0019810 | Ga0466967_0019810_647_3328 | 824 |
| 491 | 3300045976 | Ga0466967_0025870 | Ga0466967_0025870_1030_3687 | 824 |
| 492 | 3300046506 | Ga0495583_0000693 | Ga0495583_0000693_20318_22966 | 824 |
| 493 | 3300048917 | Ga0496114_0052210 | Ga0496114_0052210_110_2782 | 824 |
| 494 | 3300048918 | Ga0496115_0000301 | Ga0496115_0000301_16248_18920 | 824 |
| 495 | 3300009176 | Ga0105242_10058866 | Ga0105242_100588662 | 825 |
| 496 | 3300046522 | Ga0495643_0002531 | Ga0495643_0002531_4676_7333 | 825 |
| 497 | 3300053177 | Ga0500636_0002492 | Ga0500636_0002492_2538_5138 | 825 |
| 498 | 3300002067 | JGI24735J21928_10006678 | JGI24735J21928_100066783 | 826 |
| 499 | 3300005336 | Ga0070680_100005032 | Ga0070680_1000050325 | 826 |
| 500 | 3300005339 | Ga0070660_100003945 | Ga0070660_1000039458 | 826 |
| 501 | 3300005564 | Ga0070664_100036818 | Ga0070664_1000368182 | 826 |
| 502 | 3300013100 | Ga0157373_10026144 | Ga0157373_100261442 | 826 |
| 503 | 3300013104 | Ga0157370_10018175 | Ga0157370_100181752 | 826 |
| 504 | 3300025923 | Ga0207681_10011670 | Ga0207681_100116702 | 826 |
| 505 | 3300025945 | Ga0207679_10039835 | Ga0207679_100398352 | 826 |
| 506 | 3300031456 | Ga0307513_10013148 | Ga0307513_100131485 | 826 |
| 507 | 3300048926 | Ga0496123_0006359 | Ga0496123_0006359_6974_9619 | 826 |
| 508 | 3300005327 | Ga0070658_10041711 | Ga0070658_100417112 | 827 |
| 509 | 3300005614 | Ga0068856_100068799 | Ga0068856_1000687992 | 827 |
| 510 | 3300005616 | Ga0068852_100038415 | Ga0068852_1000384152 | 827 |
| 511 | 3300013100 | Ga0157373_10012888 | Ga0157373_100128884 | 827 |
| 512 | 3300025919 | Ga0207657_10011611 | Ga0207657_100116114 | 827 |
| 513 | 3300025920 | Ga0207649_10030433 | Ga0207649_100304331 | 827 |
| 514 | 3300025932 | Ga0207690_10014590 | Ga0207690_100145904 | 827 |
| 515 | 3300026078 | Ga0207702_10064217 | Ga0207702_100642172 | 827 |
| 516 | 3300046539 | Ga0495621_0001226 | Ga0495621_0001226_1132_3852 | 827 |
| 517 | 3300046558 | Ga0495633_0003893 | Ga0495633_0003893_1750_4470 | 827 |
| 518 | iso_pu_bacteria | 2599185359 | 2600228193 | 827 |
| 519 | iso_pu_bacteria | 2818991466 | 2819716238 | 827 |
| 520 | iso_pu_bacteria | 2928526807 | 2928528959 | 827 |
| 521 | iso_pu_bacteria | 2928968154 | 2928971194 | 827 |
| 522 | 3300005336 | Ga0070680_100013651 | Ga0070680_1000136514 | 828 |
| 523 | 3300025917 | Ga0207660_10000492 | Ga0207660_1000049221 | 828 |
| 524 | 3300025921 | Ga0207652_10016169 | Ga0207652_100161694 | 828 |
| 525 | 3300005367 | Ga0070667_100022077 | Ga0070667_1000220772 | 829 |
| 526 | 3300046506 | Ga0495583_0015304 | Ga0495583_0015304_648_3251 | 829 |
| 527 | 3300046660 | Ga0495625_0013215 | Ga0495625_0013215_561_3164 | 829 |
| 528 | 3300053130 | Ga0500642_0002192 | Ga0500642_0002192_1099_3702 | 829 |
| 529 | 3300005327 | Ga0070658_10033383 | Ga0070658_100333832 | 830 |
| 530 | 3300005331 | Ga0070670_100000716 | Ga0070670_10000071625 | 830 |
| 531 | 3300005344 | Ga0070661_100026881 | Ga0070661_1000268814 | 830 |
| 532 | 3300005353 | Ga0070669_100004211 | Ga0070669_1000042116 | 830 |
| 533 | 3300005355 | Ga0070671_100000407 | Ga0070671_10000040724 | 830 |
| 534 | 3300005457 | Ga0070662_100002550 | Ga0070662_1000025502 | 830 |
| 535 | 3300005564 | Ga0070664_100002842 | Ga0070664_1000028423 | 830 |
| 536 | 3300005842 | Ga0068858_100000181 | Ga0068858_10000018129 | 830 |
| 537 | 3300009177 | Ga0105248_10014710 | Ga0105248_100147104 | 830 |
| 538 | 3300009177 | Ga0105248_10055497 | Ga0105248_100554973 | 830 |
| 539 | 3300013306 | Ga0163162_10007146 | Ga0163162_100071463 | 830 |
| 540 | 3300025909 | Ga0207705_10026911 | Ga0207705_100269112 | 830 |
| 541 | 3300025920 | Ga0207649_10016349 | Ga0207649_100163492 | 830 |
| 542 | 3300025925 | Ga0207650_10000200 | Ga0207650_1000020037 | 830 |
| 543 | 3300025931 | Ga0207644_10001728 | Ga0207644_100017288 | 830 |
| 544 | 3300025933 | Ga0207706_10005358 | Ga0207706_100053583 | 830 |
| 545 | 3300025941 | Ga0207711_10008462 | Ga0207711_100084623 | 830 |
| 546 | 3300025945 | Ga0207679_10020156 | Ga0207679_100201564 | 830 |
| 547 | 3300026035 | Ga0207703_10000135 | Ga0207703_1000013535 | 830 |
| 548 | 3300026067 | Ga0207678_10053405 | Ga0207678_100534052 | 830 |
| 549 | 3300031901 | Ga0307406_10008897 | Ga0307406_100088972 | 830 |
| 550 | 3300046524 | Ga0495648_0000065 | Ga0495648_0000065_23261_25864 | 830 |
| 551 | 3300046684 | Ga0495669_0000899 | Ga0495669_0000899_1180_3903 | 830 |
| 552 | 3300048905 | Ga0496102_0000384 | Ga0496102_0000384_22364_25015 | 830 |
| 553 | 3300048906 | Ga0496103_0000122 | Ga0496103_0000122_59216_61867 | 830 |
| 554 | 3300048907 | Ga0496104_0003131 | Ga0496104_0003131_3872_6523 | 830 |
| 555 | 3300048908 | Ga0496105_0000267 | Ga0496105_0000267_807_3458 | 830 |
| 556 | 3300048913 | Ga0496110_0003888 | Ga0496110_0003888_4875_7526 | 830 |
| 557 | 3300048918 | Ga0496115_0000122 | Ga0496115_0000122_22182_24833 | 830 |
| 558 | 3300048919 | Ga0496116_0004379 | Ga0496116_0004379_841_3492 | 830 |
| 559 | 3300048920 | Ga0496117_0000300 | Ga0496117_0000300_22364_25015 | 830 |
| 560 | 3300048921 | Ga0496118_0000547 | Ga0496118_0000547_36559_39210 | 830 |
| 561 | 3300048922 | Ga0496119_0005819 | Ga0496119_0005819_4972_7623 | 830 |
| 562 | 3300048924 | Ga0496121_0002643 | Ga0496121_0002643_22351_25002 | 830 |
| 563 | 3300048927 | Ga0496124_0000337 | Ga0496124_0000337_61227_63878 | 830 |
| 564 | 3300048929 | Ga0496126_0000416 | Ga0496126_0000416_61229_63880 | 830 |
| 565 | 3300005336 | Ga0070680_100011326 | Ga0070680_1000113264 | 831 |
| 566 | 3300005337 | Ga0070682_100002792 | Ga0070682_1000027926 | 831 |
| 567 | 3300005341 | Ga0070691_10002673 | Ga0070691_100026735 | 831 |
| 568 | 3300005535 | Ga0070684_100001781 | Ga0070684_1000017819 | 831 |
| 569 | 3300005564 | Ga0070664_100016155 | Ga0070664_1000161553 | 831 |
| 570 | 3300005577 | Ga0068857_100049656 | Ga0068857_1000496562 | 831 |
| 571 | 3300009093 | Ga0105240_10002534 | Ga0105240_1000253412 | 831 |
| 572 | 3300009545 | Ga0105237_10003027 | Ga0105237_100030276 | 831 |
| 573 | 3300010375 | Ga0105239_10000156 | Ga0105239_1000015631 | 831 |
| 574 | 3300013100 | Ga0157373_10008085 | Ga0157373_100080855 | 831 |
| 575 | 3300013307 | Ga0157372_10035366 | Ga0157372_100353662 | 831 |
| 576 | 3300025904 | Ga0207647_10001105 | Ga0207647_100011059 | 831 |
| 577 | 3300025913 | Ga0207695_10000521 | Ga0207695_1000052114 | 831 |
| 578 | 3300025913 | Ga0207695_10028754 | Ga0207695_100287546 | 831 |
| 579 | 3300025914 | Ga0207671_10000607 | Ga0207671_1000060739 | 831 |
| 580 | 3300025932 | Ga0207690_10013525 | Ga0207690_100135251 | 831 |
| 581 | 3300025944 | Ga0207661_10006376 | Ga0207661_100063762 | 831 |
| 582 | 3300025981 | Ga0207640_10008872 | Ga0207640_100088721 | 831 |
| 583 | 3300026067 | Ga0207678_10021226 | Ga0207678_100212263 | 831 |
| 584 | 3300026116 | Ga0207674_10003891 | Ga0207674_100038919 | 831 |
| 585 | 3300032002 | Ga0307416_100000416 | Ga0307416_1000004167 | 831 |
| 586 | 3300047472 | Ga0495686_0000849 | Ga0495686_0000849_3597_6212 | 831 |
| 587 | 3300048924 | Ga0496121_0004773 | Ga0496121_0004773_15156_17762 | 831 |
| 588 | 3300048929 | Ga0496126_0005624 | Ga0496126_0005624_9940_12546 | 831 |
| 589 | 3300031852 | Ga0307410_10000124 | Ga0307410_1000012418 | 832 |
| 590 | 3300032005 | Ga0307411_10031145 | Ga0307411_100311452 | 832 |
| 591 | 3300046558 | Ga0495633_0002445 | Ga0495633_0002445_6429_9032 | 832 |
| 592 | 3300001915 | JGI24741J21665_1001079 | JGI24741J21665_10010793 | 833 |
| 593 | 3300001990 | JGI24737J22298_10006121 | JGI24737J22298_100061211 | 833 |
| 594 | 3300005327 | Ga0070658_10004264 | Ga0070658_100042644 | 833 |
| 595 | 3300005339 | Ga0070660_100009744 | Ga0070660_1000097443 | 833 |
| 596 | 3300005344 | Ga0070661_100019002 | Ga0070661_1000190022 | 833 |
| 597 | 3300005366 | Ga0070659_100031048 | Ga0070659_1000310482 | 833 |
| 598 | 3300005564 | Ga0070664_100016097 | Ga0070664_1000160973 | 833 |
| 599 | 3300009174 | Ga0105241_10001067 | Ga0105241_1000106712 | 833 |
| 600 | 3300025321 | Ga0207656_10000677 | Ga0207656_100006772 | 833 |
| 601 | 3300025904 | Ga0207647_10032113 | Ga0207647_100321131 | 833 |
| 602 | 3300025909 | Ga0207705_10000253 | Ga0207705_1000025313 | 833 |
| 603 | 3300025911 | Ga0207654_10000449 | Ga0207654_100004499 | 833 |
| 604 | 3300025913 | Ga0207695_10047602 | Ga0207695_100476022 | 833 |
| 605 | 3300025914 | Ga0207671_10008025 | Ga0207671_100080252 | 833 |
| 606 | 3300025919 | Ga0207657_10010998 | Ga0207657_100109986 | 833 |
| 607 | 3300025920 | Ga0207649_10000850 | Ga0207649_100008505 | 833 |
| 608 | 3300025932 | Ga0207690_10008543 | Ga0207690_100085432 | 833 |
| 609 | 3300025945 | Ga0207679_10030427 | Ga0207679_100304272 | 833 |
| 610 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001768 | 833 |
| 611 | 3300025981 | Ga0207640_10007833 | Ga0207640_100078333 | 833 |
| 612 | 3300026041 | Ga0207639_10001401 | Ga0207639_100014016 | 833 |
| 613 | 3300026078 | Ga0207702_10030679 | Ga0207702_100306792 | 833 |
| 614 | 3300026116 | Ga0207674_10026537 | Ga0207674_100265373 | 833 |
| 615 | 3300026142 | Ga0207698_10006090 | Ga0207698_100060904 | 833 |
| 616 | 3300038443 | Ga0395901_0049327 | Ga0395901_0049327_12_2717 | 833 |
| 617 | iso_pu_bacteria | 2738541275 | 2738709432 | 833 |
| 618 | iso_pu_bacteria | 2738541301 | 2738847857 | 833 |
| 619 | iso_pu_bacteria | 2738541304 | 2738863586 | 833 |
| 620 | iso_pu_bacteria | 2738543022 | 2739296104 | 833 |
| 621 | iso_pu_bacteria | 2738543033 | 2739357782 | 833 |
| 622 | iso_pu_bacteria | 2928100450 | 2928102569 | 833 |
| 623 | iso_pu_bacteria | 2928959182 | 2928959345 | 833 |
| 624 | 3300047470 | Ga0495681_0010700 | Ga0495681_0010700_1250_3910 | 836 |
| 625 | 3300025940 | Ga0207691_10013911 | Ga0207691_100139115 | 837 |
| 626 | 3300028786 | Ga0307517_10007919 | Ga0307517_1000791911 | 838 |
| 627 | 3300005548 | Ga0070665_100000537 | Ga0070665_10000053720 | 845 |
| 628 | 3300028379 | Ga0268266_10000074 | Ga0268266_10000074176 | 845 |
| 629 | 2162886007 | SwRhRL2b_contig_1875504 | SwRhRL2b_0698.00007500 | 860 |
| 630 | 3300005289 | Ga0065704_10000358 | Ga0065704_1000035819 | 860 |
| 631 | 3300005353 | Ga0070669_100002756 | Ga0070669_1000027565 | 860 |
| 632 | 3300005355 | Ga0070671_100006646 | Ga0070671_1000066464 | 860 |
| 633 | 3300005548 | Ga0070665_100004116 | Ga0070665_1000041169 | 860 |
| 634 | 3300009177 | Ga0105248_10023141 | Ga0105248_100231414 | 860 |
| 635 | 3300025923 | Ga0207681_10000926 | Ga0207681_1000092615 | 860 |
| 636 | 3300025931 | Ga0207644_10005709 | Ga0207644_100057094 | 860 |
| 637 | 3300028379 | Ga0268266_10007793 | Ga0268266_100077934 | 860 |
| 638 | 3300048905 | Ga0496102_0000170 | Ga0496102_0000170_25243_27924 | 860 |
| 639 | 3300048906 | Ga0496103_0000081 | Ga0496103_0000081_17263_19944 | 860 |
| 640 | 3300048907 | Ga0496104_0003648 | Ga0496104_0003648_7892_10573 | 860 |
| 641 | 3300048908 | Ga0496105_0000034 | Ga0496105_0000034_7891_10572 | 860 |
| 642 | 3300048916 | Ga0496113_0001238 | Ga0496113_0001238_7823_10504 | 860 |
| 643 | 3300048922 | Ga0496119_0000057 | Ga0496119_0000057_163175_165856 | 860 |
| 644 | 3300048923 | Ga0496120_0003771 | Ga0496120_0003771_6042_8723 | 860 |
| 645 | 3300048926 | Ga0496123_0002890 | Ga0496123_0002890_3564_6245 | 860 |
| 646 | 3300048928 | Ga0496125_0003862 | Ga0496125_0003862_3564_6245 | 860 |
| 647 | 3300048929 | Ga0496126_0000028 | Ga0496126_0000028_181534_184215 | 860 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4epa-assembly1.cif.gz_A | the crystal structure of the ferric yersiniabactin uptake receptor fyua from yersinia pestis | 0.8691 | 49 | 860 |
| 4epa-assembly1.cif.gz_A | the crystal structure of the ferric yersiniabactin uptake receptor fyua from yersinia pestis | 0.8496 | 49 | 860 |
| 3m8b-assembly1.cif.gz_A | crystal structure of spin-labeled btub v10r1 in the apo state | 0.8425 | 39 | 860 |
| 1nqg-assembly1.cif.gz_A | outer membrane cobalamin transporter (btub) from e. coli, with bound calcium | 0.8318 | 48 | 860 |
| 1nqe-assembly1.cif.gz_A | outer membrane cobalamin transporter (btub) from e. coli | 0.8291 | 48 | 860 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4epaA00 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8716 | 49 | 860 | 2.40.170.20 |
| 4epaA00 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8512 | 49 | 860 | 2.40.170.20 |
| 3rgnA02 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8283 | 173 | 860 | 2.40.170.20 |
| 3rgnA02 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.8139 | 173 | 860 | 2.40.170.20 |
| 1kmpA02 | Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain | 0.7999 | 169 | 860 | 2.40.170.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A418WJQ9-F1-model_v4 | TonB-dependent receptor | 0.8906 | 586 | 860 |
GO:0006826
GO:0009279 |
| AF-A0A0F3IK49-F1-model_v4 | TonB-dependent receptor-like beta-barrel domain-containing protein | 0.8787 | 586 | 860 |
GO:0006826
GO:0009279 |
| AF-A0A6M1Y956-F1-model_v4 | TonB-dependent receptor | 0.8711 | 42 | 860 |
GO:0006826
GO:0009279 |
| AF-A0A7W7B491-F1-model_v4 | Outer membrane receptor protein involved in Fe transport | 0.8682 | 132 | 860 |
GO:0006826
GO:0009279 |
| AF-A0A660P0W3-F1-model_v4 | TonB-dependent receptor | 0.8667 | 109 | 860 |
GO:0006826
GO:0009279 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar