F472322

General Info

Members Datasets Scaffolds Average Seq Length
647 321 630 758

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0010411|Ga0501034_0010411_6645_9086
Length 813
Sequence MRVPGSMAAASAICRPVRHARRGRLVTLVASRRLHSLILPEEATMNEAAHALPDDDAELSPWWLRTVAIVLVVGFAGLLAITSLAYRNAPPIPARVVDAQGALLFSGDDVRAGQAVFLRYGLMDNGSIWGHGAYLGPDYSAEALHRLGEDTAAAIAGSQYGKSMDELDAQHQAAVRAETAVVLKTNRYDVQTGVLQLTEAEAAAYRQQIGYWTDYFKDPTKNGGLRPGLISDPAELHQFTAFVTWAAWASVATRPGTDASYTNNFPYDPSVGNVPTGSALLWSALSLLVLLAGIATVLLAFGKFDYLGWISRGHHVHPQLLPGQAGAGQRALMKFFVVVALLFLMQTLVGGGVAHFRADPGSFYGFQLENIFPSNLLRTWHLQTAIFWIATAYVAAALFLGRSLRAPDDEPRWLSGWVHLLFAAFVVVIGGSLLGVWAGIEQKLGNLWFWFGDQGWEYLELGRAWQYLLVVGLLVWFAILWVLARPRAVANEAARPLARMFMFAAVAIPVFYVPAVFFGAETNYTVVDTWRFWIIHLWVEGFFEFFATTVVALTFYQLGLTRRNVALRVIYLDAILYFLGGLIGTGHHWYFTGHTNFNMALSALFSVLEVVPLTLLTLDAWDFVRTTRGDCAVCGKAVKVPHKWTFYFLMAVGFWNFVGAGMFGFFLNLPIVSYYEVGTQVTPTHGHAALMGVFGMLAIALMVFCLRQVSSDARWPGIEKYVKFAFWGTNIGLMLMILMSLFPSGVMQLWDVVEHGYWHARSVEYMATSRSHLVEWLRLPGDLIFIIFGAIPLLIASVKGWLGVRADARAQAR

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
8 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
9 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
10 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
11 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
12 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
13 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
14 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
15 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
16 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
17 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
318 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 0.15
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0.15
Rhizoplane 4.33
Rhizosphere 88.87
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000979 3300001904 Bacteria 5257
2 JGI24740J21852_10000027 3300001979 Bacteria 48883
3 JGI24740J21852_10000067 3300001979 Bacteria 34146
4 JGI24737J22298_10008703 3300001990 Bacteria 3392
5 JGI24735J21928_10000290 3300002067 Bacteria 17505
6 JGI24034J26672_10000065 3300002239 Bacteria 37437
7 JGI25407J50210_10001083 3300003373 Bacteria 5993
8 Ga0055531_10000052 3300003794 Bacteria 125395
9 Ga0065704_10080853 3300005289 Bacteria 3868
10 Ga0065707_10002102 3300005295 Bacteria 5026
11 Ga0065707_10081984 3300005295 Bacteria 26228
12 Ga0070658_10000088 3300005327 Bacteria 85441
13 Ga0070658_10019021 3300005327 Bacteria 5502
14 Ga0070658_10041659 3300005327 Bacteria 3705
15 Ga0070658_10051938 3300005327 Bacteria 3323
16 Ga0070683_100017433 3300005329 Bacteria 6348
17 Ga0070683_100038094 3300005329 Bacteria 4404
18 Ga0070680_100000220 3300005336 Bacteria 37754
19 Ga0070680_100026632 3300005336 Bacteria 4624
20 Ga0070682_100002070 3300005337 Bacteria 11164
21 Ga0068868_100020752 3300005338 Bacteria 4942
22 Ga0070660_100006725 3300005339 Bacteria 7976
23 Ga0070660_100019147 3300005339 Bacteria 5011
24 Ga0070660_100033687 3300005339 Bacteria 3863
25 Ga0070689_100009969 3300005340 Bacteria 6759
26 Ga0070661_100000034 3300005344 Bacteria 111603
27 Ga0070661_100000442 3300005344 Bacteria 31824
28 Ga0070661_100016691 3300005344 Bacteria 5195
29 Ga0070675_100013247 3300005354 Bacteria 6480
30 Ga0070673_100002604 3300005364 Bacteria 11025
31 Ga0070688_100006583 3300005365 Bacteria 6217
32 Ga0070659_100009381 3300005366 Bacteria 7187
33 Ga0070659_100018001 3300005366 Bacteria 5326
34 Ga0070659_100022698 3300005366 Bacteria 4793
35 Ga0070659_100024433 3300005366 Bacteria 4633
36 Ga0070659_100037459 3300005366 Bacteria 3781
37 Ga0070703_10002775 3300005406 Bacteria 5021
38 Ga0070709_10007885 3300005434 Bacteria 5848
39 Ga0070714_100000872 3300005435 Bacteria 21399
40 Ga0070714_100014518 3300005435 Bacteria 6330
41 Ga0070714_100028495 3300005435 Bacteria 4635
42 Ga0070714_100039317 3300005435 Bacteria 3982
43 Ga0070713_100037706 3300005436 Bacteria 3909
44 Ga0070705_100001456 3300005440 Bacteria 12510
45 Ga0070700_100005940 3300005441 Bacteria 6487
46 Ga0070700_100013333 3300005441 Bacteria 4616
47 Ga0070694_100014518 3300005444 Bacteria 4932
48 Ga0070708_100002244 3300005445 Bacteria 14935
49 Ga0070708_100011559 3300005445 Bacteria 7187
50 Ga0070663_100018991 3300005455 Bacteria 4520
51 Ga0070663_100030270 3300005455 Bacteria 3707
52 Ga0070662_100036457 3300005457 Bacteria 3479
53 Ga0070681_10000099 3300005458 Bacteria 64409
54 Ga0070681_10006936 3300005458 Bacteria 11026
55 Ga0070681_10014204 3300005458 Bacteria 7924
56 Ga0070681_10023219 3300005458 Bacteria 6237
57 Ga0070681_10025967 3300005458 Bacteria 5889
58 Ga0070681_10031227 3300005458 Bacteria 5346
59 Ga0070681_10064082 3300005458 Bacteria 3647
60 Ga0070681_10088473 3300005458 Bacteria 3049
61 Ga0070685_10002004 3300005466 Bacteria 10557
62 Ga0070706_100001656 3300005467 Bacteria 23195
63 Ga0070706_100006706 3300005467 Bacteria 10868
64 Ga0070707_100001104 3300005468 Bacteria 26642
65 Ga0070707_100041218 3300005468 Bacteria 4418
66 Ga0070698_100004102 3300005471 Bacteria 16003
67 Ga0070699_100001129 3300005518 Bacteria 24878
68 Ga0070699_100006903 3300005518 Bacteria 9872
69 Ga0070699_100009102 3300005518 Bacteria 8609
70 Ga0070699_100026887 3300005518 Unclassified 4963
71 Ga0070679_100003375 3300005530 Bacteria 14634
72 Ga0070679_100004764 3300005530 Bacteria 12511
73 Ga0070679_100025625 3300005530 Bacteria 5788
74 Ga0070679_100106657 3300005530 Bacteria 2787
75 Ga0070679_100107445 3300005530 Bacteria 2776
76 Ga0070679_100133524 3300005530 Bacteria 2463
77 Ga0070684_100006299 3300005535 Bacteria 9169
78 Ga0070697_100001122 3300005536 Bacteria 20239
79 Ga0070697_100001484 3300005536 Bacteria 17845
80 Ga0070697_100003818 3300005536 Bacteria 11569
81 Ga0068853_100019193 3300005539 Bacteria 5666
82 Ga0068853_100019581 3300005539 Bacteria 5614
83 Ga0068853_100047802 3300005539 Bacteria 3672
84 Ga0068853_100058872 3300005539 Bacteria 3317
85 Ga0068853_100059051 3300005539 Bacteria 3313
86 Ga0070695_100001346 3300005545 Bacteria 13619
87 Ga0070695_100009252 3300005545 Bacteria 5856
88 Ga0070696_100001810 3300005546 Bacteria 14033
89 Ga0070696_100002232 3300005546 Bacteria 12773
90 Ga0070696_100004515 3300005546 Bacteria 9289
91 Ga0070696_100015156 3300005546 Bacteria 5175
92 Ga0070693_100000295 3300005547 Bacteria 23286
93 Ga0070693_100006307 3300005547 Bacteria 5747
94 Ga0070665_100000005 3300005548 Bacteria 734905
95 Ga0070704_100002299 3300005549 Bacteria 10686
96 Ga0070704_100007594 3300005549 Bacteria 6462
97 Ga0068855_100000173 3300005563 Bacteria 82962
98 Ga0068855_100001151 3300005563 Bacteria 32758
99 Ga0068855_100001853 3300005563 Bacteria 26289
100 Ga0068855_100007890 3300005563 Bacteria 12856
101 Ga0068855_100012611 3300005563 Bacteria 10200
102 Ga0068855_100016025 3300005563 Bacteria 9016
103 Ga0068855_100027713 3300005563 Bacteria 6779
104 Ga0068855_100093402 3300005563 Bacteria 3469
105 Ga0070664_100014276 3300005564 Bacteria 6479
106 Ga0070664_100024230 3300005564 Bacteria 5019
107 Ga0068857_100000037 3300005577 Bacteria 72271
108 Ga0068857_100001129 3300005577 Bacteria 20819
109 Ga0068857_100015767 3300005577 Bacteria 6612
110 Ga0068857_100023534 3300005577 Bacteria 5422
111 Ga0068857_100036623 3300005577 Bacteria 4347
112 Ga0068857_100039091 3300005577 Bacteria 4202
113 Ga0068857_100050763 3300005577 Bacteria 3679
114 Ga0068854_100000155 3300005578 Bacteria 46783
115 Ga0068854_100000264 3300005578 Bacteria 35701
116 Ga0068854_100020179 3300005578 Bacteria 4503
117 Ga0068854_100041686 3300005578 Bacteria 3245
118 Ga0068856_100001573 3300005614 Bacteria 23906
119 Ga0068856_100004257 3300005614 Bacteria 14293
120 Ga0068856_100006583 3300005614 Bacteria 11387
121 Ga0068856_100011636 3300005614 Bacteria 8534
122 Ga0068856_100025033 3300005614 Bacteria 5817
123 Ga0068856_100027971 3300005614 Bacteria 5501
124 Ga0068856_100081964 3300005614 Bacteria 3201
125 Ga0070702_100004472 3300005615 Bacteria 6386
126 Ga0070702_100028732 3300005615 Bacteria 3016
127 Ga0068852_100000060 3300005616 Bacteria 73764
128 Ga0068852_100003542 3300005616 Bacteria 10920
129 Ga0068852_100011081 3300005616 Bacteria 6769
130 Ga0068852_100044193 3300005616 Bacteria 3782
131 Ga0068864_100019452 3300005618 Bacteria 5677
132 Ga0068864_100078069 3300005618 Bacteria 2897
133 Ga0068863_100088822 3300005841 Bacteria 2930
134 Ga0068858_100021855 3300005842 Bacteria 5975
135 Ga0068858_100048810 3300005842 Bacteria 3921
136 Ga0068860_100026137 3300005843 Bacteria 5630
137 Ga0068860_100108581 3300005843 Bacteria 2652
138 Ga0068862_100021617 3300005844 Bacteria 5380
139 Ga0081455_10000836 3300005937 Bacteria 39643
140 Ga0081455_10023949 3300005937 Bacteria 5667
141 Ga0081455_10029734 3300005937 Bacteria 4976
142 Ga0081455_10054930 3300005937 Bacteria 3390
143 Ga0081538_10003168 3300005981 Bacteria 15644
144 Ga0081538_10005079 3300005981 Bacteria 11955
145 Ga0081538_10016936 3300005981 Bacteria 5559
146 Ga0081540_1000014 3300005983 Bacteria 179266
147 Ga0081539_10002861 3300005985 Bacteria 22951
148 Ga0070717_10004535 3300006028 Bacteria 10041
149 Ga0075365_10000297 3300006038 Bacteria 17279
150 Ga0075365_10013792 3300006038 Bacteria 4848
151 Ga0075365_10015500 3300006038 Bacteria 4613
152 Ga0075364_10003478 3300006051 Bacteria 8964
153 Ga0075364_10028827 3300006051 Bacteria 3556
154 Ga0070716_100029671 3300006173 Bacteria 2960
155 Ga0070712_100013453 3300006175 Bacteria 5230
156 Ga0070712_100022276 3300006175 Bacteria 4171
157 Ga0075366_10012767 3300006195 Bacteria 4772
158 Ga0097621_100005320 3300006237 Bacteria 9065
159 Ga0097621_100056628 3300006237 Bacteria 3203
160 Ga0097621_100086773 3300006237 Bacteria 2612
161 Ga0075428_100005809 3300006844 Bacteria 13706
162 Ga0075428_100041964 3300006844 Bacteria 5031
163 Ga0075428_100087943 3300006844 Bacteria 3389
164 Ga0075430_100002488 3300006846 Bacteria 15350
165 Ga0075430_100003638 3300006846 Bacteria 12933
166 Ga0075430_100005138 3300006846 Bacteria 11017
167 Ga0075430_100005816 3300006846 Bacteria 10403
168 Ga0075431_100001497 3300006847 Bacteria 21629
169 Ga0075431_100006457 3300006847 Bacteria 11643
170 Ga0075434_100000294 3300006871 Bacteria 35398
171 Ga0075429_100078001 3300006880 Bacteria 2887
172 Ga0068865_100009469 3300006881 Bacteria 6043
173 Ga0068865_100014504 3300006881 Bacteria 5008
174 Ga0075436_100003333 3300006914 Bacteria 10996
175 Ga0075435_100024294 3300007076 Bacteria 4701
176 Ga0075435_100047496 3300007076 Bacteria 3447
177 Ga0105251_10000071 3300009011 Bacteria 97636
178 Ga0105240_10001752 3300009093 Bacteria 36654
179 Ga0105240_10006835 3300009093 Bacteria 16685
180 Ga0105240_10009341 3300009093 Bacteria 13898
181 Ga0105240_10012786 3300009093 Bacteria 11566
182 Ga0105240_10016140 3300009093 Bacteria 10121
183 Ga0105240_10021976 3300009093 Bacteria 8474
184 Ga0105240_10046551 3300009093 Bacteria 5495
185 Ga0105240_10054859 3300009093 Bacteria 4992
186 Ga0105240_10068000 3300009093 Bacteria 4414
187 Ga0105240_10068849 3300009093 Bacteria 4383
188 Ga0105240_10138630 3300009093 Bacteria 2910
189 Ga0111539_10003257 3300009094 Bacteria 21461
190 Ga0111539_10006023 3300009094 Bacteria 15666
191 Ga0111539_10029566 3300009094 Bacteria 6671
192 Ga0111539_10034113 3300009094 Bacteria 6174
193 Ga0111539_10042459 3300009094 Bacteria 5460
194 Ga0105245_10000316 3300009098 Bacteria 45965
195 Ga0105245_10005760 3300009098 Bacteria 10874
196 Ga0105245_10005955 3300009098 Bacteria 10711
197 Ga0105245_10037843 3300009098 Bacteria 4289
198 Ga0105245_10040689 3300009098 Bacteria 4142
199 Ga0105245_10073375 3300009098 Bacteria 3111
200 Ga0114129_10001564 3300009147 Bacteria 31070
201 Ga0114129_10002027 3300009147 Bacteria 27758
202 Ga0114129_10065801 3300009147 Bacteria 5058
203 Ga0105241_10000844 3300009174 Bacteria 23215
204 Ga0105241_10002240 3300009174 Bacteria 14541
205 Ga0105241_10028095 3300009174 Bacteria 4189
206 Ga0105241_10054050 3300009174 Bacteria 3073
207 Ga0105242_10004057 3300009176 Bacteria 11378
208 Ga0105242_10047060 3300009176 Bacteria 3501
209 Ga0105242_10056419 3300009176 Bacteria 3214
210 Ga0105237_10000378 3300009545 Bacteria 63407
211 Ga0105237_10002481 3300009545 Bacteria 22895
212 Ga0105237_10002758 3300009545 Bacteria 21357
213 Ga0105237_10005799 3300009545 Bacteria 13859
214 Ga0105237_10012837 3300009545 Bacteria 8808
215 Ga0105237_10022252 3300009545 Bacteria 6504
216 Ga0105237_10027552 3300009545 Bacteria 5798
217 Ga0105237_10043839 3300009545 Bacteria 4504
218 Ga0105237_10081267 3300009545 Unclassified 3231
219 Ga0105238_10003191 3300009551 Bacteria 16361
220 Ga0105238_10011466 3300009551 Bacteria 8926
221 Ga0105238_10040502 3300009551 Bacteria 4720
222 Ga0105238_10052291 3300009551 Bacteria 4106
223 Ga0105249_10009340 3300009553 Bacteria 8579
224 Ga0105249_10016569 3300009553 Bacteria 6540
225 Ga0105239_10000232 3300010375 Bacteria 82037
226 Ga0105239_10013523 3300010375 Bacteria 9060
227 Ga0105239_10030485 3300010375 Bacteria 5929
228 Ga0157373_10004598 3300013100 Bacteria 10377
229 Ga0157373_10004623 3300013100 Bacteria 10357
230 Ga0157373_10011109 3300013100 Bacteria 6628
231 Ga0157373_10026043 3300013100 Bacteria 4227
232 Ga0157371_10010207 3300013102 Bacteria 7335
233 Ga0157371_10010752 3300013102 Bacteria 7108
234 Ga0157371_10018158 3300013102 Bacteria 5208
235 Ga0157370_10001010 3300013104 Bacteria 35540
236 Ga0157370_10004714 3300013104 Bacteria 15541
237 Ga0157370_10007614 3300013104 Bacteria 11762
238 Ga0157370_10007936 3300013104 Bacteria 11494
239 Ga0157370_10008065 3300013104 Bacteria 11403
240 Ga0157370_10028669 3300013104 Bacteria 5473
241 Ga0157370_10035733 3300013104 Bacteria 4827
242 Ga0157370_10036401 3300013104 Bacteria 4776
243 Ga0157370_10044230 3300013104 Bacteria 4281
244 Ga0157369_10000191 3300013105 Bacteria 84979
245 Ga0157369_10026883 3300013105 Bacteria 6381
246 Ga0157369_10030326 3300013105 Bacteria 5965
247 Ga0157369_10058846 3300013105 Bacteria 4144
248 Ga0157369_10069526 3300013105 Bacteria 3783
249 Ga0157369_10102941 3300013105 Bacteria 3041
250 Ga0157374_10007726 3300013296 Bacteria 9179
251 Ga0157374_10056534 3300013296 Bacteria 3663
252 Ga0157378_10035214 3300013297 Bacteria 4428
253 Ga0163162_10030588 3300013306 Bacteria 5335
254 Ga0157372_10001074 3300013307 Bacteria 29813
255 Ga0157372_10003085 3300013307 Bacteria 17940
256 Ga0157372_10004519 3300013307 Bacteria 14837
257 Ga0157372_10018328 3300013307 Bacteria 7524
258 Ga0157372_10022180 3300013307 Bacteria 6868
259 Ga0157372_10040910 3300013307 Bacteria 5123
260 Ga0157372_10058151 3300013307 Bacteria 4321
261 Ga0157372_10074061 3300013307 Bacteria 3839
262 Ga0157372_10108653 3300013307 Bacteria 3175
263 Ga0157372_10116464 3300013307 Bacteria 3064
264 Ga0157375_10023093 3300013308 Bacteria 5734
265 Ga0182008_10000720 3300014497 Bacteria 23630
266 Ga0157377_10005918 3300014745 Bacteria 5787
267 Ga0182007_10000119 3300015262 Bacteria 54423
268 Ga0213873_10004949 3300021358 Bacteria 2520
269 Ga0213872_10000811 3300021361 Bacteria 22614
270 Ga0213872_10018339 3300021361 Unclassified 3228
271 Ga0213876_10000312 3300021384 Bacteria 42654
272 Ga0209026_1004101 3300025250 Bacteria 4484
273 Ga0209759_1003490 3300025256 Bacteria 6239
274 Ga0209455_1000151 3300025272 Bacteria 129842
275 Ga0209050_1003113 3300025298 Bacteria 12711
276 Ga0209257_1000021 3300025304 Bacteria 771986
277 Ga0207713_1001241 3300025735 Bacteria 21135
278 Ga0207653_10003362 3300025885 Bacteria 5048
279 Ga0207642_10004668 3300025899 Bacteria 4425
280 Ga0207688_10004387 3300025901 Bacteria 7683
281 Ga0207647_10000037 3300025904 Bacteria 97521
282 Ga0207647_10002407 3300025904 Bacteria 14206
283 Ga0207699_10024681 3300025906 Bacteria 3290
284 Ga0207705_10000138 3300025909 Bacteria 78969
285 Ga0207705_10002495 3300025909 Bacteria 14175
286 Ga0207705_10044927 3300025909 Bacteria 3175
287 Ga0207684_10002897 3300025910 Bacteria 17008
288 Ga0207684_10006810 3300025910 Bacteria 10363
289 Ga0207654_10000309 3300025911 Bacteria 29439
290 Ga0207654_10013085 3300025911 Bacteria 4263
291 Ga0207707_10000128 3300025912 Bacteria 78104
292 Ga0207707_10000829 3300025912 Bacteria 30323
293 Ga0207707_10004083 3300025912 Bacteria 12931
294 Ga0207707_10013471 3300025912 Bacteria 7127
295 Ga0207707_10028455 3300025912 Bacteria 4885
296 Ga0207707_10032978 3300025912 Bacteria 4534
297 Ga0207695_10008507 3300025913 Bacteria 12831
298 Ga0207695_10008932 3300025913 Bacteria 12475
299 Ga0207695_10021576 3300025913 Bacteria 7344
300 Ga0207695_10023730 3300025913 Bacteria 6922
301 Ga0207695_10026148 3300025913 Bacteria 6516
302 Ga0207695_10062900 3300025913 Bacteria 3828
303 Ga0207695_10065293 3300025913 Bacteria 3742
304 Ga0207695_10093082 3300025913 Bacteria 3024
305 Ga0207695_10099426 3300025913 Bacteria 2907
306 Ga0207671_10000222 3300025914 Bacteria 85244
307 Ga0207671_10016749 3300025914 Bacteria 5685
308 Ga0207671_10040184 3300025914 Bacteria 3463
309 Ga0207693_10003993 3300025915 Bacteria 12536
310 Ga0207693_10016792 3300025915 Bacteria 5844
311 Ga0207663_10023589 3300025916 Bacteria 3532
312 Ga0207660_10010927 3300025917 Bacteria 5901
313 Ga0207662_10038617 3300025918 Bacteria 2798
314 Ga0207657_10007736 3300025919 Bacteria 10974
315 Ga0207657_10011933 3300025919 Bacteria 8598
316 Ga0207657_10017493 3300025919 Bacteria 6870
317 Ga0207657_10030218 3300025919 Bacteria 4920
318 Ga0207657_10077279 3300025919 Bacteria 2806
319 Ga0207649_10000045 3300025920 Bacteria 112787
320 Ga0207652_10002805 3300025921 Bacteria 14620
321 Ga0207652_10016912 3300025921 Bacteria 5965
322 Ga0207652_10048349 3300025921 Bacteria 3636
323 Ga0207652_10082698 3300025921 Bacteria 2810
324 Ga0207652_10082700 3300025921 Unclassified 2810
325 Ga0207646_10009125 3300025922 Bacteria 9844
326 Ga0207646_10017582 3300025922 Bacteria 6684
327 Ga0207694_10006112 3300025924 Bacteria 9209
328 Ga0207694_10016693 3300025924 Bacteria 5549
329 Ga0207694_10042853 3300025924 Bacteria 3492
330 Ga0207659_10039522 3300025926 Bacteria 3292
331 Ga0207687_10000887 3300025927 Bacteria 20305
332 Ga0207700_10070096 3300025928 Bacteria 2694
333 Ga0207664_10003416 3300025929 Bacteria 10583
334 Ga0207664_10014221 3300025929 Bacteria 5739
335 Ga0207664_10026108 3300025929 Bacteria 4410
336 Ga0207690_10004619 3300025932 Bacteria 8141
337 Ga0207690_10012223 3300025932 Bacteria 5138
338 Ga0207690_10019110 3300025932 Bacteria 4211
339 Ga0207690_10028895 3300025932 Bacteria 3518
340 Ga0207690_10033828 3300025932 Bacteria 3289
341 Ga0207706_10006836 3300025933 Bacteria 10540
342 Ga0207706_10033575 3300025933 Bacteria 4566
343 Ga0207686_10002621 3300025934 Bacteria 9761
344 Ga0207709_10013696 3300025935 Bacteria 4474
345 Ga0207670_10009676 3300025936 Bacteria 5513
346 Ga0207704_10014258 3300025938 Bacteria 4009
347 Ga0207665_10028307 3300025939 Bacteria 3701
348 Ga0207691_10018788 3300025940 Bacteria 6547
349 Ga0207691_10053559 3300025940 Bacteria 3684
350 Ga0207711_10067425 3300025941 Bacteria 3097
351 Ga0207661_10059574 3300025944 Bacteria 3077
352 Ga0207679_10001606 3300025945 Bacteria 14057
353 Ga0207679_10007252 3300025945 Bacteria 7026
354 Ga0207667_10000001 3300025949 Bacteria 1178522
355 Ga0207667_10002534 3300025949 Bacteria 22749
356 Ga0207667_10004327 3300025949 Bacteria 17388
357 Ga0207667_10011114 3300025949 Bacteria 10482
358 Ga0207667_10017582 3300025949 Bacteria 8041
359 Ga0207667_10017686 3300025949 Bacteria 8021
360 Ga0207667_10020791 3300025949 Bacteria 7289
361 Ga0207667_10024812 3300025949 Bacteria 6575
362 Ga0207667_10028456 3300025949 Bacteria 6071
363 Ga0207667_10033874 3300025949 Bacteria 5488
364 Ga0207667_10093106 3300025949 Bacteria 3112
365 Ga0207667_10111411 3300025949 Bacteria 2823
366 Ga0207651_10001351 3300025960 Bacteria 11094
367 Ga0207640_10000041 3300025981 Bacteria 105374
368 Ga0207640_10010970 3300025981 Bacteria 5115
369 Ga0207640_10039381 3300025981 Bacteria 2991
370 Ga0207677_10014955 3300026023 Bacteria 4548
371 Ga0207639_10000081 3300026041 Bacteria 82747
372 Ga0207639_10006352 3300026041 Bacteria 8029
373 Ga0207639_10017297 3300026041 Bacteria 5111
374 Ga0207639_10033829 3300026041 Bacteria 3774
375 Ga0207678_10017526 3300026067 Bacteria 6290
376 Ga0207678_10025723 3300026067 Bacteria 5137
377 Ga0207678_10032253 3300026067 Bacteria 4566
378 Ga0207678_10087243 3300026067 Bacteria 2667
379 Ga0207708_10011793 3300026075 Bacteria 6510
380 Ga0207708_10024165 3300026075 Bacteria 4596
381 Ga0207702_10005253 3300026078 Bacteria 11369
382 Ga0207702_10005990 3300026078 Bacteria 10552
383 Ga0207702_10008745 3300026078 Bacteria 8537
384 Ga0207702_10010382 3300026078 Bacteria 7798
385 Ga0207702_10025399 3300026078 Bacteria 4917
386 Ga0207648_10029578 3300026089 Bacteria 4858
387 Ga0207676_10003457 3300026095 Bacteria 11180
388 Ga0207674_10000545 3300026116 Bacteria 49406
389 Ga0207674_10001824 3300026116 Bacteria 27181
390 Ga0207674_10006413 3300026116 Bacteria 13836
391 Ga0207674_10021822 3300026116 Bacteria 6891
392 Ga0207674_10045260 3300026116 Bacteria 4528
393 Ga0207675_100004314 3300026118 Bacteria 13740
394 Ga0207683_10097816 3300026121 Bacteria 2618
395 Ga0207698_10000054 3300026142 Bacteria 82681
396 Ga0207698_10004012 3300026142 Bacteria 8934
397 Ga0207698_10020871 3300026142 Bacteria 4519
398 Ga0209998_10001553 3300027717 Bacteria 5517
399 Ga0207428_10020618 3300027907 Bacteria 5596
400 Ga0207428_10050645 3300027907 Bacteria 3322
401 Ga0207428_10063864 3300027907 Bacteria 2908
402 Ga0207428_10087632 3300027907 Bacteria 2422
403 Ga0268266_10000012 3300028379 Bacteria 734912
404 Ga0268264_10074071 3300028381 Bacteria 2891
405 Ga0265334_10007814 3300028573 Bacteria 4577
406 Ga0307515_10003432 3300028794 Bacteria 33341
407 Ga0265338_10003096 3300028800 Bacteria 23860
408 Ga0265338_10011316 3300028800 Bacteria 10324
409 Ga0265338_10034240 3300028800 Bacteria 4913
410 Ga0265324_10000038 3300029957 Bacteria 119212
411 Ga0265330_10020819 3300031235 Bacteria 2996
412 Ga0265340_10004633 3300031247 Bacteria 7656
413 Ga0265339_10000039 3300031249 Bacteria 120661
414 Ga0307408_100012298 3300031548 Bacteria 5668
415 Ga0265313_10017269 3300031595 Bacteria 4108
416 Ga0307413_10001002 3300031824 Bacteria 10195
417 Ga0307412_10025210 3300031911 Bacteria 3681
418 Ga0307409_100020077 3300031995 Bacteria 4544
419 Ga0307409_100030717 3300031995 Bacteria 3865
420 Ga0307409_100050642 3300031995 Bacteria 3173
421 Ga0307409_100080824 3300031995 Bacteria 2625
422 Ga0307416_100032345 3300032002 Bacteria 3951
423 Ga0307414_10039841 3300032004 Bacteria 3169
424 Ga0307415_100012395 3300032126 Bacteria 4927
425 Ga0307415_100018805 3300032126 Bacteria 4182
426 Ga0373926_0004262 3300035083 Bacteria 4678
427 Ga0373934_0002168 3300035086 Bacteria 7220
428 Ga0373923_0002299 3300035111 Bacteria 5839
429 Ga0373953_0002942 3300035117 Bacteria 5205
430 Ga0373956_0010988 3300035119 Bacteria 3726
431 Ga0373946_0016533 3300035171 Bacteria 2812
432 Ga0373947_0002484 3300035725 Bacteria 11090
433 Ga0373937_0013594 3300036401 Bacteria 7172
434 Ga0373937_0066063 3300036401 Bacteria 3330
435 Ga0316582_0025860 3300036647 Bacteria 3529
436 Ga0373925_0003855 3300037068 Bacteria 11487
437 Ga0373925_0008070 3300037068 Bacteria 7669
438 Ga0373925_0019751 3300037068 Bacteria 4904
439 Ga0373925_0026193 3300037068 Bacteria 4266
440 Ga0395898_0112022 3300037466 Bacteria 2615
441 Ga0436364_0961538 3300037853 Bacteria 3981
442 Ga0395901_0065876 3300038443 Bacteria 3773
443 Ga0395901_0114077 3300038443 Bacteria 2838
444 Ga0436365_0829382 3300039437 Bacteria 20843
445 Ga0436361_0013419 3300039447 Unclassified 2864
446 Ga0436361_0259259 3300039447 Bacteria 4878
447 Ga0436361_0306192 3300039447 Bacteria 136694
448 Ga0436363_0558892 3300039450 Bacteria 7281
449 Ga0451807_2610835 3300041486 Bacteria 4280
450 Ga0439448_0005500 3300042005 Bacteria 3614
451 Ga0439451_000928 3300042009 Bacteria 5645
452 Ga0451577_0006548 3300042876 Bacteria 11588
453 Ga0451577_0069100 3300042876 Bacteria 3150
454 Ga0453683_0000130 3300044673 Bacteria 109669
455 Ga0453684_0000306 3300044712 Bacteria 207333
456 Ga0453684_0037081 3300044712 Bacteria 6697
457 Ga0453684_0042322 3300044712 Bacteria 6142
458 Ga0453684_0058424 3300044712 Bacteria 4982
459 Ga0453684_0155339 3300044712 Bacteria 2714
460 Ga0451576_0012158 3300045051 Bacteria 9704
461 Ga0451576_0016035 3300045051 Bacteria 8279
462 Ga0451576_0022735 3300045051 Bacteria 6793
463 Ga0451576_0022762 3300045051 Bacteria 6789
464 Ga0451576_0135550 3300045051 Bacteria 2567
465 Ga0466958_0054211 3300045836 Bacteria 2432
466 Ga0495592_0031774 3300046454 Bacteria 3987
467 Ga0495603_0002605 3300046455 Bacteria 10647
468 Ga0495590_0000005 3300046457 Bacteria 384276
469 Ga0495638_0000105 3300046460 Bacteria 134384
470 Ga0495641_0005721 3300046461 Bacteria 8269
471 Ga0495653_0002547 3300046463 Bacteria 14525
472 Ga0495650_0000061 3300046471 Bacteria 283347
473 Ga0495650_0002094 3300046471 Bacteria 17165
474 Ga0495580_0002418 3300046472 Bacteria 16314
475 Ga0495580_0004454 3300046472 Bacteria 11770
476 Ga0495580_0004869 3300046472 Bacteria 11229
477 Ga0495580_0065513 3300046472 Bacteria 2544
478 Ga0495582_0000413 3300046473 Bacteria 23302
479 Ga0495639_0000560 3300046475 Bacteria 17338
480 Ga0495594_0009676 3300046499 Bacteria 4985
481 Ga0495583_0000740 3300046506 Bacteria 41499
482 Ga0495608_0001600 3300046511 Bacteria 16214
483 Ga0495608_0010440 3300046511 Bacteria 6481
484 Ga0495608_0025250 3300046511 Bacteria 4055
485 Ga0495618_0005277 3300046514 Bacteria 7897
486 Ga0495618_0047491 3300046514 Bacteria 2709
487 Ga0495628_0016038 3300046516 Bacteria 6251
488 Ga0495648_0000008 3300046524 Bacteria 336584
489 Ga0495666_0009232 3300046526 Bacteria 4931
490 Ga0495642_0000948 3300046528 Bacteria 13579
491 Ga0495665_0044276 3300046531 Bacteria 2365
492 Ga0495640_0021018 3300046533 Bacteria 4797
493 Ga0495586_0029890 3300046535 Bacteria 2916
494 Ga0495609_0004469 3300046538 Bacteria 7640
495 Ga0495622_0000280 3300046557 Bacteria 38774
496 Ga0495633_0000238 3300046558 Bacteria 66595
497 Ga0495667_0000278 3300046559 Bacteria 33396
498 Ga0495668_0000065 3300046616 Bacteria 178985
499 Ga0495634_0005921 3300046642 Bacteria 9340
500 Ga0495634_0016612 3300046642 Bacteria 5260
501 Ga0495625_0000954 3300046660 Bacteria 38641
502 Ga0495588_0026749 3300046674 Bacteria 2881
503 Ga0495657_0004212 3300046675 Bacteria 11512
504 Ga0495599_0005873 3300046678 Bacteria 7373
505 Ga0495613_0005696 3300046689 Bacteria 9338
506 Ga0495613_0038678 3300046689 Bacteria 3535
507 Ga0495600_0006209 3300046809 Bacteria 7247
508 Ga0495660_0003991 3300046810 Bacteria 9002
509 Ga0495581_0005270 3300047315 Bacteria 7477
510 Ga0495604_0063499 3300047317 Bacteria 2816
511 Ga0495674_0038142 3300047319 Bacteria 4315
512 Ga0495674_0114570 3300047319 Bacteria 2283
513 Ga0495676_0022241 3300047321 Bacteria 5520
514 Ga0495680_0030067 3300047322 Bacteria 4440
515 Ga0495675_0003519 3300047444 Bacteria 9440
516 Ga0496100_0000293 3300048903 Bacteria 25054
517 Ga0496101_0037060 3300048904 Bacteria 3457
518 Ga0496102_0062016 3300048905 Bacteria 3423
519 Ga0496104_0040288 3300048907 Bacteria 4378
520 Ga0496104_0056584 3300048907 Bacteria 3709
521 Ga0496105_0043255 3300048908 Bacteria 3715
522 Ga0496106_0000047 3300048909 Bacteria 100449
523 Ga0496106_0006900 3300048909 Bacteria 8402
524 Ga0496107_0000232 3300048910 Bacteria 29452
525 Ga0496107_0039622 3300048910 Bacteria 3380
526 Ga0496108_0015495 3300048911 Bacteria 6217
527 Ga0496108_0050045 3300048911 Bacteria 3497
528 Ga0496108_0053039 3300048911 Bacteria 3399
529 Ga0496109_0008972 3300048912 Bacteria 8517
530 Ga0496109_0014093 3300048912 Bacteria 6949
531 Ga0496110_0002400 3300048913 Bacteria 14032
532 Ga0496110_0004086 3300048913 Bacteria 11263
533 Ga0496110_0005258 3300048913 Bacteria 10129
534 Ga0496110_0025835 3300048913 Bacteria 5021
535 Ga0496110_0033412 3300048913 Bacteria 4450
536 Ga0496111_0002866 3300048914 Bacteria 10524
537 Ga0496111_0013094 3300048914 Bacteria 5633
538 Ga0496111_0038706 3300048914 Bacteria 3417
539 Ga0496112_0035155 3300048915 Bacteria 4878
540 Ga0496112_0102369 3300048915 Bacteria 2834
541 Ga0496113_0024645 3300048916 Bacteria 4279
542 Ga0496114_0102014 3300048917 Bacteria 2451
543 Ga0496116_0000193 3300048919 Bacteria 122203
544 Ga0496117_0001656 3300048920 Bacteria 31249
545 Ga0496118_0000156 3300048921 Bacteria 121630
546 Ga0496122_0002269 3300048925 Bacteria 27812
547 Ga0496125_0004416 3300048928 Bacteria 16247
548 Ga0501310_000308 3300049130 Bacteria 4524
549 Ga0495678_006025 3300049459 Bacteria 6534
550 Ga0495678_012546 3300049459 Bacteria 4014
551 Ga0501031_0000043 3300049568 Bacteria 67296
552 Ga0501031_0011811 3300049568 Bacteria 5695
553 Ga0501031_0012739 3300049568 Bacteria 5494
554 Ga0501032_0015902 3300049569 Bacteria 5301
555 Ga0501033_0038226 3300049570 Bacteria 3590
556 Ga0501034_0010411 3300049571 Bacteria 9692
557 Ga0501034_0062823 3300049571 Bacteria 3729
558 Ga0501037_0025396 3300049573 Bacteria 4378
559 Ga0501039_0015679 3300049575 Bacteria 5797
560 Ga0501039_0022829 3300049575 Bacteria 4799
561 Ga0501040_0026961 3300049576 Bacteria 3865
562 Ga0501041_0022031 3300049577 Bacteria 3815
563 Ga0501041_0023830 3300049577 Bacteria 3672
564 Ga0501043_0002546 3300049579 Bacteria 15408
565 Ga0501046_0003075 3300049580 Bacteria 15408
566 Ga0501046_0048393 3300049580 Bacteria 3367
567 Ga0501047_0000298 3300049581 Bacteria 57038
568 Ga0501068_0016956 3300049584 Bacteria 4208
569 Ga0501069_0002005 3300049585 Bacteria 10196
570 Ga0501069_0010891 3300049585 Bacteria 4818
571 Ga0501069_0019188 3300049585 Bacteria 3694
572 Ga0501070_0003957 3300049586 Bacteria 12753
573 Ga0501070_0049236 3300049586 Bacteria 3499
574 Ga0501070_0050287 3300049586 Bacteria 3460
575 Ga0501071_0013274 3300049587 Bacteria 5613
576 Ga0501072_0018889 3300049588 Bacteria 5318
577 Ga0501072_0041387 3300049588 Bacteria 3619
578 Ga0501073_0005956 3300049589 Bacteria 9097
579 Ga0501075_0028103 3300049591 Bacteria 4150
580 Ga0501076_0003362 3300049592 Bacteria 11229
581 Ga0501076_0098723 3300049592 Bacteria 2353
582 Ga0501079_0013817 3300049741 Bacteria 6157
583 Ga0501080_0000484 3300049742 Bacteria 30966
584 Ga0501081_0018173 3300049743 Bacteria 4667
585 Ga0501083_0003320 3300049744 Bacteria 11243
586 Ga0501083_0033535 3300049744 Bacteria 3515
587 Ga0501035_0001671 3300049822 Bacteria 22430
588 Ga0501035_0003222 3300049822 Bacteria 15634
589 Ga0501035_0064939 3300049822 Bacteria 3243
590 Ga0501035_0081612 3300049822 Bacteria 2854
591 Ga0501044_0000032 3300049823 Bacteria 169439
592 Ga0501044_0000129 3300049823 Bacteria 92557
593 Ga0501044_0012042 3300049823 Bacteria 9367
594 Ga0501044_0022787 3300049823 Bacteria 6670
595 Ga0501044_0080958 3300049823 Bacteria 3288
596 Ga0501045_0003384 3300049824 Bacteria 10920
597 nmdc:mga00v17_3015_c1 3300050491 Bacteria 8654
598 nmdc:mga0yw44_27164_c1 3300050492 Bacteria 3276
599 nmdc:mga0yw44_30676_c1 3300050492 Bacteria 3119
600 nmdc:mga0yw44_8024_c1 3300050492 Bacteria 5234
601 nmdc:mga05p37_1464_c1 3300050507 Bacteria 27403
602 nmdc:mga05p37_1595_c1 3300050507 Bacteria 26327
603 nmdc:mga05p37_7948_c1 3300050507 Bacteria 12519
604 nmdc:mga09592_112367_c1 3300050508 Bacteria 2337
605 nmdc:mga09592_33132_c1 3300050508 Bacteria 4311
606 nmdc:mga09592_4143_c1 3300050508 Bacteria 11714
607 nmdc:mga0qj67_1688_c1 3300050509 Bacteria 15559
608 nmdc:mga0qj67_26132_c1 3300050509 Bacteria 4519
609 nmdc:mga0qj67_4250_c1 3300050509 Bacteria 10379
610 nmdc:mga0qj67_5040_c1 3300050509 Bacteria 9599
611 nmdc:mga06r32_15507_c1 3300050510 Bacteria 6919
612 nmdc:mga06r32_5717_c1 3300050510 Bacteria 11200
613 nmdc:mga08y16_18544_c1 3300050511 Bacteria 7332
614 nmdc:mga08y16_23587_c1 3300050511 Bacteria 6499
615 nmdc:mga08y16_39169_c1 3300050511 Bacteria 4973
616 nmdc:mga08y16_45060_c1 3300050511 Bacteria 4621
617 nmdc:mga08y16_51745_c1 3300050511 Bacteria 4298
618 nmdc:mga08y16_82223_c1 3300050511 Bacteria 3357
619 nmdc:mga08y16_89288_c1 3300050511 Bacteria 3212
620 nmdc:mga0n895_5423_c1 3300050512 Bacteria 10656
621 nmdc:mga0rr50_4741_c1 3300050513 Bacteria 8018
622 nmdc:mga0rr50_6120_c1 3300050513 Bacteria 7279
623 Ga0495619_0006383 3300053085 Bacteria 7472
624 Ga0500651_0008389 3300053093 Bacteria 6077
625 Ga0500590_000002 3300053148 Bacteria 124521
626 Ga0500619_000019 3300053154 Bacteria 52899
627 Ga0501084_0016429 3300054114 Bacteria 6147
628 Ga0501082_0017479 3300060353 Bacteria 6179
629 Ga0501082_0032968 3300060353 Bacteria 4467
630 Ga0530510_0011936 3300061734 Bacteria 6095

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10038617 Ga0207662_100386173 594
2 3300048917 Ga0496114_0102014 Ga0496114_0102014_447_2417 601
3 3300036401 Ga0373937_0066063 Ga0373937_0066063_1433_3313 615
4 3300046514 Ga0495618_0047491 Ga0495618_0047491_776_2698 624
5 3300046642 Ga0495634_0016612 Ga0495634_0016612_12_1934 624
6 3300050508 nmdc:mga09592_112367_c1 nmdc:mga09592_112367_c1_338_2317 632
7 3300049570 Ga0501033_0038226 Ga0501033_0038226_1503_3575 638
8 3300048913 Ga0496110_0005258 Ga0496110_0005258_7997_10111 649
9 3300048914 Ga0496111_0038706 Ga0496111_0038706_19_2133 649
10 3300005518 Ga0070699_100006903 Ga0070699_1000069035 658
11 3300047319 Ga0495674_0114570 Ga0495674_0114570_146_2215 658
12 3300048915 Ga0496112_0102369 Ga0496112_0102369_398_2536 658
13 3300049592 Ga0501076_0098723 Ga0501076_0098723_188_2329 658
14 3300031247 Ga0265340_10004633 Ga0265340_100046331 663
15 3300046531 Ga0495665_0044276 Ga0495665_0044276_187_2259 669
16 3300045836 Ga0466958_0054211 Ga0466958_0054211_16_2157 681
17 3300049569 Ga0501032_0015902 Ga0501032_0015902_18_2225 683
18 3300050512 nmdc:mga0n895_5423_c1 nmdc:mga0n895_5423_c1_798_3005 684
19 3300050513 nmdc:mga0rr50_4741_c1 nmdc:mga0rr50_4741_c1_3781_5988 684
20 3300021358 Ga0213873_10004949 Ga0213873_100049491 689
21 3300005983 Ga0081540_1000014 Ga0081540_100001426 690
22 3300005937 Ga0081455_10054930 Ga0081455_100549301 692
23 3300050507 nmdc:mga05p37_7948_c1 nmdc:mga05p37_7948_c1_8052_10286 694
24 3300050511 nmdc:mga08y16_51745_c1 nmdc:mga08y16_51745_c1_487_2721 694
25 3300038443 Ga0395901_0065876 Ga0395901_0065876_431_2749 695
26 3300005435 Ga0070714_100014518 Ga0070714_1000145182 697
27 3300045051 Ga0451576_0135550 Ga0451576_0135550_91_2424 697
28 3300006195 Ga0075366_10012767 Ga0075366_100127672 700
29 3300035171 Ga0373946_0016533 Ga0373946_0016533_72_2405 700
30 3300046455 Ga0495603_0002605 Ga0495603_0002605_5671_8004 700
31 3300046461 Ga0495641_0005721 Ga0495641_0005721_932_3265 700
32 3300046499 Ga0495594_0009676 Ga0495594_0009676_799_3132 700
33 3300046674 Ga0495588_0026749 Ga0495588_0026749_194_2527 700
34 3300047321 Ga0495676_0022241 Ga0495676_0022241_2736_5069 700
35 3300009147 Ga0114129_10001564 Ga0114129_1000156412 701
36 3300026116 Ga0207674_10021822 Ga0207674_100218227 701
37 3300027907 Ga0207428_10087632 Ga0207428_100876321 701
38 3300050507 nmdc:mga05p37_1464_c1 nmdc:mga05p37_1464_c1_5209_7476 701
39 3300050509 nmdc:mga0qj67_5040_c1 nmdc:mga0qj67_5040_c1_3655_5922 701
40 3300050511 nmdc:mga08y16_45060_c1 nmdc:mga08y16_45060_c1_172_2472 701
41 3300048916 Ga0496113_0024645 Ga0496113_0024645_1812_4148 702
42 3300005457 Ga0070662_100036457 Ga0070662_1000364571 703
43 3300005539 Ga0068853_100047802 Ga0068853_1000478022 703
44 3300005577 Ga0068857_100036623 Ga0068857_1000366233 703
45 3300005618 Ga0068864_100078069 Ga0068864_1000780691 703
46 3300006237 Ga0097621_100086773 Ga0097621_1000867731 703
47 3300009093 Ga0105240_10138630 Ga0105240_101386302 703
48 3300009553 Ga0105249_10016569 Ga0105249_100165691 703
49 3300013296 Ga0157374_10056534 Ga0157374_100565344 703
50 3300013307 Ga0157372_10108653 Ga0157372_101086531 703
51 3300025919 Ga0207657_10077279 Ga0207657_100772792 703
52 3300025933 Ga0207706_10033575 Ga0207706_100335752 703
53 3300025941 Ga0207711_10067425 Ga0207711_100674251 703
54 3300026116 Ga0207674_10006413 Ga0207674_100064135 703
55 3300048907 Ga0496104_0040288 Ga0496104_0040288_1915_4251 703
56 3300048908 Ga0496105_0043255 Ga0496105_0043255_658_2994 703
57 3300048911 Ga0496108_0015495 Ga0496108_0015495_1652_3988 703
58 3300048912 Ga0496109_0014093 Ga0496109_0014093_2433_4769 703
59 3300048913 Ga0496110_0025835 Ga0496110_0025835_2462_4798 703
60 3300048914 Ga0496111_0013094 Ga0496111_0013094_224_2560 703
61 3300050510 nmdc:mga06r32_15507_c1 nmdc:mga06r32_15507_c1_4313_6610 703
62 3300005329 Ga0070683_100017433 Ga0070683_1000174332 704
63 3300005338 Ga0068868_100020752 Ga0068868_1000207525 704
64 3300005354 Ga0070675_100013247 Ga0070675_1000132471 704
65 3300005366 Ga0070659_100024433 Ga0070659_1000244331 704
66 3300005441 Ga0070700_100005940 Ga0070700_1000059402 704
67 3300005455 Ga0070663_100018991 Ga0070663_1000189913 704
68 3300005577 Ga0068857_100015767 Ga0068857_1000157677 704
69 3300005614 Ga0068856_100006583 Ga0068856_1000065837 704
70 3300005615 Ga0070702_100028732 Ga0070702_1000287321 704
71 3300005616 Ga0068852_100044193 Ga0068852_1000441931 704
72 3300005843 Ga0068860_100108581 Ga0068860_1001085811 704
73 3300009094 Ga0111539_10029566 Ga0111539_100295667 704
74 3300009098 Ga0105245_10037843 Ga0105245_100378433 704
75 3300009174 Ga0105241_10002240 Ga0105241_100022407 704
76 3300009176 Ga0105242_10056419 Ga0105242_100564192 704
77 3300009545 Ga0105237_10081267 Ga0105237_100812672 704
78 3300013307 Ga0157372_10022180 Ga0157372_100221804 704
79 3300025926 Ga0207659_10039522 Ga0207659_100395222 704
80 3300025932 Ga0207690_10019110 Ga0207690_100191103 704
81 3300026023 Ga0207677_10014955 Ga0207677_100149554 704
82 3300026067 Ga0207678_10032253 Ga0207678_100322534 704
83 3300026075 Ga0207708_10011793 Ga0207708_100117931 704
84 3300026121 Ga0207683_10097816 Ga0207683_100978161 704
85 3300027907 Ga0207428_10063864 Ga0207428_100638642 704
86 3300028381 Ga0268264_10074071 Ga0268264_100740712 704
87 3300037466 Ga0395898_0112022 Ga0395898_0112022_203_2521 704
88 3300038443 Ga0395901_0114077 Ga0395901_0114077_167_2485 704
89 3300049823 Ga0501044_0000129 Ga0501044_0000129_89014_91284 704
90 3300050511 nmdc:mga08y16_23587_c1 nmdc:mga08y16_23587_c1_3972_6329 704
91 3300006871 Ga0075434_100000294 Ga0075434_10000029429 705
92 3300007076 Ga0075435_100024294 Ga0075435_1000242943 705
93 3300049568 Ga0501031_0012739 Ga0501031_0012739_46_2325 705
94 3300049577 Ga0501041_0022031 Ga0501041_0022031_366_2645 705
95 3300049588 Ga0501072_0041387 Ga0501072_0041387_1213_3492 705
96 3300049741 Ga0501079_0013817 Ga0501079_0013817_1071_3350 705
97 3300054114 Ga0501084_0016429 Ga0501084_0016429_3015_5294 705
98 3300060353 Ga0501082_0017479 Ga0501082_0017479_334_2613 705
99 3300013306 Ga0163162_10030588 Ga0163162_100305884 706
100 3300031235 Ga0265330_10020819 Ga0265330_100208191 706
101 3300032004 Ga0307414_10039841 Ga0307414_100398412 706
102 3300048907 Ga0496104_0056584 Ga0496104_0056584_167_2473 706
103 3300009545 Ga0105237_10012837 Ga0105237_100128372 707
104 3300049568 Ga0501031_0000043 Ga0501031_0000043_45323_47617 707
105 3300049822 Ga0501035_0001671 Ga0501035_0001671_12268_14562 707
106 3300049823 Ga0501044_0000032 Ga0501044_0000032_62852_65146 707
107 3300003373 JGI25407J50210_10001083 JGI25407J50210_100010834 708
108 3300005458 Ga0070681_10088473 Ga0070681_100884732 708
109 3300005981 Ga0081538_10005079 Ga0081538_100050795 708
110 3300021384 Ga0213876_10000312 Ga0213876_1000031213 708
111 3300025912 Ga0207707_10032978 Ga0207707_100329782 708
112 3300028573 Ga0265334_10007814 Ga0265334_100078144 708
113 3300028800 Ga0265338_10011316 Ga0265338_100113164 708
114 3300028800 Ga0265338_10034240 Ga0265338_100342403 708
115 3300049571 Ga0501034_0062823 Ga0501034_0062823_366_2708 709
116 3300049743 Ga0501081_0018173 Ga0501081_0018173_514_2796 709
117 3300027717 Ga0209998_10001553 Ga0209998_100015533 710
118 3300005539 Ga0068853_100019193 Ga0068853_1000191935 711
119 3300005564 Ga0070664_100024230 Ga0070664_1000242304 711
120 3300010375 Ga0105239_10013523 Ga0105239_100135235 711
121 3300013296 Ga0157374_10007726 Ga0157374_100077262 711
122 3300025940 Ga0207691_10053559 Ga0207691_100535592 711
123 3300025945 Ga0207679_10007252 Ga0207679_100072523 711
124 3300029957 Ga0265324_10000038 Ga0265324_1000003838 711
125 3300031249 Ga0265339_10000039 Ga0265339_1000003940 711
126 3300037068 Ga0373925_0019751 Ga0373925_0019751_2056_4335 711
127 3300046472 Ga0495580_0004454 Ga0495580_0004454_9112_11391 711
128 3300047319 Ga0495674_0038142 Ga0495674_0038142_1508_3802 711
129 3300005329 Ga0070683_100038094 Ga0070683_1000380942 712
130 3300005937 Ga0081455_10023949 Ga0081455_100239494 712
131 3300009094 Ga0111539_10003257 Ga0111539_1000325720 712
132 3300009147 Ga0114129_10065801 Ga0114129_100658012 712
133 3300025944 Ga0207661_10059574 Ga0207661_100595742 712
134 3300027907 Ga0207428_10020618 Ga0207428_100206182 712
135 3300050511 nmdc:mga08y16_82223_c1 nmdc:mga08y16_82223_c1_396_2630 712
136 3300001990 JGI24737J22298_10008703 JGI24737J22298_100087032 713
137 3300005340 Ga0070689_100009969 Ga0070689_1000099695 713
138 3300005365 Ga0070688_100006583 Ga0070688_1000065836 713
139 3300005441 Ga0070700_100013333 Ga0070700_1000133333 713
140 3300005466 Ga0070685_10002004 Ga0070685_100020044 713
141 3300005615 Ga0070702_100004472 Ga0070702_1000044725 713
142 3300005618 Ga0068864_100019452 Ga0068864_1000194523 713
143 3300005842 Ga0068858_100021855 Ga0068858_1000218552 713
144 3300005843 Ga0068860_100026137 Ga0068860_1000261375 713
145 3300005844 Ga0068862_100021617 Ga0068862_1000216172 713
146 3300006881 Ga0068865_100009469 Ga0068865_1000094693 713
147 3300009098 Ga0105245_10040689 Ga0105245_100406892 713
148 3300009553 Ga0105249_10009340 Ga0105249_100093403 713
149 3300010375 Ga0105239_10030485 Ga0105239_100304854 713
150 3300014745 Ga0157377_10005918 Ga0157377_100059182 713
151 3300025899 Ga0207642_10004668 Ga0207642_100046682 713
152 3300025901 Ga0207688_10004387 Ga0207688_100043874 713
153 3300025935 Ga0207709_10013696 Ga0207709_100136963 713
154 3300025936 Ga0207670_10009676 Ga0207670_100096762 713
155 3300026041 Ga0207639_10017297 Ga0207639_100172971 713
156 3300026075 Ga0207708_10024165 Ga0207708_100241652 713
157 3300026089 Ga0207648_10029578 Ga0207648_100295782 713
158 3300026118 Ga0207675_100004314 Ga0207675_1000043144 713
159 3300048905 Ga0496102_0062016 Ga0496102_0062016_802_3138 713
160 3300048909 Ga0496106_0006900 Ga0496106_0006900_5221_7557 713
161 3300048910 Ga0496107_0039622 Ga0496107_0039622_887_3223 713
162 3300048911 Ga0496108_0053039 Ga0496108_0053039_193_2529 713
163 3300048912 Ga0496109_0008972 Ga0496109_0008972_2255_4591 713
164 3300048913 Ga0496110_0004086 Ga0496110_0004086_8139_10475 713
165 3300049577 Ga0501041_0023830 Ga0501041_0023830_661_2895 713
166 3300049588 Ga0501072_0018889 Ga0501072_0018889_28_2262 713
167 3300049592 Ga0501076_0003362 Ga0501076_0003362_6496_8730 713
168 3300049824 Ga0501045_0003384 Ga0501045_0003384_6887_9121 713
169 3300061734 Ga0530510_0011936 Ga0530510_0011936_3834_6068 713
170 3300002239 JGI24034J26672_10000065 JGI24034J26672_1000006534 714
171 3300005295 Ga0065707_10002102 Ga0065707_100021025 714
172 3300005937 Ga0081455_10000836 Ga0081455_1000083612 714
173 3300031995 Ga0307409_100030717 Ga0307409_1000307172 714
174 3300042005 Ga0439448_0005500 Ga0439448_0005500_507_2834 714
175 3300009098 Ga0105245_10000316 Ga0105245_1000031650 715
176 3300025927 Ga0207687_10000887 Ga0207687_1000088716 715
177 3300031595 Ga0265313_10017269 Ga0265313_100172692 715
178 3300005458 Ga0070681_10031227 Ga0070681_100312272 717
179 3300048904 Ga0496101_0037060 Ga0496101_0037060_241_2577 718
180 3300032002 Ga0307416_100032345 Ga0307416_1000323453 719
181 3300048911 Ga0496108_0050045 Ga0496108_0050045_850_3261 719
182 3300048915 Ga0496112_0035155 Ga0496112_0035155_2047_4452 719
183 3300005406 Ga0070703_10002775 Ga0070703_100027754 720
184 3300005440 Ga0070705_100001456 Ga0070705_1000014569 720
185 3300005445 Ga0070708_100002244 Ga0070708_10000224416 720
186 3300005467 Ga0070706_100001656 Ga0070706_10000165616 720
187 3300005518 Ga0070699_100026887 Ga0070699_1000268874 720
188 3300005536 Ga0070697_100001122 Ga0070697_10000112214 720
189 3300005545 Ga0070695_100001346 Ga0070695_1000013467 720
190 3300005546 Ga0070696_100002232 Ga0070696_1000022324 720
191 3300005547 Ga0070693_100000295 Ga0070693_10000029513 720
192 3300005549 Ga0070704_100002299 Ga0070704_1000022999 720
193 3300005614 Ga0068856_100081964 Ga0068856_1000819642 720
194 3300005981 Ga0081538_10003168 Ga0081538_1000316812 720
195 3300025885 Ga0207653_10003362 Ga0207653_100033623 720
196 3300025910 Ga0207684_10006810 Ga0207684_100068101 720
197 3300025921 Ga0207652_10082700 Ga0207652_100827002 720
198 3300035086 Ga0373934_0002168 Ga0373934_0002168_4363_6573 720
199 3300035111 Ga0373923_0002299 Ga0373923_0002299_41_2251 720
200 3300035117 Ga0373953_0002942 Ga0373953_0002942_1372_3582 720
201 3300035119 Ga0373956_0010988 Ga0373956_0010988_132_2342 720
202 3300037068 Ga0373925_0008070 Ga0373925_0008070_4551_6761 720
203 3300045051 Ga0451576_0016035 Ga0451576_0016035_4867_7206 720
204 3300046454 Ga0495592_0031774 Ga0495592_0031774_110_2320 720
205 3300046463 Ga0495653_0002547 Ga0495653_0002547_12277_14487 720
206 3300046511 Ga0495608_0025250 Ga0495608_0025250_1281_3491 720
207 3300046516 Ga0495628_0016038 Ga0495628_0016038_2993_5203 720
208 3300046533 Ga0495640_0021018 Ga0495640_0021018_2023_4233 720
209 3300046535 Ga0495586_0029890 Ga0495586_0029890_565_2775 720
210 3300046675 Ga0495657_0004212 Ga0495657_0004212_4404_6614 720
211 3300046678 Ga0495599_0005873 Ga0495599_0005873_1813_4023 720
212 3300046689 Ga0495613_0038678 Ga0495613_0038678_913_3123 720
213 3300046809 Ga0495600_0006209 Ga0495600_0006209_4918_7128 720
214 3300047317 Ga0495604_0063499 Ga0495604_0063499_544_2754 720
215 3300047444 Ga0495675_0003519 Ga0495675_0003519_2654_4864 720
216 3300049585 Ga0501069_0019188 Ga0501069_0019188_35_2356 720
217 3300053085 Ga0495619_0006383 Ga0495619_0006383_1634_3844 720
218 3300006846 Ga0075430_100005138 Ga0075430_1000051388 721
219 3300028800 Ga0265338_10003096 Ga0265338_1000309614 721
220 3300021361 Ga0213872_10000811 Ga0213872_100008113 722
221 3300039447 Ga0436361_0259259 Ga0436361_0259259_2565_4850 722
222 3300039447 Ga0436361_0306192 Ga0436361_0306192_25869_28196 722
223 3300044673 Ga0453683_0000130 Ga0453683_0000130_54961_57267 722
224 3300044712 Ga0453684_0000306 Ga0453684_0000306_135184_137478 722
225 3300042876 Ga0451577_0006548 Ga0451577_0006548_2425_4722 723
226 3300045051 Ga0451576_0022735 Ga0451576_0022735_2427_4724 723
227 3300005563 Ga0068855_100027713 Ga0068855_1000277134 724
228 3300005614 Ga0068856_100001573 Ga0068856_10000157310 724
229 3300025949 Ga0207667_10017686 Ga0207667_100176867 724
230 3300026078 Ga0207702_10005990 Ga0207702_1000599010 724
231 3300048913 Ga0496110_0033412 Ga0496110_0033412_2078_4360 726
232 3300005435 Ga0070714_100000872 Ga0070714_10000087217 727
233 3300009094 Ga0111539_10034113 Ga0111539_100341131 727
234 3300009176 Ga0105242_10004057 Ga0105242_100040578 727
235 3300013308 Ga0157375_10023093 Ga0157375_100230932 727
236 3300025929 Ga0207664_10003416 Ga0207664_100034164 727
237 3300039437 Ga0436365_0829382 Ga0436365_0829382_13535_15886 727
238 3300045051 Ga0451576_0022762 Ga0451576_0022762_3782_6058 727
239 iso_pu_bacteria 2891554331 2891557389 727
240 3300005445 Ga0070708_100011559 Ga0070708_1000115594 728
241 3300005455 Ga0070663_100030270 Ga0070663_1000302702 728
242 3300005458 Ga0070681_10006936 Ga0070681_100069362 728
243 3300005467 Ga0070706_100006706 Ga0070706_1000067065 728
244 3300005468 Ga0070707_100041218 Ga0070707_1000412181 728
245 3300005471 Ga0070698_100004102 Ga0070698_1000041021 728
246 3300005518 Ga0070699_100009102 Ga0070699_1000091025 728
247 3300005530 Ga0070679_100004764 Ga0070679_10000476410 728
248 3300005536 Ga0070697_100001484 Ga0070697_10000148414 728
249 3300005614 Ga0068856_100004257 Ga0068856_10000425714 728
250 3300006038 Ga0075365_10015500 Ga0075365_100155002 728
251 3300006237 Ga0097621_100005320 Ga0097621_1000053202 728
252 3300006881 Ga0068865_100014504 Ga0068865_1000145047 728
253 3300009093 Ga0105240_10068849 Ga0105240_100688492 728
254 3300009174 Ga0105241_10054050 Ga0105241_100540502 728
255 3300009545 Ga0105237_10002481 Ga0105237_1000248117 728
256 3300009551 Ga0105238_10040502 Ga0105238_100405021 728
257 3300013105 Ga0157369_10030326 Ga0157369_100303265 728
258 3300025910 Ga0207684_10002897 Ga0207684_1000289710 728
259 3300025912 Ga0207707_10004083 Ga0207707_100040839 728
260 3300025913 Ga0207695_10099426 Ga0207695_100994262 728
261 3300025914 Ga0207671_10040184 Ga0207671_100401841 728
262 3300025916 Ga0207663_10023589 Ga0207663_100235893 728
263 3300025919 Ga0207657_10030218 Ga0207657_100302182 728
264 3300025921 Ga0207652_10002805 Ga0207652_1000280510 728
265 3300025922 Ga0207646_10009125 Ga0207646_1000912510 728
266 3300025924 Ga0207694_10042853 Ga0207694_100428532 728
267 3300025934 Ga0207686_10002621 Ga0207686_100026213 728
268 3300025938 Ga0207704_10014258 Ga0207704_100142584 728
269 3300025949 Ga0207667_10033874 Ga0207667_100338742 728
270 3300026067 Ga0207678_10017526 Ga0207678_100175262 728
271 3300026078 Ga0207702_10005253 Ga0207702_100052532 728
272 3300039450 Ga0436363_0558892 Ga0436363_0558892_638_2914 728
273 3300049585 Ga0501069_0002005 Ga0501069_0002005_4384_6687 728
274 3300049742 Ga0501080_0000484 Ga0501080_0000484_12431_14734 728
275 3300050492 nmdc:mga0yw44_8024_c1 nmdc:mga0yw44_8024_c1_1266_3623 728
276 iso_pu_bacteria 2891395885 2891399272 728
277 3300005295 Ga0065707_10081984 Ga0065707_100819846 729
278 3300005434 Ga0070709_10007885 Ga0070709_100078856 729
279 3300005435 Ga0070714_100039317 Ga0070714_1000393171 729
280 3300005436 Ga0070713_100037706 Ga0070713_1000377061 729
281 3300005548 Ga0070665_100000005 Ga0070665_100000005197 729
282 3300005842 Ga0068858_100048810 Ga0068858_1000488102 729
283 3300006028 Ga0070717_10004535 Ga0070717_100045356 729
284 3300006175 Ga0070712_100022276 Ga0070712_1000222763 729
285 3300006237 Ga0097621_100056628 Ga0097621_1000566281 729
286 3300006844 Ga0075428_100087943 Ga0075428_1000879432 729
287 3300006880 Ga0075429_100078001 Ga0075429_1000780012 729
288 3300006914 Ga0075436_100003333 Ga0075436_1000033334 729
289 3300007076 Ga0075435_100047496 Ga0075435_1000474963 729
290 3300009093 Ga0105240_10012786 Ga0105240_1001278611 729
291 3300009093 Ga0105240_10046551 Ga0105240_100465513 729
292 3300009093 Ga0105240_10054859 Ga0105240_100548592 729
293 3300009098 Ga0105245_10005955 Ga0105245_100059558 729
294 3300013105 Ga0157369_10102941 Ga0157369_101029412 729
295 3300013297 Ga0157378_10035214 Ga0157378_100352142 729
296 3300013307 Ga0157372_10004519 Ga0157372_1000451911 729
297 3300013307 Ga0157372_10058151 Ga0157372_100581513 729
298 3300021361 Ga0213872_10018339 Ga0213872_100183391 729
299 3300025913 Ga0207695_10008507 Ga0207695_1000850710 729
300 3300025913 Ga0207695_10062900 Ga0207695_100629002 729
301 3300025915 Ga0207693_10003993 Ga0207693_100039937 729
302 3300028379 Ga0268266_10000012 Ga0268266_10000012452 729
303 3300035083 Ga0373926_0004262 Ga0373926_0004262_1730_4024 729
304 3300035725 Ga0373947_0002484 Ga0373947_0002484_3966_6260 729
305 3300036401 Ga0373937_0013594 Ga0373937_0013594_2343_4637 729
306 3300037068 Ga0373925_0003855 Ga0373925_0003855_3860_6154 729
307 3300037068 Ga0373925_0026193 Ga0373925_0026193_1871_4159 729
308 3300037853 Ga0436364_0961538 Ga0436364_0961538_374_2665 729
309 3300039447 Ga0436361_0013419 Ga0436361_0013419_38_2332 729
310 3300046472 Ga0495580_0002418 Ga0495580_0002418_12865_15159 729
311 3300046472 Ga0495580_0004869 Ga0495580_0004869_3671_5965 729
312 3300046473 Ga0495582_0000413 Ga0495582_0000413_13828_16122 729
313 3300046514 Ga0495618_0005277 Ga0495618_0005277_4596_6887 729
314 3300046642 Ga0495634_0005921 Ga0495634_0005921_1546_3837 729
315 3300046689 Ga0495613_0005696 Ga0495613_0005696_953_3241 729
316 3300047315 Ga0495581_0005270 Ga0495581_0005270_1641_3935 729
317 3300047322 Ga0495680_0030067 Ga0495680_0030067_104_2395 729
318 3300050511 nmdc:mga08y16_89288_c1 nmdc:mga08y16_89288_c1_12_2291 729
319 3300050513 nmdc:mga0rr50_6120_c1 nmdc:mga0rr50_6120_c1_4109_6403 729
320 3300005578 Ga0068854_100020179 Ga0068854_1000201793 730
321 3300006038 Ga0075365_10000297 Ga0075365_1000029717 730
322 3300006038 Ga0075365_10013792 Ga0075365_100137924 730
323 3300006051 Ga0075364_10003478 Ga0075364_100034785 730
324 3300006051 Ga0075364_10028827 Ga0075364_100288272 730
325 3300009093 Ga0105240_10016140 Ga0105240_100161408 730
326 3300042876 Ga0451577_0069100 Ga0451577_0069100_685_3009 730
327 3300044712 Ga0453684_0155339 Ga0453684_0155339_95_2419 730
328 3300050491 nmdc:mga00v17_3015_c1 nmdc:mga00v17_3015_c1_4980_7280 730
329 3300050492 nmdc:mga0yw44_27164_c1 nmdc:mga0yw44_27164_c1_853_3195 730
330 3300006846 Ga0075430_100005816 Ga0075430_1000058162 732
331 3300006847 Ga0075431_100001497 Ga0075431_1000014979 732
332 3300042009 Ga0439451_000928 Ga0439451_000928_1726_4032 732
333 3300050508 nmdc:mga09592_4143_c1 nmdc:mga09592_4143_c1_2846_5176 732
334 3300050509 nmdc:mga0qj67_4250_c1 nmdc:mga0qj67_4250_c1_1922_4252 732
335 iso_pu_bacteria 2558860112 2558914799 732
336 3300005577 Ga0068857_100023534 Ga0068857_1000235343 733
337 3300005985 Ga0081539_10002861 Ga0081539_1000286110 733
338 3300006844 Ga0075428_100005809 Ga0075428_10000580915 733
339 3300006846 Ga0075430_100003638 Ga0075430_1000036382 733
340 3300009094 Ga0111539_10042459 Ga0111539_100424593 733
341 3300009147 Ga0114129_10002027 Ga0114129_1000202714 733
342 3300025949 Ga0207667_10111411 Ga0207667_101114111 733
343 3300026116 Ga0207674_10045260 Ga0207674_100452603 733
344 3300027907 Ga0207428_10050645 Ga0207428_100506452 733
345 3300031548 Ga0307408_100012298 Ga0307408_1000122983 733
346 3300031824 Ga0307413_10001002 Ga0307413_100010026 733
347 3300031911 Ga0307412_10025210 Ga0307412_100252101 733
348 3300031995 Ga0307409_100020077 Ga0307409_1000200774 733
349 3300031995 Ga0307409_100080824 Ga0307409_1000808241 733
350 3300032126 Ga0307415_100012395 Ga0307415_1000123952 733
351 3300032126 Ga0307415_100018805 Ga0307415_1000188054 733
352 3300044712 Ga0453684_0037081 Ga0453684_0037081_3744_6077 733
353 3300049575 Ga0501039_0015679 Ga0501039_0015679_743_3082 733
354 3300050492 nmdc:mga0yw44_30676_c1 nmdc:mga0yw44_30676_c1_641_2989 733
355 3300050507 nmdc:mga05p37_1595_c1 nmdc:mga05p37_1595_c1_8986_11319 733
356 3300050508 nmdc:mga09592_33132_c1 nmdc:mga09592_33132_c1_1213_3546 733
357 3300050509 nmdc:mga0qj67_26132_c1 nmdc:mga0qj67_26132_c1_1445_3778 733
358 3300050511 nmdc:mga08y16_39169_c1 nmdc:mga08y16_39169_c1_1234_3570 733
359 iso_pu_bacteria 2842134933 2842138796 733
360 3300005981 Ga0081538_10016936 Ga0081538_100169362 734
361 3300006844 Ga0075428_100041964 Ga0075428_1000419643 734
362 3300006846 Ga0075430_100002488 Ga0075430_1000024888 734
363 3300006847 Ga0075431_100006457 Ga0075431_1000064577 734
364 3300050509 nmdc:mga0qj67_1688_c1 nmdc:mga0qj67_1688_c1_5817_8147 734
365 3300050510 nmdc:mga06r32_5717_c1 nmdc:mga06r32_5717_c1_4439_6769 734
366 3300036647 Ga0316582_0025860 Ga0316582_0025860_775_3021 735
367 3300049130 Ga0501310_000308 Ga0501310_000308_1991_4324 735
368 3300053154 Ga0500619_000019 Ga0500619_000019_14751_17060 735
369 iso_pu_bacteria 2738543005 2739206295 735
370 3300005339 Ga0070660_100033687 Ga0070660_1000336873 736
371 3300005937 Ga0081455_10029734 Ga0081455_100297342 736
372 3300014497 Ga0182008_10000720 Ga0182008_1000072012 736
373 3300015262 Ga0182007_10000119 Ga0182007_1000011956 736
374 3300031995 Ga0307409_100050642 Ga0307409_1000506421 736
375 iso_pu_bacteria 2855386786 2855387357 736
376 3300049568 Ga0501031_0011811 Ga0501031_0011811_2371_4779 737
377 3300049575 Ga0501039_0022829 Ga0501039_0022829_1133_3541 737
378 3300049576 Ga0501040_0026961 Ga0501040_0026961_163_2571 737
379 3300049580 Ga0501046_0048393 Ga0501046_0048393_255_2663 737
380 3300049584 Ga0501068_0016956 Ga0501068_0016956_1291_3699 737
381 3300049587 Ga0501071_0013274 Ga0501071_0013274_157_2565 737
382 3300049591 Ga0501075_0028103 Ga0501075_0028103_1431_3839 737
383 3300060353 Ga0501082_0032968 Ga0501082_0032968_679_3087 737
384 3300025922 Ga0207646_10017582 Ga0207646_100175826 738
385 3300046511 Ga0495608_0001600 Ga0495608_0001600_9353_11665 738
386 3300005336 Ga0070680_100000220 Ga0070680_10000022019 739
387 3300005444 Ga0070694_100014518 Ga0070694_1000145186 739
388 3300005458 Ga0070681_10025967 Ga0070681_100259674 739
389 3300005468 Ga0070707_100001104 Ga0070707_10000110412 739
390 3300005518 Ga0070699_100001129 Ga0070699_10000112911 739
391 3300005530 Ga0070679_100003375 Ga0070679_1000033756 739
392 3300005536 Ga0070697_100003818 Ga0070697_10000381810 739
393 3300005545 Ga0070695_100009252 Ga0070695_1000092525 739
394 3300005546 Ga0070696_100004515 Ga0070696_1000045158 739
395 3300005547 Ga0070693_100006307 Ga0070693_1000063075 739
396 3300005549 Ga0070704_100007594 Ga0070704_1000075945 739
397 3300005563 Ga0068855_100001151 Ga0068855_10000115116 739
398 3300005578 Ga0068854_100000264 Ga0068854_10000026412 739
399 3300005614 Ga0068856_100025033 Ga0068856_1000250336 739
400 3300006173 Ga0070716_100029671 Ga0070716_1000296711 739
401 3300006175 Ga0070712_100013453 Ga0070712_1000134532 739
402 3300025906 Ga0207699_10024681 Ga0207699_100246812 739
403 3300025911 Ga0207654_10000309 Ga0207654_1000030911 739
404 3300025912 Ga0207707_10000829 Ga0207707_1000082918 739
405 3300025913 Ga0207695_10021576 Ga0207695_100215765 739
406 3300025915 Ga0207693_10016792 Ga0207693_100167924 739
407 3300025917 Ga0207660_10010927 Ga0207660_100109274 739
408 3300025921 Ga0207652_10016912 Ga0207652_100169125 739
409 3300025939 Ga0207665_10028307 Ga0207665_100283072 739
410 3300025949 Ga0207667_10017582 Ga0207667_100175825 739
411 3300026078 Ga0207702_10025399 Ga0207702_100253994 739
412 3300025940 Ga0207691_10018788 Ga0207691_100187881 741
413 3300041486 Ga0451807_2610835 Ga0451807_2610835_318_2612 742
414 3300005339 Ga0070660_100006725 Ga0070660_1000067252 743
415 3300005344 Ga0070661_100000442 Ga0070661_10000044225 743
416 3300005366 Ga0070659_100022698 Ga0070659_1000226981 743
417 3300005530 Ga0070679_100107445 Ga0070679_1001074452 743
418 3300005535 Ga0070684_100006299 Ga0070684_1000062993 743
419 3300005539 Ga0068853_100059051 Ga0068853_1000590512 743
420 3300005564 Ga0070664_100014276 Ga0070664_1000142766 743
421 3300005577 Ga0068857_100001129 Ga0068857_1000011297 743
422 3300005614 Ga0068856_100027971 Ga0068856_1000279716 743
423 3300005616 Ga0068852_100003542 Ga0068852_1000035422 743
424 3300009093 Ga0105240_10006835 Ga0105240_1000683518 743
425 3300009093 Ga0105240_10021976 Ga0105240_100219763 743
426 3300009174 Ga0105241_10028095 Ga0105241_100280952 743
427 3300009545 Ga0105237_10002758 Ga0105237_1000275820 743
428 3300009545 Ga0105237_10043839 Ga0105237_100438393 743
429 3300013100 Ga0157373_10026043 Ga0157373_100260432 743
430 3300013102 Ga0157371_10010752 Ga0157371_100107522 743
431 3300013104 Ga0157370_10008065 Ga0157370_100080659 743
432 3300013105 Ga0157369_10026883 Ga0157369_100268831 743
433 3300013307 Ga0157372_10074061 Ga0157372_100740612 743
434 3300025250 Ga0209026_1004101 Ga0209026_10041013 743
435 3300025256 Ga0209759_1003490 Ga0209759_10034902 743
436 3300025272 Ga0209455_1000151 Ga0209455_100015129 743
437 3300025911 Ga0207654_10013085 Ga0207654_100130852 743
438 3300025913 Ga0207695_10023730 Ga0207695_100237303 743
439 3300025914 Ga0207671_10016749 Ga0207671_100167491 743
440 3300025919 Ga0207657_10011933 Ga0207657_100119339 743
441 3300025921 Ga0207652_10082698 Ga0207652_100826981 743
442 3300025924 Ga0207694_10006112 Ga0207694_100061123 743
443 3300025929 Ga0207664_10014221 Ga0207664_100142214 743
444 3300025945 Ga0207679_10001606 Ga0207679_100016063 743
445 3300025949 Ga0207667_10024812 Ga0207667_100248122 743
446 3300025949 Ga0207667_10028456 Ga0207667_100284565 743
447 3300026078 Ga0207702_10010382 Ga0207702_100103821 743
448 3300026116 Ga0207674_10000545 Ga0207674_1000054530 743
449 3300026142 Ga0207698_10004012 Ga0207698_100040127 743
450 3300049586 Ga0501070_0049236 Ga0501070_0049236_287_2587 744
451 3300025981 Ga0207640_10039381 Ga0207640_100393812 745
452 3300044712 Ga0453684_0042322 Ga0453684_0042322_1113_3395 745
453 3300049586 Ga0501070_0050287 Ga0501070_0050287_77_2377 745
454 3300005327 Ga0070658_10019021 Ga0070658_100190213 747
455 3300005336 Ga0070680_100026632 Ga0070680_1000266322 747
456 3300005366 Ga0070659_100009381 Ga0070659_1000093815 747
457 3300005458 Ga0070681_10064082 Ga0070681_100640822 747
458 3300005530 Ga0070679_100025625 Ga0070679_1000256253 747
459 3300005563 Ga0068855_100093402 Ga0068855_1000934021 747
460 3300005577 Ga0068857_100050763 Ga0068857_1000507632 747
461 3300009545 Ga0105237_10027552 Ga0105237_100275524 747
462 3300013102 Ga0157371_10018158 Ga0157371_100181586 747
463 3300013307 Ga0157372_10116464 Ga0157372_101164641 747
464 3300025912 Ga0207707_10028455 Ga0207707_100284552 747
465 3300025921 Ga0207652_10048349 Ga0207652_100483493 747
466 3300025932 Ga0207690_10028895 Ga0207690_100288952 747
467 3300025949 Ga0207667_10093106 Ga0207667_100931062 747
468 3300025981 Ga0207640_10010970 Ga0207640_100109703 747
469 3300026067 Ga0207678_10025723 Ga0207678_100257235 747
470 3300049822 Ga0501035_0003222 Ga0501035_0003222_9124_11433 747
471 3300049823 Ga0501044_0012042 Ga0501044_0012042_4655_6964 747
472 3300005841 Ga0068863_100088822 Ga0068863_1000888222 748
473 3300046511 Ga0495608_0010440 Ga0495608_0010440_1400_3682 748
474 3300046559 Ga0495667_0000278 Ga0495667_0000278_8595_10877 748
475 3300005344 Ga0070661_100016691 Ga0070661_1000166912 749
476 3300009545 Ga0105237_10022252 Ga0105237_100222525 749
477 3300025904 Ga0207647_10002407 Ga0207647_100024078 749
478 3300025919 Ga0207657_10007736 Ga0207657_100077365 749
479 3300025932 Ga0207690_10004619 Ga0207690_100046196 749
480 3300025933 Ga0207706_10006836 Ga0207706_100068368 749
481 3300025949 Ga0207667_10020791 Ga0207667_100207913 749
482 3300049822 Ga0501035_0081612 Ga0501035_0081612_236_2587 749
483 3300049823 Ga0501044_0022787 Ga0501044_0022787_80_2431 749
484 3300028794 Ga0307515_10003432 Ga0307515_100034329 751
485 3300005435 Ga0070714_100028495 Ga0070714_1000284954 752
486 3300025929 Ga0207664_10026108 Ga0207664_100261084 752
487 3300049744 Ga0501083_0033535 Ga0501083_0033535_744_3056 753
488 3300005339 Ga0070660_100019147 Ga0070660_1000191473 754
489 3300005458 Ga0070681_10000099 Ga0070681_1000009924 754
490 3300013104 Ga0157370_10036401 Ga0157370_100364012 754
491 3300013105 Ga0157369_10069526 Ga0157369_100695262 754
492 3300025912 Ga0207707_10000128 Ga0207707_100001287 754
493 3300025919 Ga0207657_10017493 Ga0207657_100174934 754
494 3300009093 Ga0105240_10009341 Ga0105240_100093415 755
495 3300009094 Ga0111539_10006023 Ga0111539_100060237 755
496 3300009098 Ga0105245_10005760 Ga0105245_100057608 755
497 3300009174 Ga0105241_10000844 Ga0105241_1000084411 755
498 3300009545 Ga0105237_10005799 Ga0105237_100057998 755
499 3300013100 Ga0157373_10011109 Ga0157373_100111095 755
500 3300013104 Ga0157370_10007936 Ga0157370_100079364 755
501 3300013307 Ga0157372_10001074 Ga0157372_1000107416 755
502 3300050511 nmdc:mga08y16_18544_c1 nmdc:mga08y16_18544_c1_1139_3451 755
503 3300009093 Ga0105240_10068000 Ga0105240_100680002 756
504 3300025913 Ga0207695_10026148 Ga0207695_100261485 756
505 iso_pu_bacteria 2537561836 2538833742 756
506 iso_pu_bacteria 2643221562 2643831068 756
507 iso_pu_bacteria 2883291878 2883292593 756
508 iso_pu_bacteria 2895395659 2895396262 756
509 3300005366 Ga0070659_100037459 Ga0070659_1000374592 757
510 3300005530 Ga0070679_100106657 Ga0070679_1001066571 757
511 3300005563 Ga0068855_100001853 Ga0068855_10000185318 757
512 3300025932 Ga0207690_10012223 Ga0207690_100122232 757
513 3300025949 Ga0207667_10002534 Ga0207667_100025343 757
514 3300026067 Ga0207678_10087243 Ga0207678_100872431 757
515 3300044712 Ga0453684_0058424 Ga0453684_0058424_1211_3544 757
516 3300053093 Ga0500651_0008389 Ga0500651_0008389_3667_5961 757
517 3300005327 Ga0070658_10041659 Ga0070658_100416591 758
518 3300025909 Ga0207705_10044927 Ga0207705_100449271 758
519 3300046472 Ga0495580_0065513 Ga0495580_0065513_60_2372 758
520 3300046526 Ga0495666_0009232 Ga0495666_0009232_2321_4633 758
521 3300049579 Ga0501043_0002546 Ga0501043_0002546_5798_8104 758
522 3300049580 Ga0501046_0003075 Ga0501046_0003075_7305_9611 758
523 3300049581 Ga0501047_0000298 Ga0501047_0000298_47431_49737 758
524 iso_pu_bacteria 2939611941 2939614614 758
525 3300005458 Ga0070681_10023219 Ga0070681_100232194 759
526 3300005578 Ga0068854_100041686 Ga0068854_1000416863 759
527 3300013104 Ga0157370_10004714 Ga0157370_100047142 759
528 3300013105 Ga0157369_10000191 Ga0157369_1000019146 759
529 3300013307 Ga0157372_10018328 Ga0157372_100183283 759
530 iso_pu_bacteria 2643221577 2643896379 759
531 iso_pu_bacteria 2643221685 2644478860 759
532 3300005337 Ga0070682_100002070 Ga0070682_1000020705 760
533 3300005366 Ga0070659_100018001 Ga0070659_1000180012 760
534 3300005458 Ga0070681_10014204 Ga0070681_100142045 760
535 3300005530 Ga0070679_100133524 Ga0070679_1001335241 760
536 3300005539 Ga0068853_100019581 Ga0068853_1000195811 760
537 3300005539 Ga0068853_100058872 Ga0068853_1000588721 760
538 3300005546 Ga0070696_100015156 Ga0070696_1000151562 760
539 3300005563 Ga0068855_100012611 Ga0068855_1000126112 760
540 3300013100 Ga0157373_10004598 Ga0157373_1000459810 760
541 3300013102 Ga0157371_10010207 Ga0157371_100102072 760
542 3300013104 Ga0157370_10044230 Ga0157370_100442304 760
543 3300013307 Ga0157372_10040910 Ga0157372_100409105 760
544 3300025912 Ga0207707_10013471 Ga0207707_100134714 760
545 3300025932 Ga0207690_10033828 Ga0207690_100338282 760
546 3300025949 Ga0207667_10011114 Ga0207667_100111145 760
547 3300026041 Ga0207639_10006352 Ga0207639_100063527 760
548 3300045051 Ga0451576_0012158 Ga0451576_0012158_6767_9106 760
549 3300049571 Ga0501034_0010411 Ga0501034_0010411_6645_9086 760
550 3300049573 Ga0501037_0025396 Ga0501037_0025396_1364_3805 760
551 3300049822 Ga0501035_0064939 Ga0501035_0064939_200_2641 760
552 3300049823 Ga0501044_0080958 Ga0501044_0080958_181_2622 760
553 3300005546 Ga0070696_100001810 Ga0070696_1000018104 761
554 3300046471 Ga0495650_0000061 Ga0495650_0000061_95901_98207 761
555 3300025928 Ga0207700_10070096 Ga0207700_100700962 762
556 3300046457 Ga0495590_0000005 Ga0495590_0000005_180252_182597 762
557 3300046460 Ga0495638_0000105 Ga0495638_0000105_11209_13518 762
558 3300046471 Ga0495650_0002094 Ga0495650_0002094_11189_13498 762
559 3300046475 Ga0495639_0000560 Ga0495639_0000560_12401_14710 762
560 3300046506 Ga0495583_0000740 Ga0495583_0000740_28007_30316 762
561 3300046524 Ga0495648_0000008 Ga0495648_0000008_243676_245985 762
562 3300046528 Ga0495642_0000948 Ga0495642_0000948_9132_11441 762
563 3300046538 Ga0495609_0004469 Ga0495609_0004469_4553_6862 762
564 3300046557 Ga0495622_0000280 Ga0495622_0000280_11324_13633 762
565 3300046558 Ga0495633_0000238 Ga0495633_0000238_11323_13632 762
566 3300046616 Ga0495668_0000065 Ga0495668_0000065_154217_156562 762
567 3300046660 Ga0495625_0000954 Ga0495625_0000954_24917_27226 762
568 3300046810 Ga0495660_0003991 Ga0495660_0003991_1638_3983 762
569 3300048913 Ga0496110_0002400 Ga0496110_0002400_2339_4675 762
570 3300048914 Ga0496111_0002866 Ga0496111_0002866_802_3138 762
571 3300049459 Ga0495678_006025 Ga0495678_006025_1083_3392 762
572 3300049459 Ga0495678_012546 Ga0495678_012546_1196_3541 762
573 3300049585 Ga0501069_0010891 Ga0501069_0010891_2214_4736 762
574 3300049586 Ga0501070_0003957 Ga0501070_0003957_5374_7689 762
575 3300049589 Ga0501073_0005956 Ga0501073_0005956_2635_4950 762
576 3300049744 Ga0501083_0003320 Ga0501083_0003320_6960_9275 762
577 3300009098 Ga0105245_10073375 Ga0105245_100733752 763
578 3300013104 Ga0157370_10035733 Ga0157370_100357333 763
579 3300003794 Ga0055531_10000052 Ga0055531_1000005270 764
580 3300005344 Ga0070661_100000034 Ga0070661_1000000342 764
581 3300009176 Ga0105242_10047060 Ga0105242_100470601 764
582 3300025298 Ga0209050_1003113 Ga0209050_10031132 764
583 3300025304 Ga0209257_1000021 Ga0209257_1000021656 764
584 3300025913 Ga0207695_10065293 Ga0207695_100652934 764
585 3300025920 Ga0207649_10000045 Ga0207649_100000452 764
586 3300048925 Ga0496122_0002269 Ga0496122_0002269_22974_25286 764
587 3300026095 Ga0207676_10003457 Ga0207676_100034572 765
588 iso_pu_bacteria 2643221644 2644243107 765
589 iso_pu_bacteria 2643221646 2644258000 765
590 iso_pu_bacteria 2739367664 2739652386 765
591 iso_pu_bacteria 2739367865 2740030860 765
592 3300005364 Ga0070673_100002604 Ga0070673_1000026046 766
593 3300025960 Ga0207651_10001351 Ga0207651_100013515 766
594 3300001979 JGI24740J21852_10000067 JGI24740J21852_1000006716 768
595 3300005327 Ga0070658_10000088 Ga0070658_1000008868 768
596 3300005563 Ga0068855_100000173 Ga0068855_10000017319 768
597 3300005577 Ga0068857_100000037 Ga0068857_10000003752 768
598 3300005578 Ga0068854_100000155 Ga0068854_10000015527 768
599 3300005614 Ga0068856_100011636 Ga0068856_1000116365 768
600 3300005616 Ga0068852_100000060 Ga0068852_10000006011 768
601 3300009093 Ga0105240_10001752 Ga0105240_1000175229 768
602 3300009545 Ga0105237_10000378 Ga0105237_1000037866 768
603 3300009551 Ga0105238_10003191 Ga0105238_100031918 768
604 3300010375 Ga0105239_10000232 Ga0105239_1000023265 768
605 3300013100 Ga0157373_10004623 Ga0157373_100046237 768
606 3300013104 Ga0157370_10001010 Ga0157370_100010108 768
607 3300013307 Ga0157372_10003085 Ga0157372_1000308512 768
608 3300025909 Ga0207705_10000138 Ga0207705_1000013819 768
609 3300025913 Ga0207695_10008932 Ga0207695_100089327 768
610 3300025914 Ga0207671_10000222 Ga0207671_1000022220 768
611 3300025949 Ga0207667_10000001 Ga0207667_10000001666 768
612 3300025981 Ga0207640_10000041 Ga0207640_1000004184 768
613 3300026041 Ga0207639_10000081 Ga0207639_1000008166 768
614 3300026078 Ga0207702_10008745 Ga0207702_100087455 768
615 3300026116 Ga0207674_10001824 Ga0207674_100018247 768
616 3300026142 Ga0207698_10000054 Ga0207698_1000005465 768
617 3300053148 Ga0500590_000002 Ga0500590_000002_69957_72311 768
618 3300001904 JGI24736J21556_1000979 JGI24736J21556_10009793 769
619 3300001979 JGI24740J21852_10000027 JGI24740J21852_1000002728 769
620 3300002067 JGI24735J21928_10000290 JGI24735J21928_100002906 769
621 3300005289 Ga0065704_10080853 Ga0065704_100808533 769
622 3300005327 Ga0070658_10051938 Ga0070658_100519383 769
623 3300005563 Ga0068855_100007890 Ga0068855_10000789017 769
624 3300005563 Ga0068855_100016025 Ga0068855_1000160255 769
625 3300005577 Ga0068857_100039091 Ga0068857_1000390912 769
626 3300005616 Ga0068852_100011081 Ga0068852_1000110813 769
627 3300009011 Ga0105251_10000071 Ga0105251_1000007117 769
628 3300009551 Ga0105238_10011466 Ga0105238_100114666 769
629 3300009551 Ga0105238_10052291 Ga0105238_100522913 769
630 3300013104 Ga0157370_10007614 Ga0157370_100076147 769
631 3300013104 Ga0157370_10028669 Ga0157370_100286696 769
632 3300013105 Ga0157369_10058846 Ga0157369_100588463 769
633 3300025735 Ga0207713_1001241 Ga0207713_100124120 769
634 3300025904 Ga0207647_10000037 Ga0207647_1000003757 769
635 3300025909 Ga0207705_10002495 Ga0207705_1000249519 769
636 3300025913 Ga0207695_10093082 Ga0207695_100930822 769
637 3300025924 Ga0207694_10016693 Ga0207694_100166932 769
638 3300025949 Ga0207667_10004327 Ga0207667_1000432716 769
639 3300026041 Ga0207639_10033829 Ga0207639_100338292 769
640 3300026142 Ga0207698_10020871 Ga0207698_100208713 769
641 3300048903 Ga0496100_0000293 Ga0496100_0000293_5967_8294 769
642 3300048909 Ga0496106_0000047 Ga0496106_0000047_62743_65070 769
643 3300048910 Ga0496107_0000232 Ga0496107_0000232_4514_6841 769
644 3300048919 Ga0496116_0000193 Ga0496116_0000193_22316_24643 769
645 3300048920 Ga0496117_0001656 Ga0496117_0001656_22230_24557 769
646 3300048921 Ga0496118_0000156 Ga0496118_0000156_22658_24985 769
647 3300048928 Ga0496125_0004416 Ga0496125_0004416_11487_13814 769

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22085

NorB_cytochrome_c-like

Nitric oxide reductase subunit B, cytochrome c-like domain

93

267

0.99

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

330

784

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qq6-assembly1.cif.gz_B cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) val495ala mutant from alcaligenes xylosoxidans 0.9301 14 750
3ayf-assembly1.cif.gz_A crystal structure of nitric oxide reductase 0.9264 15 751
6qq6-assembly1.cif.gz_B cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) val495ala mutant from alcaligenes xylosoxidans 0.9215 14 750
8bgw-assembly1.cif.gz_B cryoem structure of quinol-dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans at 2.2 a resolution 0.9111 18 757
6qq5-assembly1.cif.gz_B cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans 0.9055 18 750
ID Description Score Start End Superfamily
3aygA01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9186 234 751 1.20.210.10
3aygA01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8438 234 751 1.20.210.10
4xydA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8414 285 755 1.20.210.10
4xydA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8218 285 755 1.20.210.10
5djqA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.7156 274 760 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A328ZV12-F1-model_v4 deleted 0.9904 622 758
AF-A0A539E8K1-F1-model_v4 Nitric oxide reductase subunit B 0.987 640 753 GO:0016020
AF-A0A522JJ32-F1-model_v4 Nitric-oxide reductase large subunit 0.9852 15 173 GO:0016020
AF-A0A2E5Y8S1-F1-model_v4 Nitric-oxide reductase large subunit 0.9833 29 757 GO:0004129
GO:0009060
GO:0016020
GO:0020037
AF-A0A7R7TWK5-F1-model_v4 Nitric oxide reductase 0.9809 597 754 GO:0004129
GO:0009060
GO:0016020
GO:0020037

Feature Viewer

pLDDT pTM Quality
87.65 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map