F472276

General Info

Members Datasets Scaffolds Average Seq Length
647 506 1294 259

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1000013|Ga0123341_100001324
Length 262
Sequence MTTTAQNGGQKAMHRPAVVSQTAWDAAWKQMLVKEKAQSHARDALAAERRRMPWMAVEKDYAFEGPQGRVSLLDLFEGRHQLILYRAFYEPGVFGWPEHACRGCSMVADQVAHVAHLNARDTTLVFASRGPQADIARLKARMGWTTIPWVTITDSFDKDFGVDEWHGTNVFYRDGERIFRTYFVNNRGDEQMGGTWNYLDITPLGRQEVWEDSPEGYPQTPTYKWWNWHDSYAADAEPDKKWVEVSDAGEAAFREESAKGKS

Samples

Sample ID Description Type Environment
1 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
95 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
142 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
143 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
144 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
145 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
174 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
175 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
176 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
177 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
178 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
184 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
185 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
302 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
303 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
304 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
305 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
306 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
307 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
308 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
309 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
310 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
311 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
312 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
313 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
314 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
315 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
316 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
317 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
318 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
319 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
320 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
321 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
322 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
323 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
324 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
325 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
326 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
327 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
328 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
329 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
330 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
331 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
332 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
333 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
334 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
335 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
336 2643221723 Ensifer sp. Root278 Isolate Unclassified
337 2718217882 Rhizobium sp. N741 Isolate Nodule
338 2718217927 Rhizobium sp. N324 Isolate Nodule
339 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
340 2718218009 Rhizobium sp. N561 Isolate Nodule
341 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
342 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
343 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
344 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
345 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
346 2718218363 Rhizobium sp. N113 Isolate Nodule
347 2718218365 Rhizobium sp. N731 Isolate Nodule
348 2718218366 Rhizobium sp. N621 Isolate Nodule
349 2718218423 Rhizobium sp. N941 Isolate Nodule
350 2721755514 Rhizobium sp. N6212 Isolate Nodule
351 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
352 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
353 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
354 2721755809 Rhizobium sp. N541 Isolate Nodule
355 2721755810 Rhizobium sp. N871 Isolate Nodule
356 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
357 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
358 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
359 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
360 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
361 2728369365 Rhizobium sp. N1341 Isolate Nodule
362 2728369397 Rhizobium sp. N1314 Isolate Nodule
363 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
364 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
365 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
366 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
367 2791355256 Rhizobium sp. M10 Isolate Nodule
368 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
369 2791355260 Rhizobium sp. L9 Isolate Nodule
370 2791355261 Rhizobium sp. J15 Isolate Nodule
371 2791355262 Rhizobium sp. M1 Isolate Nodule
372 2791355263 Rhizobium chutanense C5 Isolate Nodule
373 2791355264 Rhizobium sp. S9 Isolate Nodule
374 2791355265 Rhizobium sp. H4 Isolate Nodule
375 2791355266 Rhizobium sp. L43 Isolate Nodule
376 2791355267 Rhizobium sp. L18 Isolate Nodule
377 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
378 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
379 2802429633 Rhizobium anhuiense J3 Isolate Nodule
380 2802429634 Rhizobium anhuiense S10 Isolate Nodule
381 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
382 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
383 2802429637 Rhizobium anhuiense C15 Isolate Nodule
384 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
385 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
386 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
387 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
388 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
389 2838048938 Rhizobium pisi 27/80 Isolate Nodule
390 2838061910 Rhizobium phaseoli L15 Isolate Nodule
391 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
392 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
393 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
394 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
395 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
396 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
397 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
398 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
399 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
400 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
401 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
402 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
403 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
404 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
405 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
406 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
407 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
408 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
409 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
410 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
411 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
412 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
413 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
414 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
415 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
416 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
417 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
418 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
419 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
420 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
421 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
422 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
423 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
424 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
425 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
426 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
427 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
428 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
429 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
430 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
431 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
432 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
433 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
434 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
435 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
436 2842677519 Variovorax sp. R-72495 Isolate Unclassified
437 2844163670 Ensifer sp. 1H6 Isolate Unclassified
438 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
439 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
440 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
441 2858950400 Achromobacter sp. K91 Isolate Unclassified
442 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
443 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
444 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
445 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
446 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
447 2909042592 Labrys sp. LIt4 Isolate Nodule
448 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
449 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
450 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
451 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
452 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
453 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
454 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
455 2933599457 Rhizobium phaseoli M3 Isolate Nodule
456 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
457 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
458 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
459 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
460 2936381700 Rhizobium chutanense C16 Isolate Unclassified
461 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
462 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
463 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
464 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
465 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
466 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
467 2996893221 Rhizobium sp. R635 Isolate Nodule
468 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
469 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
470 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
471 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
472 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
473 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
474 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
475 8005275841 Rhizobium sp. N4311 Isolate Nodule
476 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
477 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
478 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
479 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
480 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
481 8005382845 Rhizobium sp. R634 Isolate Nodule
482 8005395548 Rhizobium sp. R339 Isolate Nodule
483 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
484 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
485 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
486 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
487 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
488 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
489 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
490 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
491 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
492 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
493 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
494 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
495 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
496 8018176218 Rhizobium sp. N122 Isolate Nodule
497 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
498 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
499 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
500 8024501048 Rhizobium sp. H4 Isolate Nodule
501 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
502 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
503 8056382006 Rhizobium croatiense 13T Isolate Nodule
504 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
505 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
506 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.85
Metatranscriptomes 0.31
Isolates 31.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.08
Nodule 28.75
Rhizoplane 3.86
Rhizosphere 40.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0123341_1000013 3300009765 Bacteria 97696
2 JGI25151J46595_10001546 3300003187 Bacteria 15355
3 JGI25151J46595_10003074 3300003187 Bacteria 9411
4 JGI25151J46595_10016131 3300003187 Bacteria 3273
5 JGI25153J46596_10004881 3300003215 Bacteria 7133
6 JGI25160J50197_1000005 3300003354 Bacteria 417280
7 JGI25160J50197_1000879 3300003354 Bacteria 15801
8 JGI25160J50197_1016142 3300003354 Bacteria 2418
9 JGI25161J50226_1001978 3300003374 Bacteria 5628
10 JGI25161J50226_1004441 3300003374 Bacteria 2935
11 Ga0006562J51391_1028949 3300003578 Bacteria 970
12 Ga0055526_1001412 3300003771 Bacteria 17095
13 Ga0055526_1001916 3300003771 Bacteria 14394
14 Ga0055526_1002113 3300003771 Bacteria 13643
15 Ga0055537_1000369 3300003773 Bacteria 30698
16 Ga0055524_1002450 3300003775 Bacteria 9546
17 Ga0055524_1030762 3300003775 Bacteria 1559
18 Ga0055536_1002736 3300003781 Bacteria 9765
19 Ga0055536_1006992 3300003781 Bacteria 5133
20 Ga0055534_1000044 3300003784 Bacteria 99295
21 Ga0055528_1000175 3300003790 Bacteria 54220
22 Ga0055528_1000269 3300003790 Bacteria 44061
23 Ga0055528_1000801 3300003790 Bacteria 21717
24 Ga0055528_1008848 3300003790 Bacteria 4263
25 Ga0055530_10012997 3300003791 Bacteria 2867
26 Ga0055540_1000192 3300003792 Bacteria 58828
27 Ga0055540_1035094 3300003792 Bacteria 1124
28 Ga0055531_10037896 3300003794 Bacteria 1457
29 Ga0055543_1000324 3300004625 Bacteria 33093
30 Ga0055543_1006342 3300004625 Bacteria 2870
31 Ga0065165_1000002 3300005262 Bacteria 444192
32 Ga0065165_1026156 3300005262 Bacteria 1924
33 Ga0065165_1027360 3300005262 Bacteria 1861
34 Ga0065714_10065424 3300005288 Bacteria 10159
35 Ga0070691_10017967 3300005341 Bacteria 3257
36 Ga0070659_100065667 3300005366 Bacteria 2874
37 Ga0070709_10021133 3300005434 Bacteria 3788
38 Ga0070714_100052883 3300005435 Bacteria 3465
39 Ga0070714_100087697 3300005435 Bacteria 2721
40 Ga0070701_10012359 3300005438 Bacteria 3849
41 Ga0070705_100000079 3300005440 Bacteria 53247
42 Ga0070700_100017375 3300005441 Bacteria 4112
43 Ga0070662_100031568 3300005457 Bacteria 3719
44 Ga0070681_10045659 3300005458 Bacteria 4382
45 Ga0070685_10077737 3300005466 Bacteria 1982
46 Ga0070707_100054109 3300005468 Bacteria 3848
47 Ga0070698_100031007 3300005471 Bacteria 5543
48 Ga0070695_100000380 3300005545 Bacteria 22898
49 Ga0070696_100000425 3300005546 Bacteria 26467
50 Ga0070665_100304300 3300005548 Bacteria 1597
51 Ga0068855_100417224 3300005563 Bacteria 1469
52 Ga0068857_100029877 3300005577 Bacteria 4809
53 Ga0070702_100088864 3300005615 Bacteria 1869
54 Ga0068852_100834043 3300005616 Bacteria 937
55 Ga0068859_100070495 3300005617 Bacteria 3531
56 Ga0068861_100325073 3300005719 Bacteria 1341
57 Ga0068861_100482742 3300005719 Bacteria 1117
58 Ga0068858_100127983 3300005842 Bacteria 2380
59 Ga0081540_1028224 3300005983 Bacteria 3157
60 Ga0081539_10000444 3300005985 Bacteria 88011
61 Ga0070717_10013471 3300006028 Bacteria 6268
62 Ga0075365_10002482 3300006038 Bacteria 9065
63 Ga0075368_10007782 3300006042 Bacteria 3796
64 Ga0075368_10070598 3300006042 Bacteria 1410
65 Ga0075363_100008129 3300006048 Bacteria 4869
66 Ga0075363_100009405 3300006048 Bacteria 4595
67 Ga0075363_100020786 3300006048 Bacteria 3297
68 Ga0075363_100238706 3300006048 Bacteria 1044
69 Ga0075364_10001378 3300006051 Bacteria 13109
70 Ga0075364_10135576 3300006051 Bacteria 1654
71 Ga0070712_100012063 3300006175 Bacteria 5491
72 Ga0075362_10000537 3300006177 Bacteria 11051
73 Ga0075362_10022348 3300006177 Bacteria 2664
74 Ga0075367_10003052 3300006178 Bacteria 7847
75 Ga0075367_10005945 3300006178 Bacteria 6125
76 Ga0075367_10049609 3300006178 Bacteria 2474
77 Ga0075367_10070752 3300006178 Bacteria 2097
78 Ga0075369_10002735 3300006186 Bacteria 6323
79 Ga0075366_10000974 3300006195 Bacteria 13992
80 Ga0075366_10077806 3300006195 Bacteria 1979
81 Ga0097621_100057148 3300006237 Bacteria 3189
82 Ga0075370_10002169 3300006353 Bacteria 8998
83 Ga0075370_10034671 3300006353 Bacteria 2829
84 Ga0075370_10046996 3300006353 Bacteria 2444
85 Ga0068871_100475644 3300006358 Bacteria 1123
86 Ga0075428_100100763 3300006844 Bacteria 3149
87 Ga0075428_100625862 3300006844 Bacteria 1149
88 Ga0075430_100015606 3300006846 Bacteria 6467
89 Ga0075430_100032484 3300006846 Bacteria 4431
90 Ga0075431_100009169 3300006847 Bacteria 9923
91 Ga0075431_100051761 3300006847 Bacteria 4234
92 Ga0075431_100085720 3300006847 Bacteria 3251
93 Ga0075431_100237892 3300006847 Bacteria 1853
94 Ga0075433_10184261 3300006852 Bacteria 1857
95 Ga0075434_100128951 3300006871 Bacteria 2547
96 Ga0075436_100014203 3300006914 Bacteria 5452
97 Ga0097620_100070494 3300006931 Bacteria 3531
98 Ga0099825_1027163 3300006941 Bacteria 2948
99 Ga0099824_1008495 3300006942 Bacteria 13117
100 Ga0099822_1013304 3300006943 Bacteria 9675
101 Ga0079104_1016961 3300006946 Bacteria 2109
102 Ga0099826_10001431 3300006948 Bacteria 14303
103 Ga0075435_100053969 3300007076 Bacteria 3243
104 Ga0075435_100116554 3300007076 Bacteria 2225
105 Ga0105240_10012018 3300009093 Bacteria 12002
106 Ga0105240_10378179 3300009093 Bacteria 1600
107 Ga0114129_10172476 3300009147 Bacteria 2948
108 Ga0114129_10381802 3300009147 Bacteria 1860
109 Ga0105241_10254760 3300009174 Bacteria 1489
110 Ga0105242_10078243 3300009176 Bacteria 2760
111 Ga0105248_10043201 3300009177 Bacteria 5054
112 Ga0105237_10081785 3300009545 Bacteria 3221
113 Ga0105237_10329964 3300009545 Bacteria 1530
114 Ga0123342_1040019 3300009766 Bacteria 1753
115 Ga0099796_10002227 3300010159 Bacteria 4202
116 Ga0105239_10010843 3300010375 Bacteria 10181
117 Ga0105239_10026693 3300010375 Bacteria 6356
118 Ga0105239_10052716 3300010375 Bacteria 4461
119 Ga0105239_10389707 3300010375 Bacteria 1576
120 Ga0105239_10423576 3300010375 Bacteria 1508
121 Ga0105239_10999789 3300010375 Bacteria 962
122 Ga0157373_10015240 3300013100 Bacteria 5621
123 Ga0163163_10062269 3300014325 Bacteria 3696
124 Ga0182008_10017339 3300014497 Bacteria 3737
125 Ga0157379_10131922 3300014968 Bacteria 2249
126 Ga0182007_10001637 3300015262 Bacteria 11859
127 Ga0182005_1061490 3300015265 Bacteria 1026
128 Ga0183363_1072 3300015690 Bacteria 30043
129 Ga0163161_10037465 3300017792 Bacteria 3477
130 Ga0163161_10206211 3300017792 Bacteria 1517
131 Ga0214542_1017604 3300021321 Bacteria 6377
132 Ga0214543_1000018 3300021327 Bacteria 272335
133 Ga0213875_10000935 3300021388 Bacteria 20990
134 Ga0224572_1001023 3300024225 Bacteria 3880
135 Ga0228598_1000041 3300024227 Bacteria 18143
136 Ga0209436_100162 3300025208 Bacteria 32237
137 Ga0207425_1004352 3300025245 Bacteria 4281
138 Ga0209148_1000037 3300025254 Bacteria 494767
139 Ga0209129_1000771 3300025258 Bacteria 20312
140 Ga0209565_1000039 3300025263 Bacteria 278026
141 Ga0209455_1000036 3300025272 Bacteria 473309
142 Ga0209673_1000013 3300025273 Bacteria 571633
143 Ga0209673_1000146 3300025273 Bacteria 150871
144 Ga0209673_1000325 3300025273 Bacteria 87535
145 Ga0209673_1001202 3300025273 Bacteria 27769
146 Ga0209673_1003962 3300025273 Bacteria 8268
147 Ga0209673_1004764 3300025273 Bacteria 7131
148 Ga0209130_1000010 3300025284 Bacteria 444920
149 Ga0209130_1001943 3300025284 Bacteria 11469
150 Ga0209675_1000030 3300025291 Bacteria 278026
151 Ga0209676_1001612 3300025292 Bacteria 19989
152 Ga0209025_1000534 3300025294 Bacteria 72165
153 Ga0209025_1001166 3300025294 Bacteria 37252
154 Ga0209025_1044413 3300025294 Bacteria 1857
155 Ga0209564_1000264 3300025295 Bacteria 111404
156 Ga0209564_1000473 3300025295 Bacteria 67272
157 Ga0209564_1001458 3300025295 Bacteria 24030
158 Ga0209758_1002424 3300025297 Bacteria 19060
159 Ga0209758_1002732 3300025297 Bacteria 17369
160 Ga0209758_1021304 3300025297 Bacteria 3025
161 Ga0209050_1005318 3300025298 Bacteria 8165
162 Ga0209256_1000245 3300025299 Bacteria 96643
163 Ga0209256_1000369 3300025299 Bacteria 72557
164 Ga0209256_1003331 3300025299 Bacteria 11396
165 Ga0207426_1000036 3300025302 Bacteria 444920
166 Ga0207426_1000039 3300025302 Bacteria 439937
167 Ga0207426_1004254 3300025302 Bacteria 7104
168 Ga0209051_1000253 3300025303 Bacteria 90622
169 Ga0209051_1001000 3300025303 Bacteria 27153
170 Ga0209051_1004287 3300025303 Bacteria 8870
171 Ga0209257_1002124 3300025304 Bacteria 20695
172 Ga0209257_1002174 3300025304 Bacteria 20322
173 Ga0207647_10057971 3300025904 Bacteria 2373
174 Ga0207647_10166069 3300025904 Bacteria 1286
175 Ga0207705_10135921 3300025909 Bacteria 1833
176 Ga0207654_10104890 3300025911 Bacteria 1748
177 Ga0207707_10064452 3300025912 Bacteria 3190
178 Ga0207707_10130705 3300025912 Bacteria 2196
179 Ga0207695_10009269 3300025913 Bacteria 12192
180 Ga0207695_10225033 3300025913 Bacteria 1782
181 Ga0207693_10004440 3300025915 Bacteria 11855
182 Ga0207652_10224722 3300025921 Bacteria 1692
183 Ga0207646_10118854 3300025922 Bacteria 2374
184 Ga0207694_10108647 3300025924 Bacteria 2204
185 Ga0207664_10076908 3300025929 Bacteria 2703
186 Ga0207690_10029561 3300025932 Bacteria 3486
187 Ga0207706_10027974 3300025933 Bacteria 5038
188 Ga0207686_10132535 3300025934 Bacteria 1711
189 Ga0207669_10175823 3300025937 Bacteria 1529
190 Ga0207691_10059778 3300025940 Bacteria 3464
191 Ga0207711_10024664 3300025941 Bacteria 5042
192 Ga0207661_10452307 3300025944 Bacteria 1170
193 Ga0207667_10163358 3300025949 Bacteria 2290
194 Ga0207640_10478058 3300025981 Bacteria 1033
195 Ga0207703_10096887 3300026035 Bacteria 2491
196 Ga0207639_10079660 3300026041 Bacteria 2589
197 Ga0207678_10421090 3300026067 Bacteria 1158
198 Ga0207674_10541377 3300026116 Bacteria 1125
199 Ga0207675_100100763 3300026118 Bacteria 2721
200 Ga0207683_10046502 3300026121 Bacteria 3798
201 Ga0209589_1000001 3300027357 Bacteria 794224
202 Ga0209489_100001 3300027361 Bacteria 794224
203 Ga0209700_100001 3300027363 Bacteria 794224
204 Ga0209282_1012610 3300027666 Bacteria 5372
205 Ga0209813_10017412 3300027866 Bacteria 1972
206 Ga0209813_10056096 3300027866 Bacteria 1246
207 Ga0307515_10082850 3300028794 Bacteria 4141
208 Ga0307511_10061864 3300030521 Bacteria 2848
209 Ga0316176_1140230 3300030732 Bacteria 1667
210 Ga0314311_1034637 3300030733 Bacteria 15856
211 Ga0316178_1014198 3300030735 Bacteria 4251
212 Ga0316180_1096139 3300030736 Bacteria 3016
213 Ga0316183_1198096 3300030742 Bacteria 4176
214 Ga0265340_10082656 3300031247 Bacteria 1510
215 Ga0307516_10125575 3300031730 Bacteria 2351
216 Ga0307410_10216842 3300031852 Bacteria 1470
217 Ga0307412_10099604 3300031911 Bacteria 2052
218 Ga0307412_10125511 3300031911 Bacteria 1856
219 Ga0307412_10188750 3300031911 Bacteria 1556
220 Ga0307412_10303338 3300031911 Bacteria 1263
221 Ga0307409_100580835 3300031995 Bacteria 1105
222 Ga0307409_100926540 3300031995 Bacteria 886
223 Ga0307416_100017075 3300032002 Bacteria 5065
224 Ga0307414_10017846 3300032004 Bacteria 4353
225 Ga0307411_10201290 3300032005 Bacteria 1529
226 Ga0307411_10526205 3300032005 Bacteria 1004
227 Ga0307507_10040471 3300033179 Bacteria 4681
228 Ga0307507_10130146 3300033179 Bacteria 1973
229 Ga0373943_0023748 3300035170 Bacteria 2853
230 Ga0373946_0027093 3300035171 Bacteria 2265
231 Ga0373935_0056492 3300035692 Bacteria 2502
232 Ga0373935_0082763 3300035692 Bacteria 2088
233 Ga0373927_0025557 3300035695 Bacteria 3861
234 Ga0373927_0051139 3300035695 Bacteria 2672
235 Ga0373937_0114014 3300036401 Bacteria 2516
236 Ga0373925_0001247 3300037068 Bacteria 22445
237 Ga0373925_0137337 3300037068 Bacteria 1911
238 Ga0395899_0006774 3300037312 Bacteria 8877
239 Ga0395900_0229005 3300037418 Bacteria 1870
240 Ga0395898_0090669 3300037466 Bacteria 2942
241 Ga0395898_0263943 3300037466 Bacteria 1642
242 Ga0395905_0000017 3300037471 Bacteria 376619
243 Ga0436364_0838310 3300037853 Bacteria 19399
244 Ga0395901_0279056 3300038443 Bacteria 1736
245 Ga0436360_0430836 3300039438 Bacteria 882
246 Ga0436361_0122568 3300039447 Bacteria 6371
247 Ga0436363_0416503 3300039450 Bacteria 1549
248 Ga0439436_0034310 3300041404 Bacteria 1467
249 Ga0439436_0046417 3300041404 Bacteria 1235
250 Ga0439465_0003131 3300041413 Bacteria 5400
251 Ga0451793_0446925 3300041452 Bacteria 1278
252 Ga0451798_0284410 3300041458 Bacteria 944
253 Ga0451835_0043983 3300041492 Bacteria 2482
254 Ga0451837_0861550 3300041494 Bacteria 1083
255 Ga0451841_0595127 3300041498 Bacteria 2049
256 Ga0451847_0393698 3300041503 Bacteria 3245
257 Ga0451851_0019019 3300041507 Bacteria 3265
258 Ga0451853_1819537 3300041512 Bacteria 4472
259 Ga0439445_0084393 3300042004 Bacteria 890
260 Ga0439432_003954 3300042006 Bacteria 5453
261 Ga0439449_0013213 3300042007 Bacteria 3106
262 Ga0450896_001581 3300042133 Bacteria 2831
263 Ga0450908_000341 3300042184 Bacteria 9076
264 Ga0450918_000211 3300042531 Bacteria 13202
265 Ga0466966_0002487 3300044684 Bacteria 12067
266 Ga0466961_0000081 3300044693 Bacteria 59450
267 Ga0466963_0121735 3300044694 Bacteria 1796
268 Ga0466964_0129745 3300044706 Bacteria 1146
269 Ga0466970_0305838 3300044765 Bacteria 897
270 Ga0466957_0090186 3300044842 Bacteria 1920
271 Ga0466959_0125080 3300045049 Bacteria 1825
272 Ga0466967_0424355 3300045976 Bacteria 1296
273 Ga0495629_0047870 3300046459 Bacteria 2998
274 Ga0495638_0082547 3300046460 Bacteria 1949
275 Ga0495651_0003650 3300046462 Bacteria 11786
276 Ga0495653_0057422 3300046463 Bacteria 2962
277 Ga0495653_0087548 3300046463 Bacteria 2287
278 Ga0495580_0170031 3300046472 Bacteria 1507
279 Ga0495605_0065117 3300046474 Bacteria 1734
280 Ga0495639_0001912 3300046475 Bacteria 9238
281 Ga0495662_0012048 3300046476 Bacteria 4225
282 Ga0495662_0196590 3300046476 Bacteria 994
283 Ga0495664_0001054 3300046477 Bacteria 14241
284 Ga0495664_0016951 3300046477 Bacteria 4160
285 Ga0495585_0063684 3300046492 Bacteria 2023
286 Ga0495596_0065572 3300046500 Bacteria 1412
287 Ga0495608_0067924 3300046511 Bacteria 2331
288 Ga0495608_0068135 3300046511 Bacteria 2327
289 Ga0495610_0033331 3300046512 Bacteria 2664
290 Ga0495618_0084114 3300046514 Bacteria 2033
291 Ga0495628_0008616 3300046516 Bacteria 8739
292 Ga0495628_0142173 3300046516 Bacteria 1831
293 Ga0495630_0018994 3300046517 Bacteria 5051
294 Ga0495637_0091506 3300046520 Bacteria 1199
295 Ga0495648_0063919 3300046524 Bacteria 2170
296 Ga0495648_0079339 3300046524 Bacteria 1874
297 Ga0495666_0083834 3300046526 Bacteria 1506
298 Ga0495652_0021740 3300046529 Bacteria 5703
299 Ga0495652_0065611 3300046529 Bacteria 3049
300 Ga0495654_0169572 3300046530 Bacteria 952
301 Ga0495665_0056410 3300046531 Bacteria 2074
302 Ga0495640_0080553 3300046533 Bacteria 2165
303 Ga0495587_0033155 3300046536 Bacteria 3119
304 Ga0495587_0059856 3300046536 Bacteria 2234
305 Ga0495597_0027694 3300046542 Bacteria 2597
306 Ga0495645_0002549 3300046543 Bacteria 12363
307 Ga0495645_0012442 3300046543 Bacteria 5997
308 Ga0495633_0032691 3300046558 Bacteria 2512
309 Ga0495667_0021678 3300046559 Bacteria 4335
310 Ga0495667_0062588 3300046559 Bacteria 2438
311 Ga0495656_0001532 3300046615 Bacteria 7550
312 Ga0495634_0017423 3300046642 Bacteria 5124
313 Ga0495634_0036534 3300046642 Bacteria 3360
314 Ga0495611_0017259 3300046648 Bacteria 3086
315 Ga0495625_0000052 3300046660 Bacteria 190656
316 Ga0495625_0037865 3300046660 Bacteria 3533
317 Ga0495625_0060852 3300046660 Bacteria 2674
318 Ga0495625_0100603 3300046660 Bacteria 1987
319 Ga0495635_0011793 3300046663 Bacteria 6128
320 Ga0495635_0027868 3300046663 Bacteria 3928
321 Ga0495661_0035454 3300046665 Bacteria 3130
322 Ga0495661_0077054 3300046665 Bacteria 1933
323 Ga0495588_0001503 3300046674 Bacteria 9988
324 Ga0495657_0016350 3300046675 Bacteria 5406
325 Ga0495657_0018110 3300046675 Bacteria 5104
326 Ga0495657_0036331 3300046675 Bacteria 3405
327 Ga0495599_0005248 3300046678 Bacteria 7730
328 Ga0495599_0019861 3300046678 Bacteria 4184
329 Ga0495646_0042053 3300046680 Bacteria 2806
330 Ga0495646_0056965 3300046680 Bacteria 2341
331 Ga0495646_0259379 3300046680 Bacteria 929
332 Ga0495613_0028020 3300046689 Bacteria 4192
333 Ga0495613_0091919 3300046689 Bacteria 2198
334 Ga0495624_0015047 3300046690 Bacteria 5237
335 Ga0495649_0006830 3300046694 Bacteria 7065
336 Ga0495600_0005446 3300046809 Bacteria 7673
337 Ga0495600_0049519 3300046809 Bacteria 2741
338 Ga0495660_0015697 3300046810 Bacteria 4373
339 Ga0495604_0003777 3300047317 Bacteria 12054
340 Ga0495604_0016956 3300047317 Bacteria 5825
341 Ga0495674_0031347 3300047319 Bacteria 4830
342 Ga0495674_0182578 3300047319 Bacteria 1747
343 Ga0495672_0020134 3300047320 Bacteria 4380
344 Ga0495676_0062972 3300047321 Bacteria 2893
345 Ga0495680_0043439 3300047322 Bacteria 3558
346 Ga0495687_007286 3300047443 Bacteria 6555
347 Ga0495675_0100549 3300047444 Bacteria 1810
348 Ga0495675_0290095 3300047444 Bacteria 974
349 Ga0495679_015719 3300047446 Bacteria 2760
350 Ga0495681_0038201 3300047470 Bacteria 2356
351 Ga0495684_0389056 3300047471 Bacteria 982
352 Ga0495686_0021410 3300047472 Bacteria 4294
353 Ga0495686_0072945 3300047472 Bacteria 2109
354 Ga0495593_0021553 3300047673 Bacteria 3597
355 Ga0495602_0029168 3300048088 Bacteria 5264
356 Ga0495602_0190339 3300048088 Bacteria 1574
357 Ga0496100_0001473 3300048903 Bacteria 11524
358 Ga0496101_0024641 3300048904 Bacteria 4166
359 Ga0496102_0002386 3300048905 Bacteria 16031
360 Ga0496102_0038016 3300048905 Bacteria 4342
361 Ga0496104_0016340 3300048907 Bacteria 6740
362 Ga0496104_0030085 3300048907 Bacteria 5043
363 Ga0496105_0000649 3300048908 Bacteria 23327
364 Ga0496105_0003866 3300048908 Bacteria 11194
365 Ga0496105_0307746 3300048908 Bacteria 1273
366 Ga0496106_0000298 3300048909 Bacteria 35026
367 Ga0496106_0001140 3300048909 Bacteria 19677
368 Ga0496106_0135520 3300048909 Bacteria 1934
369 Ga0496107_0086733 3300048910 Bacteria 2285
370 Ga0496108_0122490 3300048911 Bacteria 2231
371 Ga0496109_0145240 3300048912 Bacteria 2219
372 Ga0496109_0306938 3300048912 Bacteria 1497
373 Ga0496109_0312476 3300048912 Bacteria 1483
374 Ga0496110_0032013 3300048913 Bacteria 4539
375 Ga0496111_0048660 3300048914 Bacteria 3054
376 Ga0496114_0098737 3300048917 Bacteria 2490
377 Ga0496115_0033160 3300048918 Bacteria 4076
378 Ga0496115_0175866 3300048918 Bacteria 1770
379 Ga0496117_0000939 3300048920 Bacteria 44634
380 Ga0496117_0011684 3300048920 Bacteria 7836
381 Ga0496118_0001769 3300048921 Bacteria 31259
382 Ga0496118_0003337 3300048921 Bacteria 20313
383 Ga0496118_0010658 3300048921 Bacteria 9067
384 Ga0496118_0082496 3300048921 Bacteria 2252
385 Ga0496119_0013564 3300048922 Bacteria 6475
386 Ga0496120_0021302 3300048923 Bacteria 4099
387 Ga0496121_0000668 3300048924 Bacteria 64093
388 Ga0496121_0007858 3300048924 Bacteria 12756
389 Ga0496121_0106532 3300048924 Bacteria 2149
390 Ga0496121_0406222 3300048924 Bacteria 890
391 Ga0496124_0003401 3300048927 Bacteria 19546
392 Ga0496124_0147643 3300048927 Bacteria 1849
393 Ga0496126_0006242 3300048929 Bacteria 13320
394 Ga0496126_0018073 3300048929 Bacteria 7003
395 Ga0496126_0084081 3300048929 Bacteria 2807
396 Ga0496126_0324382 3300048929 Bacteria 1265
397 Ga0501076_0567385 3300049592 Bacteria 936
398 Ga0501079_0324061 3300049741 Bacteria 1206
399 Ga0501044_0659112 3300049823 Bacteria 935
400 nmdc:mga03683_27341_c1 3300050489 Bacteria 2258
401 nmdc:mga03683_33832_c1 3300050489 Bacteria 2066
402 nmdc:mga03n38_17798_c1 3300050490 Bacteria 2790
403 nmdc:mga03n38_58687_c1 3300050490 Bacteria 1744
404 nmdc:mga0yw44_11147_c1 3300050492 Bacteria 4624
405 nmdc:mga0yw44_17487_c1 3300050492 Bacteria 3903
406 nmdc:mga0k408_11233_c1 3300050493 Bacteria 4869
407 nmdc:mga0k408_267910_c1 3300050493 Bacteria 1020
408 nmdc:mga06z11_15600_c2 3300050494 Bacteria 2849
409 nmdc:mga06z11_276082_c1 3300050494 Bacteria 995
410 nmdc:mga06z11_405871_c1 3300050494 Bacteria 820
411 nmdc:mga04h51_20610_c1 3300050495 Bacteria 1971
412 nmdc:mga07m45_11528_c1 3300050496 Bacteria 4648
413 nmdc:mga07m45_9175_c1 3300050496 Bacteria 5115
414 nmdc:mga07m45_9404_c1 3300050496 Bacteria 5069
415 nmdc:mga05p37_142895_c1 3300050507 Bacteria 2931
416 nmdc:mga09592_54565_c1 3300050508 Bacteria 3377
417 nmdc:mga0qj67_13985_c1 3300050509 Bacteria 6061
418 nmdc:mga0qj67_547527_c1 3300050509 Bacteria 928
419 nmdc:mga06r32_26094_c1 3300050510 Bacteria 5444
420 nmdc:mga06r32_5610_c1 3300050510 Bacteria 11287
421 nmdc:mga06r32_91699_c1 3300050510 Bacteria 2970
422 nmdc:mga0n895_26135_c1 3300050512 Bacteria 5525
423 nmdc:mga0rr50_32950_c1 3300050513 Bacteria 3697
424 nmdc:mga0rr50_46252_c1 3300050513 Bacteria 3204
425 nmdc:mga08x19_28688_c1 3300050514 Bacteria 3488
426 nmdc:mga0a205_38507_c1 3300050515 Bacteria 4601
427 nmdc:mga0sz30_6761_c1 3300050516 Bacteria 4277
428 Ga0495655_0070867 3300053083 Bacteria 974
429 Ga0500651_0000009 3300053093 Bacteria 270362
430 Ga0500651_0002750 3300053093 Bacteria 9403
431 Ga0500566_0087528 3300053094 Bacteria 1725
432 Ga0500650_0217429 3300053098 Bacteria 866
433 Ga0500556_0004389 3300053104 Bacteria 4018
434 Ga0500595_015254 3300053119 Bacteria 2888
435 Ga0500658_0002671 3300053134 Bacteria 6848
436 Ga0500559_0057717 3300053136 Bacteria 1725
437 Ga0500568_0000205 3300053139 Bacteria 51687
438 Ga0500636_0004048 3300053177 Bacteria 8272
439 Ga0501084_0206887 3300054114 Bacteria 1656
440 Ga0501084_0231516 3300054114 Bacteria 1560
441 Ga0587101_003345 3300059623 Bacteria 1621
442 2509141655 2508501127 Bacteria 7037543
443 2509149366 2508501128 Bacteria 8613869
444 2509392402 2509276021 Bacteria 7634384
445 2509446664 2509276033 Bacteria 7180565
446 2510133596 2510065019 Bacteria 6903379
447 2510894998 2510461076 Bacteria 8618824
448 2513573889 2513237084 Bacteria 7231967
449 2513577567 2513237085 Bacteria 7695351
450 2513629787 2513237093 Bacteria 7545552
451 2513676710 2513237098 Bacteria 9902361
452 2513708427 2513237103 Bacteria 7647401
453 2513871779 2513237138 Bacteria 7368160
454 2513911405 2513237144 Bacteria 7530820
455 2514022439 2513237162 Bacteria 7468464
456 2514589811 2513237351 Bacteria 6968952
457 2515112585 2515075009 Bacteria 7288508
458 2515632936 2515154113 Bacteria 7807172
459 2515640079 2515154114 Bacteria 7848616
460 2515655722 2515154116 Bacteria 7552979
461 2515740175 2515154134 Bacteria 7220242
462 2517036320 2516653077 Bacteria 7555578
463 2517076682 2516653085 Bacteria 7346596
464 2517095455 2517093000 Bacteria 7412387
465 2517407040 2517287029 Bacteria 6905599
466 2524469775 2524023210 Bacteria 9029266
467 2558861898 2558860100 Bacteria 8458965
468 2585147596 2582581279 Bacteria 4980720
469 2585403185 2582581867 Bacteria 7184437
470 2585527077 2585427526 Bacteria 7258840
471 2585537827 2585427528 Bacteria 6842387
472 2585835777 2585427593 Bacteria 7141551
473 2597813409 2597489875 Bacteria 7010078
474 2599414666 2599185170 Bacteria 7295545
475 2600196800 2599185352 Bacteria 7228948
476 2616292247 2615840624 Bacteria 6557588
477 2644674703 2643221723 Bacteria 7095460
478 2719181501 2718217882 Bacteria 6556348
479 2719386009 2718217927 Bacteria 6972593
480 2719665825 2718217997 Bacteria 6740740
481 2719732165 2718218009 Bacteria 6478651
482 2720492245 2718218199 Bacteria 6740745
483 2720613600 2718218232 Bacteria 6720332
484 2720620384 2718218233 Bacteria 6662049
485 2720631806 2718218235 Bacteria 6630699
486 2720775534 2718218269 Bacteria 6906114
487 2721147593 2718218363 Bacteria 6524337
488 2721159039 2718218365 Bacteria 6274507
489 2721164428 2718218366 Bacteria 6425255
490 2721399790 2718218423 Bacteria 6438183
491 2722840598 2721755514 Bacteria 6424414
492 2723027154 2721755556 Bacteria 6745503
493 2723560766 2721755684 Bacteria 6859907
494 2723567353 2721755685 Bacteria 6704835
495 2724038603 2721755809 Bacteria 6438790
496 2724044921 2721755810 Bacteria 6479005
497 2724090141 2721755819 Bacteria 6906405
498 2724104618 2721755822 Bacteria 6726041
499 2724110433 2721755823 Bacteria 6752556
500 2725950563 2724679232 Bacteria 7646494
501 2730108090 2728369352 Bacteria 6745171
502 2730164736 2728369365 Bacteria 6555560
503 2730298671 2728369397 Bacteria 6274511
504 2739032486 2738541333 Bacteria 7106503
505 2753567586 2751185846 Bacteria 7242164
506 2766066839 2765235942 Bacteria 7445910
507 2792641396 2791355094 Bacteria 7011481
508 2793294908 2791355256 Bacteria 6798008
509 2793312493 2791355259 Bacteria 7254731
510 2793323024 2791355260 Bacteria 6598818
511 2793330706 2791355261 Bacteria 6661293
512 2793337235 2791355262 Bacteria 6774204
513 2793344900 2791355263 Bacteria 6872478
514 2793349890 2791355264 Bacteria 6429314
515 2793352827 2791355265 Bacteria 6539969
516 2793360684 2791355266 Bacteria 7116587
517 2793366970 2791355267 Bacteria 7222458
518 2805925928 2802429605 Bacteria 6875453
519 2805937571 2802429606 Bacteria 6346811
520 2806043461 2802429633 Bacteria 7341974
521 2806050605 2802429634 Bacteria 7083200
522 2806057422 2802429635 Bacteria 7650140
523 2806064803 2802429636 Bacteria 7597525
524 2806072070 2802429637 Bacteria 7067217
525 2821444811 2821443989 Bacteria 7658172
526 2838017984 2838016132 Bacteria 6577831
527 2838026190 2838022645 Bacteria 6494267
528 2838042304 2838035591 Bacteria 7166484
529 2838043668 2838042994 Bacteria 6046894
530 2838054798 2838048938 Bacteria 6044578
531 2838068473 2838061910 Bacteria 6794874
532 2838074432 2838068647 Bacteria 6208656
533 2838667891 2838661181 Bacteria 7385261
534 2838673626 2838668709 Bacteria 6671819
535 2838692069 2838686498 Bacteria 7807632
536 2838706022 2838701080 Bacteria 6669771
537 2838732785 2838729681 Bacteria 7400765
538 2838749757 2838742623 Bacteria 7396178
539 2840764886 2840764183 Bacteria 6358399
540 2841855879 2841851746 Bacteria 7532261
541 2841870724 2841864319 Bacteria 6742987
542 2842114110 2842110456 Bacteria 7656360
543 2842150875 2842146304 Bacteria 5957337
544 2842157129 2842156927 Bacteria 6894975
545 2842167789 2842163707 Bacteria 6916235
546 2842181287 2842180545 Bacteria 6888678
547 2842194277 2842192696 Bacteria 6147454
548 2842201877 2842198810 Bacteria 6608673
549 2842205806 2842205361 Bacteria 6340321
550 2842217544 2842217011 Bacteria 7497767
551 2842230662 2842229732 Bacteria 7475766
552 2842245238 2842243621 Bacteria 7421798
553 2842255836 2842250916 Bacteria 6579627
554 2842259051 2842257432 Bacteria 7401195
555 2842265818 2842264693 Bacteria 6472963
556 2842276279 2842271015 Bacteria 7807131
557 2842279263 2842278818 Bacteria 6340002
558 2842285907 2842285085 Bacteria 6011953
559 2842304578 2842304105 Bacteria 7023636
560 2842314472 2842311132 Bacteria 6616990
561 2842323033 2842317721 Bacteria 6793725
562 2842345358 2842341865 Bacteria 7003929
563 2842364806 2842363717 Bacteria 6844742
564 2842398929 2842395702 Bacteria 6780583
565 2842403266 2842402390 Bacteria 6681310
566 2842409361 2842409023 Bacteria 6687331
567 2842416014 2842415677 Bacteria 6596907
568 2842428191 2842422224 Bacteria 6239196
569 2842429545 2842428310 Bacteria 6767288
570 2842436158 2842434925 Bacteria 6502746
571 2842442505 2842441272 Bacteria 6769273
572 2842450808 2842447887 Bacteria 6754142
573 2842463966 2842462802 Bacteria 6588055
574 2842470487 2842469257 Bacteria 6752936
575 2842490258 2842489311 Bacteria 6620893
576 2842495945 2842495871 Bacteria 6820686
577 2842678531 2842677519 Bacteria 5615038
578 2844166171 2844163670 Bacteria 7266046
579 2844458876 2844454524 Bacteria 7952546
580 2856342468 2856342000 Bacteria 7176905
581 2857520001 2857516855 Bacteria 7787325
582 2858950882 2858950400 Bacteria 6783797
583 2874126502 2874123672 Bacteria 7238285
584 2883090237 2883087390 Bacteria 9532701
585 2885195660 2885192300 Bacteria 5882526
586 2885317644 2885312484 Bacteria 6415165
587 2903772371 2903768456 Bacteria 9749579
588 2909047301 2909042592 Bacteria 6499737
589 2919465054 2919462493 Bacteria 5817112
590 2920828053 2920822456 Bacteria 6897201
591 2923561912 2923556063 Bacteria 6793593
592 2932798353 2932794094 Bacteria 7915132
593 2932804149 2932801729 Bacteria 7987968
594 2933571850 2933570622 Bacteria 7023390
595 2933590206 2933586486 Bacteria 7667493
596 2933604888 2933599457 Bacteria 5858799
597 2935884046 2935883170 Bacteria 7964738
598 2935905398 2935901341 Bacteria 7341747
599 2936372429 2936367885 Bacteria 7324495
600 2936376581 2936375103 Bacteria 6652732
601 2936387573 2936381700 Bacteria 7006523
602 2937838316 2937836603 Bacteria 6811263
603 2941502726 2941499720 Bacteria 7599444
604 2958072739 2958071322 Bacteria 6815895
605 2970530653 2970524798 Bacteria 6840927
606 2970544691 2970540015 Bacteria 6977556
607 2977877131 2977872689 Bacteria 7270173
608 2996898491 2996893221 Bacteria 5823108
609 3005415050 3005409236 Bacteria 7188837
610 3005596503 3005594810 Bacteria 8716512
611 3005712573 3005710791 Bacteria 7622528
612 3005719633 3005718088 Bacteria 8283608
613 639648826 639633055 Bacteria 7751309
614 642598867 642555112 Bacteria 8676562
615 8004636019 8004633249 Bacteria 6723080
616 8005280796 8005275841 Bacteria 6929066
617 8005285268 8005282627 Bacteria 6675747
618 8005293319 8005289223 Bacteria 6634003
619 8005302790 8005301065 Bacteria 6614431
620 8005312452 8005307578 Bacteria 7395396
621 8005379496 8005376324 Bacteria 6590079
622 8005385475 8005382845 Bacteria 6732062
623 8005396530 8005395548 Bacteria 6806915
624 8005431686 8005430974 Bacteria 6689030
625 8005463260 8005460587 Bacteria 7157962
626 8005500558 8005497431 Bacteria 6477605
627 8005557414 8005556819 Bacteria 6908598
628 8005568593 8005563573 Bacteria 7153261
629 8005574543 8005570704 Bacteria 6957481
630 8005621937 8005619151 Bacteria 7030230
631 8005627176 8005626139 Bacteria 6534237
632 8005671976 8005668836 Bacteria 6953162
633 8005694811 8005688590 Bacteria 6610080
634 8005699759 8005695170 Bacteria 6912330
635 8018130133 8018127388 Bacteria 7351159
636 8018166499 8018163183 Bacteria 7277977
637 8018178754 8018176218 Bacteria 6896178
638 8019650065 8019648815 Bacteria 10014479
639 8023685097 8023680758 Bacteria 7729763
640 8024483252 8024479707 Bacteria 6954785
641 8024501406 8024501048 Bacteria 6427847
642 8055621145 8055617313 Bacteria 7548464
643 8056376855 8056375014 Bacteria 7006639
644 8056388079 8056382006 Bacteria 6408074
645 8056685116 8056681323 Bacteria 8472857
646 8056969675 8056967851 Bacteria 9038162
647 8057874748 8057874678 Bacteria 7494653
648 Ga0123341_1000013
649 JGI25151J46595_10001546
650 JGI25151J46595_10003074
651 JGI25151J46595_10016131
652 JGI25153J46596_10004881
653 JGI25160J50197_1000005
654 JGI25160J50197_1000879
655 JGI25160J50197_1016142
656 JGI25161J50226_1001978
657 JGI25161J50226_1004441
658 Ga0006562J51391_1028949
659 Ga0055526_1001412
660 Ga0055526_1001916
661 Ga0055526_1002113
662 Ga0055537_1000369
663 Ga0055524_1002450
664 Ga0055524_1030762
665 Ga0055536_1002736
666 Ga0055536_1006992
667 Ga0055534_1000044
668 Ga0055528_1000175
669 Ga0055528_1000269
670 Ga0055528_1000801
671 Ga0055528_1008848
672 Ga0055530_10012997
673 Ga0055540_1000192
674 Ga0055540_1035094
675 Ga0055531_10037896
676 Ga0055543_1000324
677 Ga0055543_1006342
678 Ga0065165_1000002
679 Ga0065165_1026156
680 Ga0065165_1027360
681 Ga0065714_10065424
682 Ga0070691_10017967
683 Ga0070659_100065667
684 Ga0070709_10021133
685 Ga0070714_100052883
686 Ga0070714_100087697
687 Ga0070701_10012359
688 Ga0070705_100000079
689 Ga0070700_100017375
690 Ga0070662_100031568
691 Ga0070681_10045659
692 Ga0070685_10077737
693 Ga0070707_100054109
694 Ga0070698_100031007
695 Ga0070695_100000380
696 Ga0070696_100000425
697 Ga0070665_100304300
698 Ga0068855_100417224
699 Ga0068857_100029877
700 Ga0070702_100088864
701 Ga0068852_100834043
702 Ga0068859_100070495
703 Ga0068861_100325073
704 Ga0068861_100482742
705 Ga0068858_100127983
706 Ga0081540_1028224
707 Ga0081539_10000444
708 Ga0070717_10013471
709 Ga0075365_10002482
710 Ga0075368_10007782
711 Ga0075368_10070598
712 Ga0075363_100008129
713 Ga0075363_100009405
714 Ga0075363_100020786
715 Ga0075363_100238706
716 Ga0075364_10001378
717 Ga0075364_10135576
718 Ga0070712_100012063
719 Ga0075362_10000537
720 Ga0075362_10022348
721 Ga0075367_10003052
722 Ga0075367_10005945
723 Ga0075367_10049609
724 Ga0075367_10070752
725 Ga0075369_10002735
726 Ga0075366_10000974
727 Ga0075366_10077806
728 Ga0097621_100057148
729 Ga0075370_10002169
730 Ga0075370_10034671
731 Ga0075370_10046996
732 Ga0068871_100475644
733 Ga0075428_100100763
734 Ga0075428_100625862
735 Ga0075430_100015606
736 Ga0075430_100032484
737 Ga0075431_100009169
738 Ga0075431_100051761
739 Ga0075431_100085720
740 Ga0075431_100237892
741 Ga0075433_10184261
742 Ga0075434_100128951
743 Ga0075436_100014203
744 Ga0097620_100070494
745 Ga0099825_1027163
746 Ga0099824_1008495
747 Ga0099822_1013304
748 Ga0079104_1016961
749 Ga0099826_10001431
750 Ga0075435_100053969
751 Ga0075435_100116554
752 Ga0105240_10012018
753 Ga0105240_10378179
754 Ga0114129_10172476
755 Ga0114129_10381802
756 Ga0105241_10254760
757 Ga0105242_10078243
758 Ga0105248_10043201
759 Ga0105237_10081785
760 Ga0105237_10329964
761 Ga0123342_1040019
762 Ga0099796_10002227
763 Ga0105239_10010843
764 Ga0105239_10026693
765 Ga0105239_10052716
766 Ga0105239_10389707
767 Ga0105239_10423576
768 Ga0105239_10999789
769 Ga0157373_10015240
770 Ga0163163_10062269
771 Ga0182008_10017339
772 Ga0157379_10131922
773 Ga0182007_10001637
774 Ga0182005_1061490
775 Ga0183363_1072
776 Ga0163161_10037465
777 Ga0163161_10206211
778 Ga0214542_1017604
779 Ga0214543_1000018
780 Ga0213875_10000935
781 Ga0224572_1001023
782 Ga0228598_1000041
783 Ga0209436_100162
784 Ga0207425_1004352
785 Ga0209148_1000037
786 Ga0209129_1000771
787 Ga0209565_1000039
788 Ga0209455_1000036
789 Ga0209673_1000013
790 Ga0209673_1000146
791 Ga0209673_1000325
792 Ga0209673_1001202
793 Ga0209673_1003962
794 Ga0209673_1004764
795 Ga0209130_1000010
796 Ga0209130_1001943
797 Ga0209675_1000030
798 Ga0209676_1001612
799 Ga0209025_1000534
800 Ga0209025_1001166
801 Ga0209025_1044413
802 Ga0209564_1000264
803 Ga0209564_1000473
804 Ga0209564_1001458
805 Ga0209758_1002424
806 Ga0209758_1002732
807 Ga0209758_1021304
808 Ga0209050_1005318
809 Ga0209256_1000245
810 Ga0209256_1000369
811 Ga0209256_1003331
812 Ga0207426_1000036
813 Ga0207426_1000039
814 Ga0207426_1004254
815 Ga0209051_1000253
816 Ga0209051_1001000
817 Ga0209051_1004287
818 Ga0209257_1002124
819 Ga0209257_1002174
820 Ga0207647_10057971
821 Ga0207647_10166069
822 Ga0207705_10135921
823 Ga0207654_10104890
824 Ga0207707_10064452
825 Ga0207707_10130705
826 Ga0207695_10009269
827 Ga0207695_10225033
828 Ga0207693_10004440
829 Ga0207652_10224722
830 Ga0207646_10118854
831 Ga0207694_10108647
832 Ga0207664_10076908
833 Ga0207690_10029561
834 Ga0207706_10027974
835 Ga0207686_10132535
836 Ga0207669_10175823
837 Ga0207691_10059778
838 Ga0207711_10024664
839 Ga0207661_10452307
840 Ga0207667_10163358
841 Ga0207640_10478058
842 Ga0207703_10096887
843 Ga0207639_10079660
844 Ga0207678_10421090
845 Ga0207674_10541377
846 Ga0207675_100100763
847 Ga0207683_10046502
848 Ga0209589_1000001
849 Ga0209489_100001
850 Ga0209700_100001
851 Ga0209282_1012610
852 Ga0209813_10017412
853 Ga0209813_10056096
854 Ga0307515_10082850
855 Ga0307511_10061864
856 Ga0316176_1140230
857 Ga0314311_1034637
858 Ga0316178_1014198
859 Ga0316180_1096139
860 Ga0316183_1198096
861 Ga0265340_10082656
862 Ga0307516_10125575
863 Ga0307410_10216842
864 Ga0307412_10099604
865 Ga0307412_10125511
866 Ga0307412_10188750
867 Ga0307412_10303338
868 Ga0307409_100580835
869 Ga0307409_100926540
870 Ga0307416_100017075
871 Ga0307414_10017846
872 Ga0307411_10201290
873 Ga0307411_10526205
874 Ga0307507_10040471
875 Ga0307507_10130146
876 Ga0373943_0023748
877 Ga0373946_0027093
878 Ga0373935_0056492
879 Ga0373935_0082763
880 Ga0373927_0025557
881 Ga0373927_0051139
882 Ga0373937_0114014
883 Ga0373925_0001247
884 Ga0373925_0137337
885 Ga0395899_0006774
886 Ga0395900_0229005
887 Ga0395898_0090669
888 Ga0395898_0263943
889 Ga0395905_0000017
890 Ga0436364_0838310
891 Ga0395901_0279056
892 Ga0436360_0430836
893 Ga0436361_0122568
894 Ga0436363_0416503
895 Ga0439436_0034310
896 Ga0439436_0046417
897 Ga0439465_0003131
898 Ga0451793_0446925
899 Ga0451798_0284410
900 Ga0451835_0043983
901 Ga0451837_0861550
902 Ga0451841_0595127
903 Ga0451847_0393698
904 Ga0451851_0019019
905 Ga0451853_1819537
906 Ga0439445_0084393
907 Ga0439432_003954
908 Ga0439449_0013213
909 Ga0450896_001581
910 Ga0450908_000341
911 Ga0450918_000211
912 Ga0466966_0002487
913 Ga0466961_0000081
914 Ga0466963_0121735
915 Ga0466964_0129745
916 Ga0466970_0305838
917 Ga0466957_0090186
918 Ga0466959_0125080
919 Ga0466967_0424355
920 Ga0495629_0047870
921 Ga0495638_0082547
922 Ga0495651_0003650
923 Ga0495653_0057422
924 Ga0495653_0087548
925 Ga0495580_0170031
926 Ga0495605_0065117
927 Ga0495639_0001912
928 Ga0495662_0012048
929 Ga0495662_0196590
930 Ga0495664_0001054
931 Ga0495664_0016951
932 Ga0495585_0063684
933 Ga0495596_0065572
934 Ga0495608_0067924
935 Ga0495608_0068135
936 Ga0495610_0033331
937 Ga0495618_0084114
938 Ga0495628_0008616
939 Ga0495628_0142173
940 Ga0495630_0018994
941 Ga0495637_0091506
942 Ga0495648_0063919
943 Ga0495648_0079339
944 Ga0495666_0083834
945 Ga0495652_0021740
946 Ga0495652_0065611
947 Ga0495654_0169572
948 Ga0495665_0056410
949 Ga0495640_0080553
950 Ga0495587_0033155
951 Ga0495587_0059856
952 Ga0495597_0027694
953 Ga0495645_0002549
954 Ga0495645_0012442
955 Ga0495633_0032691
956 Ga0495667_0021678
957 Ga0495667_0062588
958 Ga0495656_0001532
959 Ga0495634_0017423
960 Ga0495634_0036534
961 Ga0495611_0017259
962 Ga0495625_0000052
963 Ga0495625_0037865
964 Ga0495625_0060852
965 Ga0495625_0100603
966 Ga0495635_0011793
967 Ga0495635_0027868
968 Ga0495661_0035454
969 Ga0495661_0077054
970 Ga0495588_0001503
971 Ga0495657_0016350
972 Ga0495657_0018110
973 Ga0495657_0036331
974 Ga0495599_0005248
975 Ga0495599_0019861
976 Ga0495646_0042053
977 Ga0495646_0056965
978 Ga0495646_0259379
979 Ga0495613_0028020
980 Ga0495613_0091919
981 Ga0495624_0015047
982 Ga0495649_0006830
983 Ga0495600_0005446
984 Ga0495600_0049519
985 Ga0495660_0015697
986 Ga0495604_0003777
987 Ga0495604_0016956
988 Ga0495674_0031347
989 Ga0495674_0182578
990 Ga0495672_0020134
991 Ga0495676_0062972
992 Ga0495680_0043439
993 Ga0495687_007286
994 Ga0495675_0100549
995 Ga0495675_0290095
996 Ga0495679_015719
997 Ga0495681_0038201
998 Ga0495684_0389056
999 Ga0495686_0021410
1000 Ga0495686_0072945
1001 Ga0495593_0021553
1002 Ga0495602_0029168
1003 Ga0495602_0190339
1004 Ga0496100_0001473
1005 Ga0496101_0024641
1006 Ga0496102_0002386
1007 Ga0496102_0038016
1008 Ga0496104_0016340
1009 Ga0496104_0030085
1010 Ga0496105_0000649
1011 Ga0496105_0003866
1012 Ga0496105_0307746
1013 Ga0496106_0000298
1014 Ga0496106_0001140
1015 Ga0496106_0135520
1016 Ga0496107_0086733
1017 Ga0496108_0122490
1018 Ga0496109_0145240
1019 Ga0496109_0306938
1020 Ga0496109_0312476
1021 Ga0496110_0032013
1022 Ga0496111_0048660
1023 Ga0496114_0098737
1024 Ga0496115_0033160
1025 Ga0496115_0175866
1026 Ga0496117_0000939
1027 Ga0496117_0011684
1028 Ga0496118_0001769
1029 Ga0496118_0003337
1030 Ga0496118_0010658
1031 Ga0496118_0082496
1032 Ga0496119_0013564
1033 Ga0496120_0021302
1034 Ga0496121_0000668
1035 Ga0496121_0007858
1036 Ga0496121_0106532
1037 Ga0496121_0406222
1038 Ga0496124_0003401
1039 Ga0496124_0147643
1040 Ga0496126_0006242
1041 Ga0496126_0018073
1042 Ga0496126_0084081
1043 Ga0496126_0324382
1044 Ga0501076_0567385
1045 Ga0501079_0324061
1046 Ga0501044_0659112
1047 nmdc:mga03683_27341_c1
1048 nmdc:mga03683_33832_c1
1049 nmdc:mga03n38_17798_c1
1050 nmdc:mga03n38_58687_c1
1051 nmdc:mga0yw44_11147_c1
1052 nmdc:mga0yw44_17487_c1
1053 nmdc:mga0k408_11233_c1
1054 nmdc:mga0k408_267910_c1
1055 nmdc:mga06z11_15600_c2
1056 nmdc:mga06z11_276082_c1
1057 nmdc:mga06z11_405871_c1
1058 nmdc:mga04h51_20610_c1
1059 nmdc:mga07m45_11528_c1
1060 nmdc:mga07m45_9175_c1
1061 nmdc:mga07m45_9404_c1
1062 nmdc:mga05p37_142895_c1
1063 nmdc:mga09592_54565_c1
1064 nmdc:mga0qj67_13985_c1
1065 nmdc:mga0qj67_547527_c1
1066 nmdc:mga06r32_26094_c1
1067 nmdc:mga06r32_5610_c1
1068 nmdc:mga06r32_91699_c1
1069 nmdc:mga0n895_26135_c1
1070 nmdc:mga0rr50_32950_c1
1071 nmdc:mga0rr50_46252_c1
1072 nmdc:mga08x19_28688_c1
1073 nmdc:mga0a205_38507_c1
1074 nmdc:mga0sz30_6761_c1
1075 Ga0495655_0070867
1076 Ga0500651_0000009
1077 Ga0500651_0002750
1078 Ga0500566_0087528
1079 Ga0500650_0217429
1080 Ga0500556_0004389
1081 Ga0500595_015254
1082 Ga0500658_0002671
1083 Ga0500559_0057717
1084 Ga0500568_0000205
1085 Ga0500636_0004048
1086 Ga0501084_0206887
1087 Ga0501084_0231516
1088 Ga0587101_003345
1089 2509141655
1090 2509149366
1091 2509392402
1092 2509446664
1093 2510133596
1094 2510894998
1095 2513573889
1096 2513577567
1097 2513629787
1098 2513676710
1099 2513708427
1100 2513871779
1101 2513911405
1102 2514022439
1103 2514589811
1104 2515112585
1105 2515632936
1106 2515640079
1107 2515655722
1108 2515740175
1109 2517036320
1110 2517076682
1111 2517095455
1112 2517407040
1113 2524469775
1114 2558861898
1115 2585147596
1116 2585403185
1117 2585527077
1118 2585537827
1119 2585835777
1120 2597813409
1121 2599414666
1122 2600196800
1123 2616292247
1124 2644674703
1125 2719181501
1126 2719386009
1127 2719665825
1128 2719732165
1129 2720492245
1130 2720613600
1131 2720620384
1132 2720631806
1133 2720775534
1134 2721147593
1135 2721159039
1136 2721164428
1137 2721399790
1138 2722840598
1139 2723027154
1140 2723560766
1141 2723567353
1142 2724038603
1143 2724044921
1144 2724090141
1145 2724104618
1146 2724110433
1147 2725950563
1148 2730108090
1149 2730164736
1150 2730298671
1151 2739032486
1152 2753567586
1153 2766066839
1154 2792641396
1155 2793294908
1156 2793312493
1157 2793323024
1158 2793330706
1159 2793337235
1160 2793344900
1161 2793349890
1162 2793352827
1163 2793360684
1164 2793366970
1165 2805925928
1166 2805937571
1167 2806043461
1168 2806050605
1169 2806057422
1170 2806064803
1171 2806072070
1172 2821444811
1173 2838017984
1174 2838026190
1175 2838042304
1176 2838043668
1177 2838054798
1178 2838068473
1179 2838074432
1180 2838667891
1181 2838673626
1182 2838692069
1183 2838706022
1184 2838732785
1185 2838749757
1186 2840764886
1187 2841855879
1188 2841870724
1189 2842114110
1190 2842150875
1191 2842157129
1192 2842167789
1193 2842181287
1194 2842194277
1195 2842201877
1196 2842205806
1197 2842217544
1198 2842230662
1199 2842245238
1200 2842255836
1201 2842259051
1202 2842265818
1203 2842276279
1204 2842279263
1205 2842285907
1206 2842304578
1207 2842314472
1208 2842323033
1209 2842345358
1210 2842364806
1211 2842398929
1212 2842403266
1213 2842409361
1214 2842416014
1215 2842428191
1216 2842429545
1217 2842436158
1218 2842442505
1219 2842450808
1220 2842463966
1221 2842470487
1222 2842490258
1223 2842495945
1224 2842678531
1225 2844166171
1226 2844458876
1227 2856342468
1228 2857520001
1229 2858950882
1230 2874126502
1231 2883090237
1232 2885195660
1233 2885317644
1234 2903772371
1235 2909047301
1236 2919465054
1237 2920828053
1238 2923561912
1239 2932798353
1240 2932804149
1241 2933571850
1242 2933590206
1243 2933604888
1244 2935884046
1245 2935905398
1246 2936372429
1247 2936376581
1248 2936387573
1249 2937838316
1250 2941502726
1251 2958072739
1252 2970530653
1253 2970544691
1254 2977877131
1255 2996898491
1256 3005415050
1257 3005596503
1258 3005712573
1259 3005719633
1260 639648826
1261 642598867
1262 8004636019
1263 8005280796
1264 8005285268
1265 8005293319
1266 8005302790
1267 8005312452
1268 8005379496
1269 8005385475
1270 8005396530
1271 8005431686
1272 8005463260
1273 8005500558
1274 8005557414
1275 8005568593
1276 8005574543
1277 8005621937
1278 8005627176
1279 8005671976
1280 8005694811
1281 8005699759
1282 8018130133
1283 8018166499
1284 8018178754
1285 8019650065
1286 8023685097
1287 8024483252
1288 8024501406
1289 8055621145
1290 8056376855
1291 8056388079
1292 8056685116
1293 8056969675
1294 8057874748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

13

232

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kcm-assembly1.cif.gz_A the crystal structure of thioredoxin protein from geobacter metallireducens 0.7039 59 184
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.7028 53 187
5um7-assembly2.cif.gz_B crystal structure of the reduced state of the thiol-disulfide reductase sdba from streptococcus gordonii 0.6731 61 192
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.6507 53 187
2h1b-assembly2.cif.gz_B resa e80q 0.6464 54 203
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.724 60 185 3.40.30.10
3kcmB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6969 59 201 3.40.30.10
af_A4I174_5_200_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6808 114 154 3.40.50.1000
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6666 63 158 3.40.30.10
3erwA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6606 56 193 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1X2FAW9-F1-model_v4 DUF899 domain-containing protein 0.9088 14 234
AF-A0A1X2FAW9-F1-model_v4 DUF899 domain-containing protein 0.9049 14 234
AF-A0A4R4WCJ1-F1-model_v4 DUF899 domain-containing protein 0.9032 13 234
AF-A0A5N0V0U4-F1-model_v4 DUF899 domain-containing protein 0.9013 14 253
AF-A0A7W1J4Q3-F1-model_v4 DUF899 domain-containing protein 0.9005 14 234

Map