F472322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 647 | 321 | 630 | 758 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0010411|Ga0501034_0010411_6645_9086 |
| Length | 813 |
| Sequence | MRVPGSMAAASAICRPVRHARRGRLVTLVASRRLHSLILPEEATMNEAAHALPDDDAELSPWWLRTVAIVLVVGFAGLLAITSLAYRNAPPIPARVVDAQGALLFSGDDVRAGQAVFLRYGLMDNGSIWGHGAYLGPDYSAEALHRLGEDTAAAIAGSQYGKSMDELDAQHQAAVRAETAVVLKTNRYDVQTGVLQLTEAEAAAYRQQIGYWTDYFKDPTKNGGLRPGLISDPAELHQFTAFVTWAAWASVATRPGTDASYTNNFPYDPSVGNVPTGSALLWSALSLLVLLAGIATVLLAFGKFDYLGWISRGHHVHPQLLPGQAGAGQRALMKFFVVVALLFLMQTLVGGGVAHFRADPGSFYGFQLENIFPSNLLRTWHLQTAIFWIATAYVAAALFLGRSLRAPDDEPRWLSGWVHLLFAAFVVVIGGSLLGVWAGIEQKLGNLWFWFGDQGWEYLELGRAWQYLLVVGLLVWFAILWVLARPRAVANEAARPLARMFMFAAVAIPVFYVPAVFFGAETNYTVVDTWRFWIIHLWVEGFFEFFATTVVALTFYQLGLTRRNVALRVIYLDAILYFLGGLIGTGHHWYFTGHTNFNMALSALFSVLEVVPLTLLTLDAWDFVRTTRGDCAVCGKAVKVPHKWTFYFLMAVGFWNFVGAGMFGFFLNLPIVSYYEVGTQVTPTHGHAALMGVFGMLAIALMVFCLRQVSSDARWPGIEKYVKFAFWGTNIGLMLMILMSLFPSGVMQLWDVVEHGYWHARSVEYMATSRSHLVEWLRLPGDLIFIIFGAIPLLIASVKGWLGVRADARAQAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 4 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 5 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 6 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 7 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 8 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 9 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 10 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 11 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 12 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 13 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 14 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 15 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 16 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 17 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 278 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 317 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.22 |
| Metatranscriptomes | 0.15 |
| Isolates | 2.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.63 |
| Nodule | 0.15 |
| Rhizoplane | 4.33 |
| Rhizosphere | 88.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000979 | 3300001904 | Bacteria | 5257 |
| 2 | JGI24740J21852_10000027 | 3300001979 | Bacteria | 48883 |
| 3 | JGI24740J21852_10000067 | 3300001979 | Bacteria | 34146 |
| 4 | JGI24737J22298_10008703 | 3300001990 | Bacteria | 3392 |
| 5 | JGI24735J21928_10000290 | 3300002067 | Bacteria | 17505 |
| 6 | JGI24034J26672_10000065 | 3300002239 | Bacteria | 37437 |
| 7 | JGI25407J50210_10001083 | 3300003373 | Bacteria | 5993 |
| 8 | Ga0055531_10000052 | 3300003794 | Bacteria | 125395 |
| 9 | Ga0065704_10080853 | 3300005289 | Bacteria | 3868 |
| 10 | Ga0065707_10002102 | 3300005295 | Bacteria | 5026 |
| 11 | Ga0065707_10081984 | 3300005295 | Bacteria | 26228 |
| 12 | Ga0070658_10000088 | 3300005327 | Bacteria | 85441 |
| 13 | Ga0070658_10019021 | 3300005327 | Bacteria | 5502 |
| 14 | Ga0070658_10041659 | 3300005327 | Bacteria | 3705 |
| 15 | Ga0070658_10051938 | 3300005327 | Bacteria | 3323 |
| 16 | Ga0070683_100017433 | 3300005329 | Bacteria | 6348 |
| 17 | Ga0070683_100038094 | 3300005329 | Bacteria | 4404 |
| 18 | Ga0070680_100000220 | 3300005336 | Bacteria | 37754 |
| 19 | Ga0070680_100026632 | 3300005336 | Bacteria | 4624 |
| 20 | Ga0070682_100002070 | 3300005337 | Bacteria | 11164 |
| 21 | Ga0068868_100020752 | 3300005338 | Bacteria | 4942 |
| 22 | Ga0070660_100006725 | 3300005339 | Bacteria | 7976 |
| 23 | Ga0070660_100019147 | 3300005339 | Bacteria | 5011 |
| 24 | Ga0070660_100033687 | 3300005339 | Bacteria | 3863 |
| 25 | Ga0070689_100009969 | 3300005340 | Bacteria | 6759 |
| 26 | Ga0070661_100000034 | 3300005344 | Bacteria | 111603 |
| 27 | Ga0070661_100000442 | 3300005344 | Bacteria | 31824 |
| 28 | Ga0070661_100016691 | 3300005344 | Bacteria | 5195 |
| 29 | Ga0070675_100013247 | 3300005354 | Bacteria | 6480 |
| 30 | Ga0070673_100002604 | 3300005364 | Bacteria | 11025 |
| 31 | Ga0070688_100006583 | 3300005365 | Bacteria | 6217 |
| 32 | Ga0070659_100009381 | 3300005366 | Bacteria | 7187 |
| 33 | Ga0070659_100018001 | 3300005366 | Bacteria | 5326 |
| 34 | Ga0070659_100022698 | 3300005366 | Bacteria | 4793 |
| 35 | Ga0070659_100024433 | 3300005366 | Bacteria | 4633 |
| 36 | Ga0070659_100037459 | 3300005366 | Bacteria | 3781 |
| 37 | Ga0070703_10002775 | 3300005406 | Bacteria | 5021 |
| 38 | Ga0070709_10007885 | 3300005434 | Bacteria | 5848 |
| 39 | Ga0070714_100000872 | 3300005435 | Bacteria | 21399 |
| 40 | Ga0070714_100014518 | 3300005435 | Bacteria | 6330 |
| 41 | Ga0070714_100028495 | 3300005435 | Bacteria | 4635 |
| 42 | Ga0070714_100039317 | 3300005435 | Bacteria | 3982 |
| 43 | Ga0070713_100037706 | 3300005436 | Bacteria | 3909 |
| 44 | Ga0070705_100001456 | 3300005440 | Bacteria | 12510 |
| 45 | Ga0070700_100005940 | 3300005441 | Bacteria | 6487 |
| 46 | Ga0070700_100013333 | 3300005441 | Bacteria | 4616 |
| 47 | Ga0070694_100014518 | 3300005444 | Bacteria | 4932 |
| 48 | Ga0070708_100002244 | 3300005445 | Bacteria | 14935 |
| 49 | Ga0070708_100011559 | 3300005445 | Bacteria | 7187 |
| 50 | Ga0070663_100018991 | 3300005455 | Bacteria | 4520 |
| 51 | Ga0070663_100030270 | 3300005455 | Bacteria | 3707 |
| 52 | Ga0070662_100036457 | 3300005457 | Bacteria | 3479 |
| 53 | Ga0070681_10000099 | 3300005458 | Bacteria | 64409 |
| 54 | Ga0070681_10006936 | 3300005458 | Bacteria | 11026 |
| 55 | Ga0070681_10014204 | 3300005458 | Bacteria | 7924 |
| 56 | Ga0070681_10023219 | 3300005458 | Bacteria | 6237 |
| 57 | Ga0070681_10025967 | 3300005458 | Bacteria | 5889 |
| 58 | Ga0070681_10031227 | 3300005458 | Bacteria | 5346 |
| 59 | Ga0070681_10064082 | 3300005458 | Bacteria | 3647 |
| 60 | Ga0070681_10088473 | 3300005458 | Bacteria | 3049 |
| 61 | Ga0070685_10002004 | 3300005466 | Bacteria | 10557 |
| 62 | Ga0070706_100001656 | 3300005467 | Bacteria | 23195 |
| 63 | Ga0070706_100006706 | 3300005467 | Bacteria | 10868 |
| 64 | Ga0070707_100001104 | 3300005468 | Bacteria | 26642 |
| 65 | Ga0070707_100041218 | 3300005468 | Bacteria | 4418 |
| 66 | Ga0070698_100004102 | 3300005471 | Bacteria | 16003 |
| 67 | Ga0070699_100001129 | 3300005518 | Bacteria | 24878 |
| 68 | Ga0070699_100006903 | 3300005518 | Bacteria | 9872 |
| 69 | Ga0070699_100009102 | 3300005518 | Bacteria | 8609 |
| 70 | Ga0070699_100026887 | 3300005518 | Unclassified | 4963 |
| 71 | Ga0070679_100003375 | 3300005530 | Bacteria | 14634 |
| 72 | Ga0070679_100004764 | 3300005530 | Bacteria | 12511 |
| 73 | Ga0070679_100025625 | 3300005530 | Bacteria | 5788 |
| 74 | Ga0070679_100106657 | 3300005530 | Bacteria | 2787 |
| 75 | Ga0070679_100107445 | 3300005530 | Bacteria | 2776 |
| 76 | Ga0070679_100133524 | 3300005530 | Bacteria | 2463 |
| 77 | Ga0070684_100006299 | 3300005535 | Bacteria | 9169 |
| 78 | Ga0070697_100001122 | 3300005536 | Bacteria | 20239 |
| 79 | Ga0070697_100001484 | 3300005536 | Bacteria | 17845 |
| 80 | Ga0070697_100003818 | 3300005536 | Bacteria | 11569 |
| 81 | Ga0068853_100019193 | 3300005539 | Bacteria | 5666 |
| 82 | Ga0068853_100019581 | 3300005539 | Bacteria | 5614 |
| 83 | Ga0068853_100047802 | 3300005539 | Bacteria | 3672 |
| 84 | Ga0068853_100058872 | 3300005539 | Bacteria | 3317 |
| 85 | Ga0068853_100059051 | 3300005539 | Bacteria | 3313 |
| 86 | Ga0070695_100001346 | 3300005545 | Bacteria | 13619 |
| 87 | Ga0070695_100009252 | 3300005545 | Bacteria | 5856 |
| 88 | Ga0070696_100001810 | 3300005546 | Bacteria | 14033 |
| 89 | Ga0070696_100002232 | 3300005546 | Bacteria | 12773 |
| 90 | Ga0070696_100004515 | 3300005546 | Bacteria | 9289 |
| 91 | Ga0070696_100015156 | 3300005546 | Bacteria | 5175 |
| 92 | Ga0070693_100000295 | 3300005547 | Bacteria | 23286 |
| 93 | Ga0070693_100006307 | 3300005547 | Bacteria | 5747 |
| 94 | Ga0070665_100000005 | 3300005548 | Bacteria | 734905 |
| 95 | Ga0070704_100002299 | 3300005549 | Bacteria | 10686 |
| 96 | Ga0070704_100007594 | 3300005549 | Bacteria | 6462 |
| 97 | Ga0068855_100000173 | 3300005563 | Bacteria | 82962 |
| 98 | Ga0068855_100001151 | 3300005563 | Bacteria | 32758 |
| 99 | Ga0068855_100001853 | 3300005563 | Bacteria | 26289 |
| 100 | Ga0068855_100007890 | 3300005563 | Bacteria | 12856 |
| 101 | Ga0068855_100012611 | 3300005563 | Bacteria | 10200 |
| 102 | Ga0068855_100016025 | 3300005563 | Bacteria | 9016 |
| 103 | Ga0068855_100027713 | 3300005563 | Bacteria | 6779 |
| 104 | Ga0068855_100093402 | 3300005563 | Bacteria | 3469 |
| 105 | Ga0070664_100014276 | 3300005564 | Bacteria | 6479 |
| 106 | Ga0070664_100024230 | 3300005564 | Bacteria | 5019 |
| 107 | Ga0068857_100000037 | 3300005577 | Bacteria | 72271 |
| 108 | Ga0068857_100001129 | 3300005577 | Bacteria | 20819 |
| 109 | Ga0068857_100015767 | 3300005577 | Bacteria | 6612 |
| 110 | Ga0068857_100023534 | 3300005577 | Bacteria | 5422 |
| 111 | Ga0068857_100036623 | 3300005577 | Bacteria | 4347 |
| 112 | Ga0068857_100039091 | 3300005577 | Bacteria | 4202 |
| 113 | Ga0068857_100050763 | 3300005577 | Bacteria | 3679 |
| 114 | Ga0068854_100000155 | 3300005578 | Bacteria | 46783 |
| 115 | Ga0068854_100000264 | 3300005578 | Bacteria | 35701 |
| 116 | Ga0068854_100020179 | 3300005578 | Bacteria | 4503 |
| 117 | Ga0068854_100041686 | 3300005578 | Bacteria | 3245 |
| 118 | Ga0068856_100001573 | 3300005614 | Bacteria | 23906 |
| 119 | Ga0068856_100004257 | 3300005614 | Bacteria | 14293 |
| 120 | Ga0068856_100006583 | 3300005614 | Bacteria | 11387 |
| 121 | Ga0068856_100011636 | 3300005614 | Bacteria | 8534 |
| 122 | Ga0068856_100025033 | 3300005614 | Bacteria | 5817 |
| 123 | Ga0068856_100027971 | 3300005614 | Bacteria | 5501 |
| 124 | Ga0068856_100081964 | 3300005614 | Bacteria | 3201 |
| 125 | Ga0070702_100004472 | 3300005615 | Bacteria | 6386 |
| 126 | Ga0070702_100028732 | 3300005615 | Bacteria | 3016 |
| 127 | Ga0068852_100000060 | 3300005616 | Bacteria | 73764 |
| 128 | Ga0068852_100003542 | 3300005616 | Bacteria | 10920 |
| 129 | Ga0068852_100011081 | 3300005616 | Bacteria | 6769 |
| 130 | Ga0068852_100044193 | 3300005616 | Bacteria | 3782 |
| 131 | Ga0068864_100019452 | 3300005618 | Bacteria | 5677 |
| 132 | Ga0068864_100078069 | 3300005618 | Bacteria | 2897 |
| 133 | Ga0068863_100088822 | 3300005841 | Bacteria | 2930 |
| 134 | Ga0068858_100021855 | 3300005842 | Bacteria | 5975 |
| 135 | Ga0068858_100048810 | 3300005842 | Bacteria | 3921 |
| 136 | Ga0068860_100026137 | 3300005843 | Bacteria | 5630 |
| 137 | Ga0068860_100108581 | 3300005843 | Bacteria | 2652 |
| 138 | Ga0068862_100021617 | 3300005844 | Bacteria | 5380 |
| 139 | Ga0081455_10000836 | 3300005937 | Bacteria | 39643 |
| 140 | Ga0081455_10023949 | 3300005937 | Bacteria | 5667 |
| 141 | Ga0081455_10029734 | 3300005937 | Bacteria | 4976 |
| 142 | Ga0081455_10054930 | 3300005937 | Bacteria | 3390 |
| 143 | Ga0081538_10003168 | 3300005981 | Bacteria | 15644 |
| 144 | Ga0081538_10005079 | 3300005981 | Bacteria | 11955 |
| 145 | Ga0081538_10016936 | 3300005981 | Bacteria | 5559 |
| 146 | Ga0081540_1000014 | 3300005983 | Bacteria | 179266 |
| 147 | Ga0081539_10002861 | 3300005985 | Bacteria | 22951 |
| 148 | Ga0070717_10004535 | 3300006028 | Bacteria | 10041 |
| 149 | Ga0075365_10000297 | 3300006038 | Bacteria | 17279 |
| 150 | Ga0075365_10013792 | 3300006038 | Bacteria | 4848 |
| 151 | Ga0075365_10015500 | 3300006038 | Bacteria | 4613 |
| 152 | Ga0075364_10003478 | 3300006051 | Bacteria | 8964 |
| 153 | Ga0075364_10028827 | 3300006051 | Bacteria | 3556 |
| 154 | Ga0070716_100029671 | 3300006173 | Bacteria | 2960 |
| 155 | Ga0070712_100013453 | 3300006175 | Bacteria | 5230 |
| 156 | Ga0070712_100022276 | 3300006175 | Bacteria | 4171 |
| 157 | Ga0075366_10012767 | 3300006195 | Bacteria | 4772 |
| 158 | Ga0097621_100005320 | 3300006237 | Bacteria | 9065 |
| 159 | Ga0097621_100056628 | 3300006237 | Bacteria | 3203 |
| 160 | Ga0097621_100086773 | 3300006237 | Bacteria | 2612 |
| 161 | Ga0075428_100005809 | 3300006844 | Bacteria | 13706 |
| 162 | Ga0075428_100041964 | 3300006844 | Bacteria | 5031 |
| 163 | Ga0075428_100087943 | 3300006844 | Bacteria | 3389 |
| 164 | Ga0075430_100002488 | 3300006846 | Bacteria | 15350 |
| 165 | Ga0075430_100003638 | 3300006846 | Bacteria | 12933 |
| 166 | Ga0075430_100005138 | 3300006846 | Bacteria | 11017 |
| 167 | Ga0075430_100005816 | 3300006846 | Bacteria | 10403 |
| 168 | Ga0075431_100001497 | 3300006847 | Bacteria | 21629 |
| 169 | Ga0075431_100006457 | 3300006847 | Bacteria | 11643 |
| 170 | Ga0075434_100000294 | 3300006871 | Bacteria | 35398 |
| 171 | Ga0075429_100078001 | 3300006880 | Bacteria | 2887 |
| 172 | Ga0068865_100009469 | 3300006881 | Bacteria | 6043 |
| 173 | Ga0068865_100014504 | 3300006881 | Bacteria | 5008 |
| 174 | Ga0075436_100003333 | 3300006914 | Bacteria | 10996 |
| 175 | Ga0075435_100024294 | 3300007076 | Bacteria | 4701 |
| 176 | Ga0075435_100047496 | 3300007076 | Bacteria | 3447 |
| 177 | Ga0105251_10000071 | 3300009011 | Bacteria | 97636 |
| 178 | Ga0105240_10001752 | 3300009093 | Bacteria | 36654 |
| 179 | Ga0105240_10006835 | 3300009093 | Bacteria | 16685 |
| 180 | Ga0105240_10009341 | 3300009093 | Bacteria | 13898 |
| 181 | Ga0105240_10012786 | 3300009093 | Bacteria | 11566 |
| 182 | Ga0105240_10016140 | 3300009093 | Bacteria | 10121 |
| 183 | Ga0105240_10021976 | 3300009093 | Bacteria | 8474 |
| 184 | Ga0105240_10046551 | 3300009093 | Bacteria | 5495 |
| 185 | Ga0105240_10054859 | 3300009093 | Bacteria | 4992 |
| 186 | Ga0105240_10068000 | 3300009093 | Bacteria | 4414 |
| 187 | Ga0105240_10068849 | 3300009093 | Bacteria | 4383 |
| 188 | Ga0105240_10138630 | 3300009093 | Bacteria | 2910 |
| 189 | Ga0111539_10003257 | 3300009094 | Bacteria | 21461 |
| 190 | Ga0111539_10006023 | 3300009094 | Bacteria | 15666 |
| 191 | Ga0111539_10029566 | 3300009094 | Bacteria | 6671 |
| 192 | Ga0111539_10034113 | 3300009094 | Bacteria | 6174 |
| 193 | Ga0111539_10042459 | 3300009094 | Bacteria | 5460 |
| 194 | Ga0105245_10000316 | 3300009098 | Bacteria | 45965 |
| 195 | Ga0105245_10005760 | 3300009098 | Bacteria | 10874 |
| 196 | Ga0105245_10005955 | 3300009098 | Bacteria | 10711 |
| 197 | Ga0105245_10037843 | 3300009098 | Bacteria | 4289 |
| 198 | Ga0105245_10040689 | 3300009098 | Bacteria | 4142 |
| 199 | Ga0105245_10073375 | 3300009098 | Bacteria | 3111 |
| 200 | Ga0114129_10001564 | 3300009147 | Bacteria | 31070 |
| 201 | Ga0114129_10002027 | 3300009147 | Bacteria | 27758 |
| 202 | Ga0114129_10065801 | 3300009147 | Bacteria | 5058 |
| 203 | Ga0105241_10000844 | 3300009174 | Bacteria | 23215 |
| 204 | Ga0105241_10002240 | 3300009174 | Bacteria | 14541 |
| 205 | Ga0105241_10028095 | 3300009174 | Bacteria | 4189 |
| 206 | Ga0105241_10054050 | 3300009174 | Bacteria | 3073 |
| 207 | Ga0105242_10004057 | 3300009176 | Bacteria | 11378 |
| 208 | Ga0105242_10047060 | 3300009176 | Bacteria | 3501 |
| 209 | Ga0105242_10056419 | 3300009176 | Bacteria | 3214 |
| 210 | Ga0105237_10000378 | 3300009545 | Bacteria | 63407 |
| 211 | Ga0105237_10002481 | 3300009545 | Bacteria | 22895 |
| 212 | Ga0105237_10002758 | 3300009545 | Bacteria | 21357 |
| 213 | Ga0105237_10005799 | 3300009545 | Bacteria | 13859 |
| 214 | Ga0105237_10012837 | 3300009545 | Bacteria | 8808 |
| 215 | Ga0105237_10022252 | 3300009545 | Bacteria | 6504 |
| 216 | Ga0105237_10027552 | 3300009545 | Bacteria | 5798 |
| 217 | Ga0105237_10043839 | 3300009545 | Bacteria | 4504 |
| 218 | Ga0105237_10081267 | 3300009545 | Unclassified | 3231 |
| 219 | Ga0105238_10003191 | 3300009551 | Bacteria | 16361 |
| 220 | Ga0105238_10011466 | 3300009551 | Bacteria | 8926 |
| 221 | Ga0105238_10040502 | 3300009551 | Bacteria | 4720 |
| 222 | Ga0105238_10052291 | 3300009551 | Bacteria | 4106 |
| 223 | Ga0105249_10009340 | 3300009553 | Bacteria | 8579 |
| 224 | Ga0105249_10016569 | 3300009553 | Bacteria | 6540 |
| 225 | Ga0105239_10000232 | 3300010375 | Bacteria | 82037 |
| 226 | Ga0105239_10013523 | 3300010375 | Bacteria | 9060 |
| 227 | Ga0105239_10030485 | 3300010375 | Bacteria | 5929 |
| 228 | Ga0157373_10004598 | 3300013100 | Bacteria | 10377 |
| 229 | Ga0157373_10004623 | 3300013100 | Bacteria | 10357 |
| 230 | Ga0157373_10011109 | 3300013100 | Bacteria | 6628 |
| 231 | Ga0157373_10026043 | 3300013100 | Bacteria | 4227 |
| 232 | Ga0157371_10010207 | 3300013102 | Bacteria | 7335 |
| 233 | Ga0157371_10010752 | 3300013102 | Bacteria | 7108 |
| 234 | Ga0157371_10018158 | 3300013102 | Bacteria | 5208 |
| 235 | Ga0157370_10001010 | 3300013104 | Bacteria | 35540 |
| 236 | Ga0157370_10004714 | 3300013104 | Bacteria | 15541 |
| 237 | Ga0157370_10007614 | 3300013104 | Bacteria | 11762 |
| 238 | Ga0157370_10007936 | 3300013104 | Bacteria | 11494 |
| 239 | Ga0157370_10008065 | 3300013104 | Bacteria | 11403 |
| 240 | Ga0157370_10028669 | 3300013104 | Bacteria | 5473 |
| 241 | Ga0157370_10035733 | 3300013104 | Bacteria | 4827 |
| 242 | Ga0157370_10036401 | 3300013104 | Bacteria | 4776 |
| 243 | Ga0157370_10044230 | 3300013104 | Bacteria | 4281 |
| 244 | Ga0157369_10000191 | 3300013105 | Bacteria | 84979 |
| 245 | Ga0157369_10026883 | 3300013105 | Bacteria | 6381 |
| 246 | Ga0157369_10030326 | 3300013105 | Bacteria | 5965 |
| 247 | Ga0157369_10058846 | 3300013105 | Bacteria | 4144 |
| 248 | Ga0157369_10069526 | 3300013105 | Bacteria | 3783 |
| 249 | Ga0157369_10102941 | 3300013105 | Bacteria | 3041 |
| 250 | Ga0157374_10007726 | 3300013296 | Bacteria | 9179 |
| 251 | Ga0157374_10056534 | 3300013296 | Bacteria | 3663 |
| 252 | Ga0157378_10035214 | 3300013297 | Bacteria | 4428 |
| 253 | Ga0163162_10030588 | 3300013306 | Bacteria | 5335 |
| 254 | Ga0157372_10001074 | 3300013307 | Bacteria | 29813 |
| 255 | Ga0157372_10003085 | 3300013307 | Bacteria | 17940 |
| 256 | Ga0157372_10004519 | 3300013307 | Bacteria | 14837 |
| 257 | Ga0157372_10018328 | 3300013307 | Bacteria | 7524 |
| 258 | Ga0157372_10022180 | 3300013307 | Bacteria | 6868 |
| 259 | Ga0157372_10040910 | 3300013307 | Bacteria | 5123 |
| 260 | Ga0157372_10058151 | 3300013307 | Bacteria | 4321 |
| 261 | Ga0157372_10074061 | 3300013307 | Bacteria | 3839 |
| 262 | Ga0157372_10108653 | 3300013307 | Bacteria | 3175 |
| 263 | Ga0157372_10116464 | 3300013307 | Bacteria | 3064 |
| 264 | Ga0157375_10023093 | 3300013308 | Bacteria | 5734 |
| 265 | Ga0182008_10000720 | 3300014497 | Bacteria | 23630 |
| 266 | Ga0157377_10005918 | 3300014745 | Bacteria | 5787 |
| 267 | Ga0182007_10000119 | 3300015262 | Bacteria | 54423 |
| 268 | Ga0213873_10004949 | 3300021358 | Bacteria | 2520 |
| 269 | Ga0213872_10000811 | 3300021361 | Bacteria | 22614 |
| 270 | Ga0213872_10018339 | 3300021361 | Unclassified | 3228 |
| 271 | Ga0213876_10000312 | 3300021384 | Bacteria | 42654 |
| 272 | Ga0209026_1004101 | 3300025250 | Bacteria | 4484 |
| 273 | Ga0209759_1003490 | 3300025256 | Bacteria | 6239 |
| 274 | Ga0209455_1000151 | 3300025272 | Bacteria | 129842 |
| 275 | Ga0209050_1003113 | 3300025298 | Bacteria | 12711 |
| 276 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 277 | Ga0207713_1001241 | 3300025735 | Bacteria | 21135 |
| 278 | Ga0207653_10003362 | 3300025885 | Bacteria | 5048 |
| 279 | Ga0207642_10004668 | 3300025899 | Bacteria | 4425 |
| 280 | Ga0207688_10004387 | 3300025901 | Bacteria | 7683 |
| 281 | Ga0207647_10000037 | 3300025904 | Bacteria | 97521 |
| 282 | Ga0207647_10002407 | 3300025904 | Bacteria | 14206 |
| 283 | Ga0207699_10024681 | 3300025906 | Bacteria | 3290 |
| 284 | Ga0207705_10000138 | 3300025909 | Bacteria | 78969 |
| 285 | Ga0207705_10002495 | 3300025909 | Bacteria | 14175 |
| 286 | Ga0207705_10044927 | 3300025909 | Bacteria | 3175 |
| 287 | Ga0207684_10002897 | 3300025910 | Bacteria | 17008 |
| 288 | Ga0207684_10006810 | 3300025910 | Bacteria | 10363 |
| 289 | Ga0207654_10000309 | 3300025911 | Bacteria | 29439 |
| 290 | Ga0207654_10013085 | 3300025911 | Bacteria | 4263 |
| 291 | Ga0207707_10000128 | 3300025912 | Bacteria | 78104 |
| 292 | Ga0207707_10000829 | 3300025912 | Bacteria | 30323 |
| 293 | Ga0207707_10004083 | 3300025912 | Bacteria | 12931 |
| 294 | Ga0207707_10013471 | 3300025912 | Bacteria | 7127 |
| 295 | Ga0207707_10028455 | 3300025912 | Bacteria | 4885 |
| 296 | Ga0207707_10032978 | 3300025912 | Bacteria | 4534 |
| 297 | Ga0207695_10008507 | 3300025913 | Bacteria | 12831 |
| 298 | Ga0207695_10008932 | 3300025913 | Bacteria | 12475 |
| 299 | Ga0207695_10021576 | 3300025913 | Bacteria | 7344 |
| 300 | Ga0207695_10023730 | 3300025913 | Bacteria | 6922 |
| 301 | Ga0207695_10026148 | 3300025913 | Bacteria | 6516 |
| 302 | Ga0207695_10062900 | 3300025913 | Bacteria | 3828 |
| 303 | Ga0207695_10065293 | 3300025913 | Bacteria | 3742 |
| 304 | Ga0207695_10093082 | 3300025913 | Bacteria | 3024 |
| 305 | Ga0207695_10099426 | 3300025913 | Bacteria | 2907 |
| 306 | Ga0207671_10000222 | 3300025914 | Bacteria | 85244 |
| 307 | Ga0207671_10016749 | 3300025914 | Bacteria | 5685 |
| 308 | Ga0207671_10040184 | 3300025914 | Bacteria | 3463 |
| 309 | Ga0207693_10003993 | 3300025915 | Bacteria | 12536 |
| 310 | Ga0207693_10016792 | 3300025915 | Bacteria | 5844 |
| 311 | Ga0207663_10023589 | 3300025916 | Bacteria | 3532 |
| 312 | Ga0207660_10010927 | 3300025917 | Bacteria | 5901 |
| 313 | Ga0207662_10038617 | 3300025918 | Bacteria | 2798 |
| 314 | Ga0207657_10007736 | 3300025919 | Bacteria | 10974 |
| 315 | Ga0207657_10011933 | 3300025919 | Bacteria | 8598 |
| 316 | Ga0207657_10017493 | 3300025919 | Bacteria | 6870 |
| 317 | Ga0207657_10030218 | 3300025919 | Bacteria | 4920 |
| 318 | Ga0207657_10077279 | 3300025919 | Bacteria | 2806 |
| 319 | Ga0207649_10000045 | 3300025920 | Bacteria | 112787 |
| 320 | Ga0207652_10002805 | 3300025921 | Bacteria | 14620 |
| 321 | Ga0207652_10016912 | 3300025921 | Bacteria | 5965 |
| 322 | Ga0207652_10048349 | 3300025921 | Bacteria | 3636 |
| 323 | Ga0207652_10082698 | 3300025921 | Bacteria | 2810 |
| 324 | Ga0207652_10082700 | 3300025921 | Unclassified | 2810 |
| 325 | Ga0207646_10009125 | 3300025922 | Bacteria | 9844 |
| 326 | Ga0207646_10017582 | 3300025922 | Bacteria | 6684 |
| 327 | Ga0207694_10006112 | 3300025924 | Bacteria | 9209 |
| 328 | Ga0207694_10016693 | 3300025924 | Bacteria | 5549 |
| 329 | Ga0207694_10042853 | 3300025924 | Bacteria | 3492 |
| 330 | Ga0207659_10039522 | 3300025926 | Bacteria | 3292 |
| 331 | Ga0207687_10000887 | 3300025927 | Bacteria | 20305 |
| 332 | Ga0207700_10070096 | 3300025928 | Bacteria | 2694 |
| 333 | Ga0207664_10003416 | 3300025929 | Bacteria | 10583 |
| 334 | Ga0207664_10014221 | 3300025929 | Bacteria | 5739 |
| 335 | Ga0207664_10026108 | 3300025929 | Bacteria | 4410 |
| 336 | Ga0207690_10004619 | 3300025932 | Bacteria | 8141 |
| 337 | Ga0207690_10012223 | 3300025932 | Bacteria | 5138 |
| 338 | Ga0207690_10019110 | 3300025932 | Bacteria | 4211 |
| 339 | Ga0207690_10028895 | 3300025932 | Bacteria | 3518 |
| 340 | Ga0207690_10033828 | 3300025932 | Bacteria | 3289 |
| 341 | Ga0207706_10006836 | 3300025933 | Bacteria | 10540 |
| 342 | Ga0207706_10033575 | 3300025933 | Bacteria | 4566 |
| 343 | Ga0207686_10002621 | 3300025934 | Bacteria | 9761 |
| 344 | Ga0207709_10013696 | 3300025935 | Bacteria | 4474 |
| 345 | Ga0207670_10009676 | 3300025936 | Bacteria | 5513 |
| 346 | Ga0207704_10014258 | 3300025938 | Bacteria | 4009 |
| 347 | Ga0207665_10028307 | 3300025939 | Bacteria | 3701 |
| 348 | Ga0207691_10018788 | 3300025940 | Bacteria | 6547 |
| 349 | Ga0207691_10053559 | 3300025940 | Bacteria | 3684 |
| 350 | Ga0207711_10067425 | 3300025941 | Bacteria | 3097 |
| 351 | Ga0207661_10059574 | 3300025944 | Bacteria | 3077 |
| 352 | Ga0207679_10001606 | 3300025945 | Bacteria | 14057 |
| 353 | Ga0207679_10007252 | 3300025945 | Bacteria | 7026 |
| 354 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 355 | Ga0207667_10002534 | 3300025949 | Bacteria | 22749 |
| 356 | Ga0207667_10004327 | 3300025949 | Bacteria | 17388 |
| 357 | Ga0207667_10011114 | 3300025949 | Bacteria | 10482 |
| 358 | Ga0207667_10017582 | 3300025949 | Bacteria | 8041 |
| 359 | Ga0207667_10017686 | 3300025949 | Bacteria | 8021 |
| 360 | Ga0207667_10020791 | 3300025949 | Bacteria | 7289 |
| 361 | Ga0207667_10024812 | 3300025949 | Bacteria | 6575 |
| 362 | Ga0207667_10028456 | 3300025949 | Bacteria | 6071 |
| 363 | Ga0207667_10033874 | 3300025949 | Bacteria | 5488 |
| 364 | Ga0207667_10093106 | 3300025949 | Bacteria | 3112 |
| 365 | Ga0207667_10111411 | 3300025949 | Bacteria | 2823 |
| 366 | Ga0207651_10001351 | 3300025960 | Bacteria | 11094 |
| 367 | Ga0207640_10000041 | 3300025981 | Bacteria | 105374 |
| 368 | Ga0207640_10010970 | 3300025981 | Bacteria | 5115 |
| 369 | Ga0207640_10039381 | 3300025981 | Bacteria | 2991 |
| 370 | Ga0207677_10014955 | 3300026023 | Bacteria | 4548 |
| 371 | Ga0207639_10000081 | 3300026041 | Bacteria | 82747 |
| 372 | Ga0207639_10006352 | 3300026041 | Bacteria | 8029 |
| 373 | Ga0207639_10017297 | 3300026041 | Bacteria | 5111 |
| 374 | Ga0207639_10033829 | 3300026041 | Bacteria | 3774 |
| 375 | Ga0207678_10017526 | 3300026067 | Bacteria | 6290 |
| 376 | Ga0207678_10025723 | 3300026067 | Bacteria | 5137 |
| 377 | Ga0207678_10032253 | 3300026067 | Bacteria | 4566 |
| 378 | Ga0207678_10087243 | 3300026067 | Bacteria | 2667 |
| 379 | Ga0207708_10011793 | 3300026075 | Bacteria | 6510 |
| 380 | Ga0207708_10024165 | 3300026075 | Bacteria | 4596 |
| 381 | Ga0207702_10005253 | 3300026078 | Bacteria | 11369 |
| 382 | Ga0207702_10005990 | 3300026078 | Bacteria | 10552 |
| 383 | Ga0207702_10008745 | 3300026078 | Bacteria | 8537 |
| 384 | Ga0207702_10010382 | 3300026078 | Bacteria | 7798 |
| 385 | Ga0207702_10025399 | 3300026078 | Bacteria | 4917 |
| 386 | Ga0207648_10029578 | 3300026089 | Bacteria | 4858 |
| 387 | Ga0207676_10003457 | 3300026095 | Bacteria | 11180 |
| 388 | Ga0207674_10000545 | 3300026116 | Bacteria | 49406 |
| 389 | Ga0207674_10001824 | 3300026116 | Bacteria | 27181 |
| 390 | Ga0207674_10006413 | 3300026116 | Bacteria | 13836 |
| 391 | Ga0207674_10021822 | 3300026116 | Bacteria | 6891 |
| 392 | Ga0207674_10045260 | 3300026116 | Bacteria | 4528 |
| 393 | Ga0207675_100004314 | 3300026118 | Bacteria | 13740 |
| 394 | Ga0207683_10097816 | 3300026121 | Bacteria | 2618 |
| 395 | Ga0207698_10000054 | 3300026142 | Bacteria | 82681 |
| 396 | Ga0207698_10004012 | 3300026142 | Bacteria | 8934 |
| 397 | Ga0207698_10020871 | 3300026142 | Bacteria | 4519 |
| 398 | Ga0209998_10001553 | 3300027717 | Bacteria | 5517 |
| 399 | Ga0207428_10020618 | 3300027907 | Bacteria | 5596 |
| 400 | Ga0207428_10050645 | 3300027907 | Bacteria | 3322 |
| 401 | Ga0207428_10063864 | 3300027907 | Bacteria | 2908 |
| 402 | Ga0207428_10087632 | 3300027907 | Bacteria | 2422 |
| 403 | Ga0268266_10000012 | 3300028379 | Bacteria | 734912 |
| 404 | Ga0268264_10074071 | 3300028381 | Bacteria | 2891 |
| 405 | Ga0265334_10007814 | 3300028573 | Bacteria | 4577 |
| 406 | Ga0307515_10003432 | 3300028794 | Bacteria | 33341 |
| 407 | Ga0265338_10003096 | 3300028800 | Bacteria | 23860 |
| 408 | Ga0265338_10011316 | 3300028800 | Bacteria | 10324 |
| 409 | Ga0265338_10034240 | 3300028800 | Bacteria | 4913 |
| 410 | Ga0265324_10000038 | 3300029957 | Bacteria | 119212 |
| 411 | Ga0265330_10020819 | 3300031235 | Bacteria | 2996 |
| 412 | Ga0265340_10004633 | 3300031247 | Bacteria | 7656 |
| 413 | Ga0265339_10000039 | 3300031249 | Bacteria | 120661 |
| 414 | Ga0307408_100012298 | 3300031548 | Bacteria | 5668 |
| 415 | Ga0265313_10017269 | 3300031595 | Bacteria | 4108 |
| 416 | Ga0307413_10001002 | 3300031824 | Bacteria | 10195 |
| 417 | Ga0307412_10025210 | 3300031911 | Bacteria | 3681 |
| 418 | Ga0307409_100020077 | 3300031995 | Bacteria | 4544 |
| 419 | Ga0307409_100030717 | 3300031995 | Bacteria | 3865 |
| 420 | Ga0307409_100050642 | 3300031995 | Bacteria | 3173 |
| 421 | Ga0307409_100080824 | 3300031995 | Bacteria | 2625 |
| 422 | Ga0307416_100032345 | 3300032002 | Bacteria | 3951 |
| 423 | Ga0307414_10039841 | 3300032004 | Bacteria | 3169 |
| 424 | Ga0307415_100012395 | 3300032126 | Bacteria | 4927 |
| 425 | Ga0307415_100018805 | 3300032126 | Bacteria | 4182 |
| 426 | Ga0373926_0004262 | 3300035083 | Bacteria | 4678 |
| 427 | Ga0373934_0002168 | 3300035086 | Bacteria | 7220 |
| 428 | Ga0373923_0002299 | 3300035111 | Bacteria | 5839 |
| 429 | Ga0373953_0002942 | 3300035117 | Bacteria | 5205 |
| 430 | Ga0373956_0010988 | 3300035119 | Bacteria | 3726 |
| 431 | Ga0373946_0016533 | 3300035171 | Bacteria | 2812 |
| 432 | Ga0373947_0002484 | 3300035725 | Bacteria | 11090 |
| 433 | Ga0373937_0013594 | 3300036401 | Bacteria | 7172 |
| 434 | Ga0373937_0066063 | 3300036401 | Bacteria | 3330 |
| 435 | Ga0316582_0025860 | 3300036647 | Bacteria | 3529 |
| 436 | Ga0373925_0003855 | 3300037068 | Bacteria | 11487 |
| 437 | Ga0373925_0008070 | 3300037068 | Bacteria | 7669 |
| 438 | Ga0373925_0019751 | 3300037068 | Bacteria | 4904 |
| 439 | Ga0373925_0026193 | 3300037068 | Bacteria | 4266 |
| 440 | Ga0395898_0112022 | 3300037466 | Bacteria | 2615 |
| 441 | Ga0436364_0961538 | 3300037853 | Bacteria | 3981 |
| 442 | Ga0395901_0065876 | 3300038443 | Bacteria | 3773 |
| 443 | Ga0395901_0114077 | 3300038443 | Bacteria | 2838 |
| 444 | Ga0436365_0829382 | 3300039437 | Bacteria | 20843 |
| 445 | Ga0436361_0013419 | 3300039447 | Unclassified | 2864 |
| 446 | Ga0436361_0259259 | 3300039447 | Bacteria | 4878 |
| 447 | Ga0436361_0306192 | 3300039447 | Bacteria | 136694 |
| 448 | Ga0436363_0558892 | 3300039450 | Bacteria | 7281 |
| 449 | Ga0451807_2610835 | 3300041486 | Bacteria | 4280 |
| 450 | Ga0439448_0005500 | 3300042005 | Bacteria | 3614 |
| 451 | Ga0439451_000928 | 3300042009 | Bacteria | 5645 |
| 452 | Ga0451577_0006548 | 3300042876 | Bacteria | 11588 |
| 453 | Ga0451577_0069100 | 3300042876 | Bacteria | 3150 |
| 454 | Ga0453683_0000130 | 3300044673 | Bacteria | 109669 |
| 455 | Ga0453684_0000306 | 3300044712 | Bacteria | 207333 |
| 456 | Ga0453684_0037081 | 3300044712 | Bacteria | 6697 |
| 457 | Ga0453684_0042322 | 3300044712 | Bacteria | 6142 |
| 458 | Ga0453684_0058424 | 3300044712 | Bacteria | 4982 |
| 459 | Ga0453684_0155339 | 3300044712 | Bacteria | 2714 |
| 460 | Ga0451576_0012158 | 3300045051 | Bacteria | 9704 |
| 461 | Ga0451576_0016035 | 3300045051 | Bacteria | 8279 |
| 462 | Ga0451576_0022735 | 3300045051 | Bacteria | 6793 |
| 463 | Ga0451576_0022762 | 3300045051 | Bacteria | 6789 |
| 464 | Ga0451576_0135550 | 3300045051 | Bacteria | 2567 |
| 465 | Ga0466958_0054211 | 3300045836 | Bacteria | 2432 |
| 466 | Ga0495592_0031774 | 3300046454 | Bacteria | 3987 |
| 467 | Ga0495603_0002605 | 3300046455 | Bacteria | 10647 |
| 468 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 469 | Ga0495638_0000105 | 3300046460 | Bacteria | 134384 |
| 470 | Ga0495641_0005721 | 3300046461 | Bacteria | 8269 |
| 471 | Ga0495653_0002547 | 3300046463 | Bacteria | 14525 |
| 472 | Ga0495650_0000061 | 3300046471 | Bacteria | 283347 |
| 473 | Ga0495650_0002094 | 3300046471 | Bacteria | 17165 |
| 474 | Ga0495580_0002418 | 3300046472 | Bacteria | 16314 |
| 475 | Ga0495580_0004454 | 3300046472 | Bacteria | 11770 |
| 476 | Ga0495580_0004869 | 3300046472 | Bacteria | 11229 |
| 477 | Ga0495580_0065513 | 3300046472 | Bacteria | 2544 |
| 478 | Ga0495582_0000413 | 3300046473 | Bacteria | 23302 |
| 479 | Ga0495639_0000560 | 3300046475 | Bacteria | 17338 |
| 480 | Ga0495594_0009676 | 3300046499 | Bacteria | 4985 |
| 481 | Ga0495583_0000740 | 3300046506 | Bacteria | 41499 |
| 482 | Ga0495608_0001600 | 3300046511 | Bacteria | 16214 |
| 483 | Ga0495608_0010440 | 3300046511 | Bacteria | 6481 |
| 484 | Ga0495608_0025250 | 3300046511 | Bacteria | 4055 |
| 485 | Ga0495618_0005277 | 3300046514 | Bacteria | 7897 |
| 486 | Ga0495618_0047491 | 3300046514 | Bacteria | 2709 |
| 487 | Ga0495628_0016038 | 3300046516 | Bacteria | 6251 |
| 488 | Ga0495648_0000008 | 3300046524 | Bacteria | 336584 |
| 489 | Ga0495666_0009232 | 3300046526 | Bacteria | 4931 |
| 490 | Ga0495642_0000948 | 3300046528 | Bacteria | 13579 |
| 491 | Ga0495665_0044276 | 3300046531 | Bacteria | 2365 |
| 492 | Ga0495640_0021018 | 3300046533 | Bacteria | 4797 |
| 493 | Ga0495586_0029890 | 3300046535 | Bacteria | 2916 |
| 494 | Ga0495609_0004469 | 3300046538 | Bacteria | 7640 |
| 495 | Ga0495622_0000280 | 3300046557 | Bacteria | 38774 |
| 496 | Ga0495633_0000238 | 3300046558 | Bacteria | 66595 |
| 497 | Ga0495667_0000278 | 3300046559 | Bacteria | 33396 |
| 498 | Ga0495668_0000065 | 3300046616 | Bacteria | 178985 |
| 499 | Ga0495634_0005921 | 3300046642 | Bacteria | 9340 |
| 500 | Ga0495634_0016612 | 3300046642 | Bacteria | 5260 |
| 501 | Ga0495625_0000954 | 3300046660 | Bacteria | 38641 |
| 502 | Ga0495588_0026749 | 3300046674 | Bacteria | 2881 |
| 503 | Ga0495657_0004212 | 3300046675 | Bacteria | 11512 |
| 504 | Ga0495599_0005873 | 3300046678 | Bacteria | 7373 |
| 505 | Ga0495613_0005696 | 3300046689 | Bacteria | 9338 |
| 506 | Ga0495613_0038678 | 3300046689 | Bacteria | 3535 |
| 507 | Ga0495600_0006209 | 3300046809 | Bacteria | 7247 |
| 508 | Ga0495660_0003991 | 3300046810 | Bacteria | 9002 |
| 509 | Ga0495581_0005270 | 3300047315 | Bacteria | 7477 |
| 510 | Ga0495604_0063499 | 3300047317 | Bacteria | 2816 |
| 511 | Ga0495674_0038142 | 3300047319 | Bacteria | 4315 |
| 512 | Ga0495674_0114570 | 3300047319 | Bacteria | 2283 |
| 513 | Ga0495676_0022241 | 3300047321 | Bacteria | 5520 |
| 514 | Ga0495680_0030067 | 3300047322 | Bacteria | 4440 |
| 515 | Ga0495675_0003519 | 3300047444 | Bacteria | 9440 |
| 516 | Ga0496100_0000293 | 3300048903 | Bacteria | 25054 |
| 517 | Ga0496101_0037060 | 3300048904 | Bacteria | 3457 |
| 518 | Ga0496102_0062016 | 3300048905 | Bacteria | 3423 |
| 519 | Ga0496104_0040288 | 3300048907 | Bacteria | 4378 |
| 520 | Ga0496104_0056584 | 3300048907 | Bacteria | 3709 |
| 521 | Ga0496105_0043255 | 3300048908 | Bacteria | 3715 |
| 522 | Ga0496106_0000047 | 3300048909 | Bacteria | 100449 |
| 523 | Ga0496106_0006900 | 3300048909 | Bacteria | 8402 |
| 524 | Ga0496107_0000232 | 3300048910 | Bacteria | 29452 |
| 525 | Ga0496107_0039622 | 3300048910 | Bacteria | 3380 |
| 526 | Ga0496108_0015495 | 3300048911 | Bacteria | 6217 |
| 527 | Ga0496108_0050045 | 3300048911 | Bacteria | 3497 |
| 528 | Ga0496108_0053039 | 3300048911 | Bacteria | 3399 |
| 529 | Ga0496109_0008972 | 3300048912 | Bacteria | 8517 |
| 530 | Ga0496109_0014093 | 3300048912 | Bacteria | 6949 |
| 531 | Ga0496110_0002400 | 3300048913 | Bacteria | 14032 |
| 532 | Ga0496110_0004086 | 3300048913 | Bacteria | 11263 |
| 533 | Ga0496110_0005258 | 3300048913 | Bacteria | 10129 |
| 534 | Ga0496110_0025835 | 3300048913 | Bacteria | 5021 |
| 535 | Ga0496110_0033412 | 3300048913 | Bacteria | 4450 |
| 536 | Ga0496111_0002866 | 3300048914 | Bacteria | 10524 |
| 537 | Ga0496111_0013094 | 3300048914 | Bacteria | 5633 |
| 538 | Ga0496111_0038706 | 3300048914 | Bacteria | 3417 |
| 539 | Ga0496112_0035155 | 3300048915 | Bacteria | 4878 |
| 540 | Ga0496112_0102369 | 3300048915 | Bacteria | 2834 |
| 541 | Ga0496113_0024645 | 3300048916 | Bacteria | 4279 |
| 542 | Ga0496114_0102014 | 3300048917 | Bacteria | 2451 |
| 543 | Ga0496116_0000193 | 3300048919 | Bacteria | 122203 |
| 544 | Ga0496117_0001656 | 3300048920 | Bacteria | 31249 |
| 545 | Ga0496118_0000156 | 3300048921 | Bacteria | 121630 |
| 546 | Ga0496122_0002269 | 3300048925 | Bacteria | 27812 |
| 547 | Ga0496125_0004416 | 3300048928 | Bacteria | 16247 |
| 548 | Ga0501310_000308 | 3300049130 | Bacteria | 4524 |
| 549 | Ga0495678_006025 | 3300049459 | Bacteria | 6534 |
| 550 | Ga0495678_012546 | 3300049459 | Bacteria | 4014 |
| 551 | Ga0501031_0000043 | 3300049568 | Bacteria | 67296 |
| 552 | Ga0501031_0011811 | 3300049568 | Bacteria | 5695 |
| 553 | Ga0501031_0012739 | 3300049568 | Bacteria | 5494 |
| 554 | Ga0501032_0015902 | 3300049569 | Bacteria | 5301 |
| 555 | Ga0501033_0038226 | 3300049570 | Bacteria | 3590 |
| 556 | Ga0501034_0010411 | 3300049571 | Bacteria | 9692 |
| 557 | Ga0501034_0062823 | 3300049571 | Bacteria | 3729 |
| 558 | Ga0501037_0025396 | 3300049573 | Bacteria | 4378 |
| 559 | Ga0501039_0015679 | 3300049575 | Bacteria | 5797 |
| 560 | Ga0501039_0022829 | 3300049575 | Bacteria | 4799 |
| 561 | Ga0501040_0026961 | 3300049576 | Bacteria | 3865 |
| 562 | Ga0501041_0022031 | 3300049577 | Bacteria | 3815 |
| 563 | Ga0501041_0023830 | 3300049577 | Bacteria | 3672 |
| 564 | Ga0501043_0002546 | 3300049579 | Bacteria | 15408 |
| 565 | Ga0501046_0003075 | 3300049580 | Bacteria | 15408 |
| 566 | Ga0501046_0048393 | 3300049580 | Bacteria | 3367 |
| 567 | Ga0501047_0000298 | 3300049581 | Bacteria | 57038 |
| 568 | Ga0501068_0016956 | 3300049584 | Bacteria | 4208 |
| 569 | Ga0501069_0002005 | 3300049585 | Bacteria | 10196 |
| 570 | Ga0501069_0010891 | 3300049585 | Bacteria | 4818 |
| 571 | Ga0501069_0019188 | 3300049585 | Bacteria | 3694 |
| 572 | Ga0501070_0003957 | 3300049586 | Bacteria | 12753 |
| 573 | Ga0501070_0049236 | 3300049586 | Bacteria | 3499 |
| 574 | Ga0501070_0050287 | 3300049586 | Bacteria | 3460 |
| 575 | Ga0501071_0013274 | 3300049587 | Bacteria | 5613 |
| 576 | Ga0501072_0018889 | 3300049588 | Bacteria | 5318 |
| 577 | Ga0501072_0041387 | 3300049588 | Bacteria | 3619 |
| 578 | Ga0501073_0005956 | 3300049589 | Bacteria | 9097 |
| 579 | Ga0501075_0028103 | 3300049591 | Bacteria | 4150 |
| 580 | Ga0501076_0003362 | 3300049592 | Bacteria | 11229 |
| 581 | Ga0501076_0098723 | 3300049592 | Bacteria | 2353 |
| 582 | Ga0501079_0013817 | 3300049741 | Bacteria | 6157 |
| 583 | Ga0501080_0000484 | 3300049742 | Bacteria | 30966 |
| 584 | Ga0501081_0018173 | 3300049743 | Bacteria | 4667 |
| 585 | Ga0501083_0003320 | 3300049744 | Bacteria | 11243 |
| 586 | Ga0501083_0033535 | 3300049744 | Bacteria | 3515 |
| 587 | Ga0501035_0001671 | 3300049822 | Bacteria | 22430 |
| 588 | Ga0501035_0003222 | 3300049822 | Bacteria | 15634 |
| 589 | Ga0501035_0064939 | 3300049822 | Bacteria | 3243 |
| 590 | Ga0501035_0081612 | 3300049822 | Bacteria | 2854 |
| 591 | Ga0501044_0000032 | 3300049823 | Bacteria | 169439 |
| 592 | Ga0501044_0000129 | 3300049823 | Bacteria | 92557 |
| 593 | Ga0501044_0012042 | 3300049823 | Bacteria | 9367 |
| 594 | Ga0501044_0022787 | 3300049823 | Bacteria | 6670 |
| 595 | Ga0501044_0080958 | 3300049823 | Bacteria | 3288 |
| 596 | Ga0501045_0003384 | 3300049824 | Bacteria | 10920 |
| 597 | nmdc:mga00v17_3015_c1 | 3300050491 | Bacteria | 8654 |
| 598 | nmdc:mga0yw44_27164_c1 | 3300050492 | Bacteria | 3276 |
| 599 | nmdc:mga0yw44_30676_c1 | 3300050492 | Bacteria | 3119 |
| 600 | nmdc:mga0yw44_8024_c1 | 3300050492 | Bacteria | 5234 |
| 601 | nmdc:mga05p37_1464_c1 | 3300050507 | Bacteria | 27403 |
| 602 | nmdc:mga05p37_1595_c1 | 3300050507 | Bacteria | 26327 |
| 603 | nmdc:mga05p37_7948_c1 | 3300050507 | Bacteria | 12519 |
| 604 | nmdc:mga09592_112367_c1 | 3300050508 | Bacteria | 2337 |
| 605 | nmdc:mga09592_33132_c1 | 3300050508 | Bacteria | 4311 |
| 606 | nmdc:mga09592_4143_c1 | 3300050508 | Bacteria | 11714 |
| 607 | nmdc:mga0qj67_1688_c1 | 3300050509 | Bacteria | 15559 |
| 608 | nmdc:mga0qj67_26132_c1 | 3300050509 | Bacteria | 4519 |
| 609 | nmdc:mga0qj67_4250_c1 | 3300050509 | Bacteria | 10379 |
| 610 | nmdc:mga0qj67_5040_c1 | 3300050509 | Bacteria | 9599 |
| 611 | nmdc:mga06r32_15507_c1 | 3300050510 | Bacteria | 6919 |
| 612 | nmdc:mga06r32_5717_c1 | 3300050510 | Bacteria | 11200 |
| 613 | nmdc:mga08y16_18544_c1 | 3300050511 | Bacteria | 7332 |
| 614 | nmdc:mga08y16_23587_c1 | 3300050511 | Bacteria | 6499 |
| 615 | nmdc:mga08y16_39169_c1 | 3300050511 | Bacteria | 4973 |
| 616 | nmdc:mga08y16_45060_c1 | 3300050511 | Bacteria | 4621 |
| 617 | nmdc:mga08y16_51745_c1 | 3300050511 | Bacteria | 4298 |
| 618 | nmdc:mga08y16_82223_c1 | 3300050511 | Bacteria | 3357 |
| 619 | nmdc:mga08y16_89288_c1 | 3300050511 | Bacteria | 3212 |
| 620 | nmdc:mga0n895_5423_c1 | 3300050512 | Bacteria | 10656 |
| 621 | nmdc:mga0rr50_4741_c1 | 3300050513 | Bacteria | 8018 |
| 622 | nmdc:mga0rr50_6120_c1 | 3300050513 | Bacteria | 7279 |
| 623 | Ga0495619_0006383 | 3300053085 | Bacteria | 7472 |
| 624 | Ga0500651_0008389 | 3300053093 | Bacteria | 6077 |
| 625 | Ga0500590_000002 | 3300053148 | Bacteria | 124521 |
| 626 | Ga0500619_000019 | 3300053154 | Bacteria | 52899 |
| 627 | Ga0501084_0016429 | 3300054114 | Bacteria | 6147 |
| 628 | Ga0501082_0017479 | 3300060353 | Bacteria | 6179 |
| 629 | Ga0501082_0032968 | 3300060353 | Bacteria | 4467 |
| 630 | Ga0530510_0011936 | 3300061734 | Bacteria | 6095 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025918 | Ga0207662_10038617 | Ga0207662_100386173 | 594 |
| 2 | 3300048917 | Ga0496114_0102014 | Ga0496114_0102014_447_2417 | 601 |
| 3 | 3300036401 | Ga0373937_0066063 | Ga0373937_0066063_1433_3313 | 615 |
| 4 | 3300046514 | Ga0495618_0047491 | Ga0495618_0047491_776_2698 | 624 |
| 5 | 3300046642 | Ga0495634_0016612 | Ga0495634_0016612_12_1934 | 624 |
| 6 | 3300050508 | nmdc:mga09592_112367_c1 | nmdc:mga09592_112367_c1_338_2317 | 632 |
| 7 | 3300049570 | Ga0501033_0038226 | Ga0501033_0038226_1503_3575 | 638 |
| 8 | 3300048913 | Ga0496110_0005258 | Ga0496110_0005258_7997_10111 | 649 |
| 9 | 3300048914 | Ga0496111_0038706 | Ga0496111_0038706_19_2133 | 649 |
| 10 | 3300005518 | Ga0070699_100006903 | Ga0070699_1000069035 | 658 |
| 11 | 3300047319 | Ga0495674_0114570 | Ga0495674_0114570_146_2215 | 658 |
| 12 | 3300048915 | Ga0496112_0102369 | Ga0496112_0102369_398_2536 | 658 |
| 13 | 3300049592 | Ga0501076_0098723 | Ga0501076_0098723_188_2329 | 658 |
| 14 | 3300031247 | Ga0265340_10004633 | Ga0265340_100046331 | 663 |
| 15 | 3300046531 | Ga0495665_0044276 | Ga0495665_0044276_187_2259 | 669 |
| 16 | 3300045836 | Ga0466958_0054211 | Ga0466958_0054211_16_2157 | 681 |
| 17 | 3300049569 | Ga0501032_0015902 | Ga0501032_0015902_18_2225 | 683 |
| 18 | 3300050512 | nmdc:mga0n895_5423_c1 | nmdc:mga0n895_5423_c1_798_3005 | 684 |
| 19 | 3300050513 | nmdc:mga0rr50_4741_c1 | nmdc:mga0rr50_4741_c1_3781_5988 | 684 |
| 20 | 3300021358 | Ga0213873_10004949 | Ga0213873_100049491 | 689 |
| 21 | 3300005983 | Ga0081540_1000014 | Ga0081540_100001426 | 690 |
| 22 | 3300005937 | Ga0081455_10054930 | Ga0081455_100549301 | 692 |
| 23 | 3300050507 | nmdc:mga05p37_7948_c1 | nmdc:mga05p37_7948_c1_8052_10286 | 694 |
| 24 | 3300050511 | nmdc:mga08y16_51745_c1 | nmdc:mga08y16_51745_c1_487_2721 | 694 |
| 25 | 3300038443 | Ga0395901_0065876 | Ga0395901_0065876_431_2749 | 695 |
| 26 | 3300005435 | Ga0070714_100014518 | Ga0070714_1000145182 | 697 |
| 27 | 3300045051 | Ga0451576_0135550 | Ga0451576_0135550_91_2424 | 697 |
| 28 | 3300006195 | Ga0075366_10012767 | Ga0075366_100127672 | 700 |
| 29 | 3300035171 | Ga0373946_0016533 | Ga0373946_0016533_72_2405 | 700 |
| 30 | 3300046455 | Ga0495603_0002605 | Ga0495603_0002605_5671_8004 | 700 |
| 31 | 3300046461 | Ga0495641_0005721 | Ga0495641_0005721_932_3265 | 700 |
| 32 | 3300046499 | Ga0495594_0009676 | Ga0495594_0009676_799_3132 | 700 |
| 33 | 3300046674 | Ga0495588_0026749 | Ga0495588_0026749_194_2527 | 700 |
| 34 | 3300047321 | Ga0495676_0022241 | Ga0495676_0022241_2736_5069 | 700 |
| 35 | 3300009147 | Ga0114129_10001564 | Ga0114129_1000156412 | 701 |
| 36 | 3300026116 | Ga0207674_10021822 | Ga0207674_100218227 | 701 |
| 37 | 3300027907 | Ga0207428_10087632 | Ga0207428_100876321 | 701 |
| 38 | 3300050507 | nmdc:mga05p37_1464_c1 | nmdc:mga05p37_1464_c1_5209_7476 | 701 |
| 39 | 3300050509 | nmdc:mga0qj67_5040_c1 | nmdc:mga0qj67_5040_c1_3655_5922 | 701 |
| 40 | 3300050511 | nmdc:mga08y16_45060_c1 | nmdc:mga08y16_45060_c1_172_2472 | 701 |
| 41 | 3300048916 | Ga0496113_0024645 | Ga0496113_0024645_1812_4148 | 702 |
| 42 | 3300005457 | Ga0070662_100036457 | Ga0070662_1000364571 | 703 |
| 43 | 3300005539 | Ga0068853_100047802 | Ga0068853_1000478022 | 703 |
| 44 | 3300005577 | Ga0068857_100036623 | Ga0068857_1000366233 | 703 |
| 45 | 3300005618 | Ga0068864_100078069 | Ga0068864_1000780691 | 703 |
| 46 | 3300006237 | Ga0097621_100086773 | Ga0097621_1000867731 | 703 |
| 47 | 3300009093 | Ga0105240_10138630 | Ga0105240_101386302 | 703 |
| 48 | 3300009553 | Ga0105249_10016569 | Ga0105249_100165691 | 703 |
| 49 | 3300013296 | Ga0157374_10056534 | Ga0157374_100565344 | 703 |
| 50 | 3300013307 | Ga0157372_10108653 | Ga0157372_101086531 | 703 |
| 51 | 3300025919 | Ga0207657_10077279 | Ga0207657_100772792 | 703 |
| 52 | 3300025933 | Ga0207706_10033575 | Ga0207706_100335752 | 703 |
| 53 | 3300025941 | Ga0207711_10067425 | Ga0207711_100674251 | 703 |
| 54 | 3300026116 | Ga0207674_10006413 | Ga0207674_100064135 | 703 |
| 55 | 3300048907 | Ga0496104_0040288 | Ga0496104_0040288_1915_4251 | 703 |
| 56 | 3300048908 | Ga0496105_0043255 | Ga0496105_0043255_658_2994 | 703 |
| 57 | 3300048911 | Ga0496108_0015495 | Ga0496108_0015495_1652_3988 | 703 |
| 58 | 3300048912 | Ga0496109_0014093 | Ga0496109_0014093_2433_4769 | 703 |
| 59 | 3300048913 | Ga0496110_0025835 | Ga0496110_0025835_2462_4798 | 703 |
| 60 | 3300048914 | Ga0496111_0013094 | Ga0496111_0013094_224_2560 | 703 |
| 61 | 3300050510 | nmdc:mga06r32_15507_c1 | nmdc:mga06r32_15507_c1_4313_6610 | 703 |
| 62 | 3300005329 | Ga0070683_100017433 | Ga0070683_1000174332 | 704 |
| 63 | 3300005338 | Ga0068868_100020752 | Ga0068868_1000207525 | 704 |
| 64 | 3300005354 | Ga0070675_100013247 | Ga0070675_1000132471 | 704 |
| 65 | 3300005366 | Ga0070659_100024433 | Ga0070659_1000244331 | 704 |
| 66 | 3300005441 | Ga0070700_100005940 | Ga0070700_1000059402 | 704 |
| 67 | 3300005455 | Ga0070663_100018991 | Ga0070663_1000189913 | 704 |
| 68 | 3300005577 | Ga0068857_100015767 | Ga0068857_1000157677 | 704 |
| 69 | 3300005614 | Ga0068856_100006583 | Ga0068856_1000065837 | 704 |
| 70 | 3300005615 | Ga0070702_100028732 | Ga0070702_1000287321 | 704 |
| 71 | 3300005616 | Ga0068852_100044193 | Ga0068852_1000441931 | 704 |
| 72 | 3300005843 | Ga0068860_100108581 | Ga0068860_1001085811 | 704 |
| 73 | 3300009094 | Ga0111539_10029566 | Ga0111539_100295667 | 704 |
| 74 | 3300009098 | Ga0105245_10037843 | Ga0105245_100378433 | 704 |
| 75 | 3300009174 | Ga0105241_10002240 | Ga0105241_100022407 | 704 |
| 76 | 3300009176 | Ga0105242_10056419 | Ga0105242_100564192 | 704 |
| 77 | 3300009545 | Ga0105237_10081267 | Ga0105237_100812672 | 704 |
| 78 | 3300013307 | Ga0157372_10022180 | Ga0157372_100221804 | 704 |
| 79 | 3300025926 | Ga0207659_10039522 | Ga0207659_100395222 | 704 |
| 80 | 3300025932 | Ga0207690_10019110 | Ga0207690_100191103 | 704 |
| 81 | 3300026023 | Ga0207677_10014955 | Ga0207677_100149554 | 704 |
| 82 | 3300026067 | Ga0207678_10032253 | Ga0207678_100322534 | 704 |
| 83 | 3300026075 | Ga0207708_10011793 | Ga0207708_100117931 | 704 |
| 84 | 3300026121 | Ga0207683_10097816 | Ga0207683_100978161 | 704 |
| 85 | 3300027907 | Ga0207428_10063864 | Ga0207428_100638642 | 704 |
| 86 | 3300028381 | Ga0268264_10074071 | Ga0268264_100740712 | 704 |
| 87 | 3300037466 | Ga0395898_0112022 | Ga0395898_0112022_203_2521 | 704 |
| 88 | 3300038443 | Ga0395901_0114077 | Ga0395901_0114077_167_2485 | 704 |
| 89 | 3300049823 | Ga0501044_0000129 | Ga0501044_0000129_89014_91284 | 704 |
| 90 | 3300050511 | nmdc:mga08y16_23587_c1 | nmdc:mga08y16_23587_c1_3972_6329 | 704 |
| 91 | 3300006871 | Ga0075434_100000294 | Ga0075434_10000029429 | 705 |
| 92 | 3300007076 | Ga0075435_100024294 | Ga0075435_1000242943 | 705 |
| 93 | 3300049568 | Ga0501031_0012739 | Ga0501031_0012739_46_2325 | 705 |
| 94 | 3300049577 | Ga0501041_0022031 | Ga0501041_0022031_366_2645 | 705 |
| 95 | 3300049588 | Ga0501072_0041387 | Ga0501072_0041387_1213_3492 | 705 |
| 96 | 3300049741 | Ga0501079_0013817 | Ga0501079_0013817_1071_3350 | 705 |
| 97 | 3300054114 | Ga0501084_0016429 | Ga0501084_0016429_3015_5294 | 705 |
| 98 | 3300060353 | Ga0501082_0017479 | Ga0501082_0017479_334_2613 | 705 |
| 99 | 3300013306 | Ga0163162_10030588 | Ga0163162_100305884 | 706 |
| 100 | 3300031235 | Ga0265330_10020819 | Ga0265330_100208191 | 706 |
| 101 | 3300032004 | Ga0307414_10039841 | Ga0307414_100398412 | 706 |
| 102 | 3300048907 | Ga0496104_0056584 | Ga0496104_0056584_167_2473 | 706 |
| 103 | 3300009545 | Ga0105237_10012837 | Ga0105237_100128372 | 707 |
| 104 | 3300049568 | Ga0501031_0000043 | Ga0501031_0000043_45323_47617 | 707 |
| 105 | 3300049822 | Ga0501035_0001671 | Ga0501035_0001671_12268_14562 | 707 |
| 106 | 3300049823 | Ga0501044_0000032 | Ga0501044_0000032_62852_65146 | 707 |
| 107 | 3300003373 | JGI25407J50210_10001083 | JGI25407J50210_100010834 | 708 |
| 108 | 3300005458 | Ga0070681_10088473 | Ga0070681_100884732 | 708 |
| 109 | 3300005981 | Ga0081538_10005079 | Ga0081538_100050795 | 708 |
| 110 | 3300021384 | Ga0213876_10000312 | Ga0213876_1000031213 | 708 |
| 111 | 3300025912 | Ga0207707_10032978 | Ga0207707_100329782 | 708 |
| 112 | 3300028573 | Ga0265334_10007814 | Ga0265334_100078144 | 708 |
| 113 | 3300028800 | Ga0265338_10011316 | Ga0265338_100113164 | 708 |
| 114 | 3300028800 | Ga0265338_10034240 | Ga0265338_100342403 | 708 |
| 115 | 3300049571 | Ga0501034_0062823 | Ga0501034_0062823_366_2708 | 709 |
| 116 | 3300049743 | Ga0501081_0018173 | Ga0501081_0018173_514_2796 | 709 |
| 117 | 3300027717 | Ga0209998_10001553 | Ga0209998_100015533 | 710 |
| 118 | 3300005539 | Ga0068853_100019193 | Ga0068853_1000191935 | 711 |
| 119 | 3300005564 | Ga0070664_100024230 | Ga0070664_1000242304 | 711 |
| 120 | 3300010375 | Ga0105239_10013523 | Ga0105239_100135235 | 711 |
| 121 | 3300013296 | Ga0157374_10007726 | Ga0157374_100077262 | 711 |
| 122 | 3300025940 | Ga0207691_10053559 | Ga0207691_100535592 | 711 |
| 123 | 3300025945 | Ga0207679_10007252 | Ga0207679_100072523 | 711 |
| 124 | 3300029957 | Ga0265324_10000038 | Ga0265324_1000003838 | 711 |
| 125 | 3300031249 | Ga0265339_10000039 | Ga0265339_1000003940 | 711 |
| 126 | 3300037068 | Ga0373925_0019751 | Ga0373925_0019751_2056_4335 | 711 |
| 127 | 3300046472 | Ga0495580_0004454 | Ga0495580_0004454_9112_11391 | 711 |
| 128 | 3300047319 | Ga0495674_0038142 | Ga0495674_0038142_1508_3802 | 711 |
| 129 | 3300005329 | Ga0070683_100038094 | Ga0070683_1000380942 | 712 |
| 130 | 3300005937 | Ga0081455_10023949 | Ga0081455_100239494 | 712 |
| 131 | 3300009094 | Ga0111539_10003257 | Ga0111539_1000325720 | 712 |
| 132 | 3300009147 | Ga0114129_10065801 | Ga0114129_100658012 | 712 |
| 133 | 3300025944 | Ga0207661_10059574 | Ga0207661_100595742 | 712 |
| 134 | 3300027907 | Ga0207428_10020618 | Ga0207428_100206182 | 712 |
| 135 | 3300050511 | nmdc:mga08y16_82223_c1 | nmdc:mga08y16_82223_c1_396_2630 | 712 |
| 136 | 3300001990 | JGI24737J22298_10008703 | JGI24737J22298_100087032 | 713 |
| 137 | 3300005340 | Ga0070689_100009969 | Ga0070689_1000099695 | 713 |
| 138 | 3300005365 | Ga0070688_100006583 | Ga0070688_1000065836 | 713 |
| 139 | 3300005441 | Ga0070700_100013333 | Ga0070700_1000133333 | 713 |
| 140 | 3300005466 | Ga0070685_10002004 | Ga0070685_100020044 | 713 |
| 141 | 3300005615 | Ga0070702_100004472 | Ga0070702_1000044725 | 713 |
| 142 | 3300005618 | Ga0068864_100019452 | Ga0068864_1000194523 | 713 |
| 143 | 3300005842 | Ga0068858_100021855 | Ga0068858_1000218552 | 713 |
| 144 | 3300005843 | Ga0068860_100026137 | Ga0068860_1000261375 | 713 |
| 145 | 3300005844 | Ga0068862_100021617 | Ga0068862_1000216172 | 713 |
| 146 | 3300006881 | Ga0068865_100009469 | Ga0068865_1000094693 | 713 |
| 147 | 3300009098 | Ga0105245_10040689 | Ga0105245_100406892 | 713 |
| 148 | 3300009553 | Ga0105249_10009340 | Ga0105249_100093403 | 713 |
| 149 | 3300010375 | Ga0105239_10030485 | Ga0105239_100304854 | 713 |
| 150 | 3300014745 | Ga0157377_10005918 | Ga0157377_100059182 | 713 |
| 151 | 3300025899 | Ga0207642_10004668 | Ga0207642_100046682 | 713 |
| 152 | 3300025901 | Ga0207688_10004387 | Ga0207688_100043874 | 713 |
| 153 | 3300025935 | Ga0207709_10013696 | Ga0207709_100136963 | 713 |
| 154 | 3300025936 | Ga0207670_10009676 | Ga0207670_100096762 | 713 |
| 155 | 3300026041 | Ga0207639_10017297 | Ga0207639_100172971 | 713 |
| 156 | 3300026075 | Ga0207708_10024165 | Ga0207708_100241652 | 713 |
| 157 | 3300026089 | Ga0207648_10029578 | Ga0207648_100295782 | 713 |
| 158 | 3300026118 | Ga0207675_100004314 | Ga0207675_1000043144 | 713 |
| 159 | 3300048905 | Ga0496102_0062016 | Ga0496102_0062016_802_3138 | 713 |
| 160 | 3300048909 | Ga0496106_0006900 | Ga0496106_0006900_5221_7557 | 713 |
| 161 | 3300048910 | Ga0496107_0039622 | Ga0496107_0039622_887_3223 | 713 |
| 162 | 3300048911 | Ga0496108_0053039 | Ga0496108_0053039_193_2529 | 713 |
| 163 | 3300048912 | Ga0496109_0008972 | Ga0496109_0008972_2255_4591 | 713 |
| 164 | 3300048913 | Ga0496110_0004086 | Ga0496110_0004086_8139_10475 | 713 |
| 165 | 3300049577 | Ga0501041_0023830 | Ga0501041_0023830_661_2895 | 713 |
| 166 | 3300049588 | Ga0501072_0018889 | Ga0501072_0018889_28_2262 | 713 |
| 167 | 3300049592 | Ga0501076_0003362 | Ga0501076_0003362_6496_8730 | 713 |
| 168 | 3300049824 | Ga0501045_0003384 | Ga0501045_0003384_6887_9121 | 713 |
| 169 | 3300061734 | Ga0530510_0011936 | Ga0530510_0011936_3834_6068 | 713 |
| 170 | 3300002239 | JGI24034J26672_10000065 | JGI24034J26672_1000006534 | 714 |
| 171 | 3300005295 | Ga0065707_10002102 | Ga0065707_100021025 | 714 |
| 172 | 3300005937 | Ga0081455_10000836 | Ga0081455_1000083612 | 714 |
| 173 | 3300031995 | Ga0307409_100030717 | Ga0307409_1000307172 | 714 |
| 174 | 3300042005 | Ga0439448_0005500 | Ga0439448_0005500_507_2834 | 714 |
| 175 | 3300009098 | Ga0105245_10000316 | Ga0105245_1000031650 | 715 |
| 176 | 3300025927 | Ga0207687_10000887 | Ga0207687_1000088716 | 715 |
| 177 | 3300031595 | Ga0265313_10017269 | Ga0265313_100172692 | 715 |
| 178 | 3300005458 | Ga0070681_10031227 | Ga0070681_100312272 | 717 |
| 179 | 3300048904 | Ga0496101_0037060 | Ga0496101_0037060_241_2577 | 718 |
| 180 | 3300032002 | Ga0307416_100032345 | Ga0307416_1000323453 | 719 |
| 181 | 3300048911 | Ga0496108_0050045 | Ga0496108_0050045_850_3261 | 719 |
| 182 | 3300048915 | Ga0496112_0035155 | Ga0496112_0035155_2047_4452 | 719 |
| 183 | 3300005406 | Ga0070703_10002775 | Ga0070703_100027754 | 720 |
| 184 | 3300005440 | Ga0070705_100001456 | Ga0070705_1000014569 | 720 |
| 185 | 3300005445 | Ga0070708_100002244 | Ga0070708_10000224416 | 720 |
| 186 | 3300005467 | Ga0070706_100001656 | Ga0070706_10000165616 | 720 |
| 187 | 3300005518 | Ga0070699_100026887 | Ga0070699_1000268874 | 720 |
| 188 | 3300005536 | Ga0070697_100001122 | Ga0070697_10000112214 | 720 |
| 189 | 3300005545 | Ga0070695_100001346 | Ga0070695_1000013467 | 720 |
| 190 | 3300005546 | Ga0070696_100002232 | Ga0070696_1000022324 | 720 |
| 191 | 3300005547 | Ga0070693_100000295 | Ga0070693_10000029513 | 720 |
| 192 | 3300005549 | Ga0070704_100002299 | Ga0070704_1000022999 | 720 |
| 193 | 3300005614 | Ga0068856_100081964 | Ga0068856_1000819642 | 720 |
| 194 | 3300005981 | Ga0081538_10003168 | Ga0081538_1000316812 | 720 |
| 195 | 3300025885 | Ga0207653_10003362 | Ga0207653_100033623 | 720 |
| 196 | 3300025910 | Ga0207684_10006810 | Ga0207684_100068101 | 720 |
| 197 | 3300025921 | Ga0207652_10082700 | Ga0207652_100827002 | 720 |
| 198 | 3300035086 | Ga0373934_0002168 | Ga0373934_0002168_4363_6573 | 720 |
| 199 | 3300035111 | Ga0373923_0002299 | Ga0373923_0002299_41_2251 | 720 |
| 200 | 3300035117 | Ga0373953_0002942 | Ga0373953_0002942_1372_3582 | 720 |
| 201 | 3300035119 | Ga0373956_0010988 | Ga0373956_0010988_132_2342 | 720 |
| 202 | 3300037068 | Ga0373925_0008070 | Ga0373925_0008070_4551_6761 | 720 |
| 203 | 3300045051 | Ga0451576_0016035 | Ga0451576_0016035_4867_7206 | 720 |
| 204 | 3300046454 | Ga0495592_0031774 | Ga0495592_0031774_110_2320 | 720 |
| 205 | 3300046463 | Ga0495653_0002547 | Ga0495653_0002547_12277_14487 | 720 |
| 206 | 3300046511 | Ga0495608_0025250 | Ga0495608_0025250_1281_3491 | 720 |
| 207 | 3300046516 | Ga0495628_0016038 | Ga0495628_0016038_2993_5203 | 720 |
| 208 | 3300046533 | Ga0495640_0021018 | Ga0495640_0021018_2023_4233 | 720 |
| 209 | 3300046535 | Ga0495586_0029890 | Ga0495586_0029890_565_2775 | 720 |
| 210 | 3300046675 | Ga0495657_0004212 | Ga0495657_0004212_4404_6614 | 720 |
| 211 | 3300046678 | Ga0495599_0005873 | Ga0495599_0005873_1813_4023 | 720 |
| 212 | 3300046689 | Ga0495613_0038678 | Ga0495613_0038678_913_3123 | 720 |
| 213 | 3300046809 | Ga0495600_0006209 | Ga0495600_0006209_4918_7128 | 720 |
| 214 | 3300047317 | Ga0495604_0063499 | Ga0495604_0063499_544_2754 | 720 |
| 215 | 3300047444 | Ga0495675_0003519 | Ga0495675_0003519_2654_4864 | 720 |
| 216 | 3300049585 | Ga0501069_0019188 | Ga0501069_0019188_35_2356 | 720 |
| 217 | 3300053085 | Ga0495619_0006383 | Ga0495619_0006383_1634_3844 | 720 |
| 218 | 3300006846 | Ga0075430_100005138 | Ga0075430_1000051388 | 721 |
| 219 | 3300028800 | Ga0265338_10003096 | Ga0265338_1000309614 | 721 |
| 220 | 3300021361 | Ga0213872_10000811 | Ga0213872_100008113 | 722 |
| 221 | 3300039447 | Ga0436361_0259259 | Ga0436361_0259259_2565_4850 | 722 |
| 222 | 3300039447 | Ga0436361_0306192 | Ga0436361_0306192_25869_28196 | 722 |
| 223 | 3300044673 | Ga0453683_0000130 | Ga0453683_0000130_54961_57267 | 722 |
| 224 | 3300044712 | Ga0453684_0000306 | Ga0453684_0000306_135184_137478 | 722 |
| 225 | 3300042876 | Ga0451577_0006548 | Ga0451577_0006548_2425_4722 | 723 |
| 226 | 3300045051 | Ga0451576_0022735 | Ga0451576_0022735_2427_4724 | 723 |
| 227 | 3300005563 | Ga0068855_100027713 | Ga0068855_1000277134 | 724 |
| 228 | 3300005614 | Ga0068856_100001573 | Ga0068856_10000157310 | 724 |
| 229 | 3300025949 | Ga0207667_10017686 | Ga0207667_100176867 | 724 |
| 230 | 3300026078 | Ga0207702_10005990 | Ga0207702_1000599010 | 724 |
| 231 | 3300048913 | Ga0496110_0033412 | Ga0496110_0033412_2078_4360 | 726 |
| 232 | 3300005435 | Ga0070714_100000872 | Ga0070714_10000087217 | 727 |
| 233 | 3300009094 | Ga0111539_10034113 | Ga0111539_100341131 | 727 |
| 234 | 3300009176 | Ga0105242_10004057 | Ga0105242_100040578 | 727 |
| 235 | 3300013308 | Ga0157375_10023093 | Ga0157375_100230932 | 727 |
| 236 | 3300025929 | Ga0207664_10003416 | Ga0207664_100034164 | 727 |
| 237 | 3300039437 | Ga0436365_0829382 | Ga0436365_0829382_13535_15886 | 727 |
| 238 | 3300045051 | Ga0451576_0022762 | Ga0451576_0022762_3782_6058 | 727 |
| 239 | iso_pu_bacteria | 2891554331 | 2891557389 | 727 |
| 240 | 3300005445 | Ga0070708_100011559 | Ga0070708_1000115594 | 728 |
| 241 | 3300005455 | Ga0070663_100030270 | Ga0070663_1000302702 | 728 |
| 242 | 3300005458 | Ga0070681_10006936 | Ga0070681_100069362 | 728 |
| 243 | 3300005467 | Ga0070706_100006706 | Ga0070706_1000067065 | 728 |
| 244 | 3300005468 | Ga0070707_100041218 | Ga0070707_1000412181 | 728 |
| 245 | 3300005471 | Ga0070698_100004102 | Ga0070698_1000041021 | 728 |
| 246 | 3300005518 | Ga0070699_100009102 | Ga0070699_1000091025 | 728 |
| 247 | 3300005530 | Ga0070679_100004764 | Ga0070679_10000476410 | 728 |
| 248 | 3300005536 | Ga0070697_100001484 | Ga0070697_10000148414 | 728 |
| 249 | 3300005614 | Ga0068856_100004257 | Ga0068856_10000425714 | 728 |
| 250 | 3300006038 | Ga0075365_10015500 | Ga0075365_100155002 | 728 |
| 251 | 3300006237 | Ga0097621_100005320 | Ga0097621_1000053202 | 728 |
| 252 | 3300006881 | Ga0068865_100014504 | Ga0068865_1000145047 | 728 |
| 253 | 3300009093 | Ga0105240_10068849 | Ga0105240_100688492 | 728 |
| 254 | 3300009174 | Ga0105241_10054050 | Ga0105241_100540502 | 728 |
| 255 | 3300009545 | Ga0105237_10002481 | Ga0105237_1000248117 | 728 |
| 256 | 3300009551 | Ga0105238_10040502 | Ga0105238_100405021 | 728 |
| 257 | 3300013105 | Ga0157369_10030326 | Ga0157369_100303265 | 728 |
| 258 | 3300025910 | Ga0207684_10002897 | Ga0207684_1000289710 | 728 |
| 259 | 3300025912 | Ga0207707_10004083 | Ga0207707_100040839 | 728 |
| 260 | 3300025913 | Ga0207695_10099426 | Ga0207695_100994262 | 728 |
| 261 | 3300025914 | Ga0207671_10040184 | Ga0207671_100401841 | 728 |
| 262 | 3300025916 | Ga0207663_10023589 | Ga0207663_100235893 | 728 |
| 263 | 3300025919 | Ga0207657_10030218 | Ga0207657_100302182 | 728 |
| 264 | 3300025921 | Ga0207652_10002805 | Ga0207652_1000280510 | 728 |
| 265 | 3300025922 | Ga0207646_10009125 | Ga0207646_1000912510 | 728 |
| 266 | 3300025924 | Ga0207694_10042853 | Ga0207694_100428532 | 728 |
| 267 | 3300025934 | Ga0207686_10002621 | Ga0207686_100026213 | 728 |
| 268 | 3300025938 | Ga0207704_10014258 | Ga0207704_100142584 | 728 |
| 269 | 3300025949 | Ga0207667_10033874 | Ga0207667_100338742 | 728 |
| 270 | 3300026067 | Ga0207678_10017526 | Ga0207678_100175262 | 728 |
| 271 | 3300026078 | Ga0207702_10005253 | Ga0207702_100052532 | 728 |
| 272 | 3300039450 | Ga0436363_0558892 | Ga0436363_0558892_638_2914 | 728 |
| 273 | 3300049585 | Ga0501069_0002005 | Ga0501069_0002005_4384_6687 | 728 |
| 274 | 3300049742 | Ga0501080_0000484 | Ga0501080_0000484_12431_14734 | 728 |
| 275 | 3300050492 | nmdc:mga0yw44_8024_c1 | nmdc:mga0yw44_8024_c1_1266_3623 | 728 |
| 276 | iso_pu_bacteria | 2891395885 | 2891399272 | 728 |
| 277 | 3300005295 | Ga0065707_10081984 | Ga0065707_100819846 | 729 |
| 278 | 3300005434 | Ga0070709_10007885 | Ga0070709_100078856 | 729 |
| 279 | 3300005435 | Ga0070714_100039317 | Ga0070714_1000393171 | 729 |
| 280 | 3300005436 | Ga0070713_100037706 | Ga0070713_1000377061 | 729 |
| 281 | 3300005548 | Ga0070665_100000005 | Ga0070665_100000005197 | 729 |
| 282 | 3300005842 | Ga0068858_100048810 | Ga0068858_1000488102 | 729 |
| 283 | 3300006028 | Ga0070717_10004535 | Ga0070717_100045356 | 729 |
| 284 | 3300006175 | Ga0070712_100022276 | Ga0070712_1000222763 | 729 |
| 285 | 3300006237 | Ga0097621_100056628 | Ga0097621_1000566281 | 729 |
| 286 | 3300006844 | Ga0075428_100087943 | Ga0075428_1000879432 | 729 |
| 287 | 3300006880 | Ga0075429_100078001 | Ga0075429_1000780012 | 729 |
| 288 | 3300006914 | Ga0075436_100003333 | Ga0075436_1000033334 | 729 |
| 289 | 3300007076 | Ga0075435_100047496 | Ga0075435_1000474963 | 729 |
| 290 | 3300009093 | Ga0105240_10012786 | Ga0105240_1001278611 | 729 |
| 291 | 3300009093 | Ga0105240_10046551 | Ga0105240_100465513 | 729 |
| 292 | 3300009093 | Ga0105240_10054859 | Ga0105240_100548592 | 729 |
| 293 | 3300009098 | Ga0105245_10005955 | Ga0105245_100059558 | 729 |
| 294 | 3300013105 | Ga0157369_10102941 | Ga0157369_101029412 | 729 |
| 295 | 3300013297 | Ga0157378_10035214 | Ga0157378_100352142 | 729 |
| 296 | 3300013307 | Ga0157372_10004519 | Ga0157372_1000451911 | 729 |
| 297 | 3300013307 | Ga0157372_10058151 | Ga0157372_100581513 | 729 |
| 298 | 3300021361 | Ga0213872_10018339 | Ga0213872_100183391 | 729 |
| 299 | 3300025913 | Ga0207695_10008507 | Ga0207695_1000850710 | 729 |
| 300 | 3300025913 | Ga0207695_10062900 | Ga0207695_100629002 | 729 |
| 301 | 3300025915 | Ga0207693_10003993 | Ga0207693_100039937 | 729 |
| 302 | 3300028379 | Ga0268266_10000012 | Ga0268266_10000012452 | 729 |
| 303 | 3300035083 | Ga0373926_0004262 | Ga0373926_0004262_1730_4024 | 729 |
| 304 | 3300035725 | Ga0373947_0002484 | Ga0373947_0002484_3966_6260 | 729 |
| 305 | 3300036401 | Ga0373937_0013594 | Ga0373937_0013594_2343_4637 | 729 |
| 306 | 3300037068 | Ga0373925_0003855 | Ga0373925_0003855_3860_6154 | 729 |
| 307 | 3300037068 | Ga0373925_0026193 | Ga0373925_0026193_1871_4159 | 729 |
| 308 | 3300037853 | Ga0436364_0961538 | Ga0436364_0961538_374_2665 | 729 |
| 309 | 3300039447 | Ga0436361_0013419 | Ga0436361_0013419_38_2332 | 729 |
| 310 | 3300046472 | Ga0495580_0002418 | Ga0495580_0002418_12865_15159 | 729 |
| 311 | 3300046472 | Ga0495580_0004869 | Ga0495580_0004869_3671_5965 | 729 |
| 312 | 3300046473 | Ga0495582_0000413 | Ga0495582_0000413_13828_16122 | 729 |
| 313 | 3300046514 | Ga0495618_0005277 | Ga0495618_0005277_4596_6887 | 729 |
| 314 | 3300046642 | Ga0495634_0005921 | Ga0495634_0005921_1546_3837 | 729 |
| 315 | 3300046689 | Ga0495613_0005696 | Ga0495613_0005696_953_3241 | 729 |
| 316 | 3300047315 | Ga0495581_0005270 | Ga0495581_0005270_1641_3935 | 729 |
| 317 | 3300047322 | Ga0495680_0030067 | Ga0495680_0030067_104_2395 | 729 |
| 318 | 3300050511 | nmdc:mga08y16_89288_c1 | nmdc:mga08y16_89288_c1_12_2291 | 729 |
| 319 | 3300050513 | nmdc:mga0rr50_6120_c1 | nmdc:mga0rr50_6120_c1_4109_6403 | 729 |
| 320 | 3300005578 | Ga0068854_100020179 | Ga0068854_1000201793 | 730 |
| 321 | 3300006038 | Ga0075365_10000297 | Ga0075365_1000029717 | 730 |
| 322 | 3300006038 | Ga0075365_10013792 | Ga0075365_100137924 | 730 |
| 323 | 3300006051 | Ga0075364_10003478 | Ga0075364_100034785 | 730 |
| 324 | 3300006051 | Ga0075364_10028827 | Ga0075364_100288272 | 730 |
| 325 | 3300009093 | Ga0105240_10016140 | Ga0105240_100161408 | 730 |
| 326 | 3300042876 | Ga0451577_0069100 | Ga0451577_0069100_685_3009 | 730 |
| 327 | 3300044712 | Ga0453684_0155339 | Ga0453684_0155339_95_2419 | 730 |
| 328 | 3300050491 | nmdc:mga00v17_3015_c1 | nmdc:mga00v17_3015_c1_4980_7280 | 730 |
| 329 | 3300050492 | nmdc:mga0yw44_27164_c1 | nmdc:mga0yw44_27164_c1_853_3195 | 730 |
| 330 | 3300006846 | Ga0075430_100005816 | Ga0075430_1000058162 | 732 |
| 331 | 3300006847 | Ga0075431_100001497 | Ga0075431_1000014979 | 732 |
| 332 | 3300042009 | Ga0439451_000928 | Ga0439451_000928_1726_4032 | 732 |
| 333 | 3300050508 | nmdc:mga09592_4143_c1 | nmdc:mga09592_4143_c1_2846_5176 | 732 |
| 334 | 3300050509 | nmdc:mga0qj67_4250_c1 | nmdc:mga0qj67_4250_c1_1922_4252 | 732 |
| 335 | iso_pu_bacteria | 2558860112 | 2558914799 | 732 |
| 336 | 3300005577 | Ga0068857_100023534 | Ga0068857_1000235343 | 733 |
| 337 | 3300005985 | Ga0081539_10002861 | Ga0081539_1000286110 | 733 |
| 338 | 3300006844 | Ga0075428_100005809 | Ga0075428_10000580915 | 733 |
| 339 | 3300006846 | Ga0075430_100003638 | Ga0075430_1000036382 | 733 |
| 340 | 3300009094 | Ga0111539_10042459 | Ga0111539_100424593 | 733 |
| 341 | 3300009147 | Ga0114129_10002027 | Ga0114129_1000202714 | 733 |
| 342 | 3300025949 | Ga0207667_10111411 | Ga0207667_101114111 | 733 |
| 343 | 3300026116 | Ga0207674_10045260 | Ga0207674_100452603 | 733 |
| 344 | 3300027907 | Ga0207428_10050645 | Ga0207428_100506452 | 733 |
| 345 | 3300031548 | Ga0307408_100012298 | Ga0307408_1000122983 | 733 |
| 346 | 3300031824 | Ga0307413_10001002 | Ga0307413_100010026 | 733 |
| 347 | 3300031911 | Ga0307412_10025210 | Ga0307412_100252101 | 733 |
| 348 | 3300031995 | Ga0307409_100020077 | Ga0307409_1000200774 | 733 |
| 349 | 3300031995 | Ga0307409_100080824 | Ga0307409_1000808241 | 733 |
| 350 | 3300032126 | Ga0307415_100012395 | Ga0307415_1000123952 | 733 |
| 351 | 3300032126 | Ga0307415_100018805 | Ga0307415_1000188054 | 733 |
| 352 | 3300044712 | Ga0453684_0037081 | Ga0453684_0037081_3744_6077 | 733 |
| 353 | 3300049575 | Ga0501039_0015679 | Ga0501039_0015679_743_3082 | 733 |
| 354 | 3300050492 | nmdc:mga0yw44_30676_c1 | nmdc:mga0yw44_30676_c1_641_2989 | 733 |
| 355 | 3300050507 | nmdc:mga05p37_1595_c1 | nmdc:mga05p37_1595_c1_8986_11319 | 733 |
| 356 | 3300050508 | nmdc:mga09592_33132_c1 | nmdc:mga09592_33132_c1_1213_3546 | 733 |
| 357 | 3300050509 | nmdc:mga0qj67_26132_c1 | nmdc:mga0qj67_26132_c1_1445_3778 | 733 |
| 358 | 3300050511 | nmdc:mga08y16_39169_c1 | nmdc:mga08y16_39169_c1_1234_3570 | 733 |
| 359 | iso_pu_bacteria | 2842134933 | 2842138796 | 733 |
| 360 | 3300005981 | Ga0081538_10016936 | Ga0081538_100169362 | 734 |
| 361 | 3300006844 | Ga0075428_100041964 | Ga0075428_1000419643 | 734 |
| 362 | 3300006846 | Ga0075430_100002488 | Ga0075430_1000024888 | 734 |
| 363 | 3300006847 | Ga0075431_100006457 | Ga0075431_1000064577 | 734 |
| 364 | 3300050509 | nmdc:mga0qj67_1688_c1 | nmdc:mga0qj67_1688_c1_5817_8147 | 734 |
| 365 | 3300050510 | nmdc:mga06r32_5717_c1 | nmdc:mga06r32_5717_c1_4439_6769 | 734 |
| 366 | 3300036647 | Ga0316582_0025860 | Ga0316582_0025860_775_3021 | 735 |
| 367 | 3300049130 | Ga0501310_000308 | Ga0501310_000308_1991_4324 | 735 |
| 368 | 3300053154 | Ga0500619_000019 | Ga0500619_000019_14751_17060 | 735 |
| 369 | iso_pu_bacteria | 2738543005 | 2739206295 | 735 |
| 370 | 3300005339 | Ga0070660_100033687 | Ga0070660_1000336873 | 736 |
| 371 | 3300005937 | Ga0081455_10029734 | Ga0081455_100297342 | 736 |
| 372 | 3300014497 | Ga0182008_10000720 | Ga0182008_1000072012 | 736 |
| 373 | 3300015262 | Ga0182007_10000119 | Ga0182007_1000011956 | 736 |
| 374 | 3300031995 | Ga0307409_100050642 | Ga0307409_1000506421 | 736 |
| 375 | iso_pu_bacteria | 2855386786 | 2855387357 | 736 |
| 376 | 3300049568 | Ga0501031_0011811 | Ga0501031_0011811_2371_4779 | 737 |
| 377 | 3300049575 | Ga0501039_0022829 | Ga0501039_0022829_1133_3541 | 737 |
| 378 | 3300049576 | Ga0501040_0026961 | Ga0501040_0026961_163_2571 | 737 |
| 379 | 3300049580 | Ga0501046_0048393 | Ga0501046_0048393_255_2663 | 737 |
| 380 | 3300049584 | Ga0501068_0016956 | Ga0501068_0016956_1291_3699 | 737 |
| 381 | 3300049587 | Ga0501071_0013274 | Ga0501071_0013274_157_2565 | 737 |
| 382 | 3300049591 | Ga0501075_0028103 | Ga0501075_0028103_1431_3839 | 737 |
| 383 | 3300060353 | Ga0501082_0032968 | Ga0501082_0032968_679_3087 | 737 |
| 384 | 3300025922 | Ga0207646_10017582 | Ga0207646_100175826 | 738 |
| 385 | 3300046511 | Ga0495608_0001600 | Ga0495608_0001600_9353_11665 | 738 |
| 386 | 3300005336 | Ga0070680_100000220 | Ga0070680_10000022019 | 739 |
| 387 | 3300005444 | Ga0070694_100014518 | Ga0070694_1000145186 | 739 |
| 388 | 3300005458 | Ga0070681_10025967 | Ga0070681_100259674 | 739 |
| 389 | 3300005468 | Ga0070707_100001104 | Ga0070707_10000110412 | 739 |
| 390 | 3300005518 | Ga0070699_100001129 | Ga0070699_10000112911 | 739 |
| 391 | 3300005530 | Ga0070679_100003375 | Ga0070679_1000033756 | 739 |
| 392 | 3300005536 | Ga0070697_100003818 | Ga0070697_10000381810 | 739 |
| 393 | 3300005545 | Ga0070695_100009252 | Ga0070695_1000092525 | 739 |
| 394 | 3300005546 | Ga0070696_100004515 | Ga0070696_1000045158 | 739 |
| 395 | 3300005547 | Ga0070693_100006307 | Ga0070693_1000063075 | 739 |
| 396 | 3300005549 | Ga0070704_100007594 | Ga0070704_1000075945 | 739 |
| 397 | 3300005563 | Ga0068855_100001151 | Ga0068855_10000115116 | 739 |
| 398 | 3300005578 | Ga0068854_100000264 | Ga0068854_10000026412 | 739 |
| 399 | 3300005614 | Ga0068856_100025033 | Ga0068856_1000250336 | 739 |
| 400 | 3300006173 | Ga0070716_100029671 | Ga0070716_1000296711 | 739 |
| 401 | 3300006175 | Ga0070712_100013453 | Ga0070712_1000134532 | 739 |
| 402 | 3300025906 | Ga0207699_10024681 | Ga0207699_100246812 | 739 |
| 403 | 3300025911 | Ga0207654_10000309 | Ga0207654_1000030911 | 739 |
| 404 | 3300025912 | Ga0207707_10000829 | Ga0207707_1000082918 | 739 |
| 405 | 3300025913 | Ga0207695_10021576 | Ga0207695_100215765 | 739 |
| 406 | 3300025915 | Ga0207693_10016792 | Ga0207693_100167924 | 739 |
| 407 | 3300025917 | Ga0207660_10010927 | Ga0207660_100109274 | 739 |
| 408 | 3300025921 | Ga0207652_10016912 | Ga0207652_100169125 | 739 |
| 409 | 3300025939 | Ga0207665_10028307 | Ga0207665_100283072 | 739 |
| 410 | 3300025949 | Ga0207667_10017582 | Ga0207667_100175825 | 739 |
| 411 | 3300026078 | Ga0207702_10025399 | Ga0207702_100253994 | 739 |
| 412 | 3300025940 | Ga0207691_10018788 | Ga0207691_100187881 | 741 |
| 413 | 3300041486 | Ga0451807_2610835 | Ga0451807_2610835_318_2612 | 742 |
| 414 | 3300005339 | Ga0070660_100006725 | Ga0070660_1000067252 | 743 |
| 415 | 3300005344 | Ga0070661_100000442 | Ga0070661_10000044225 | 743 |
| 416 | 3300005366 | Ga0070659_100022698 | Ga0070659_1000226981 | 743 |
| 417 | 3300005530 | Ga0070679_100107445 | Ga0070679_1001074452 | 743 |
| 418 | 3300005535 | Ga0070684_100006299 | Ga0070684_1000062993 | 743 |
| 419 | 3300005539 | Ga0068853_100059051 | Ga0068853_1000590512 | 743 |
| 420 | 3300005564 | Ga0070664_100014276 | Ga0070664_1000142766 | 743 |
| 421 | 3300005577 | Ga0068857_100001129 | Ga0068857_1000011297 | 743 |
| 422 | 3300005614 | Ga0068856_100027971 | Ga0068856_1000279716 | 743 |
| 423 | 3300005616 | Ga0068852_100003542 | Ga0068852_1000035422 | 743 |
| 424 | 3300009093 | Ga0105240_10006835 | Ga0105240_1000683518 | 743 |
| 425 | 3300009093 | Ga0105240_10021976 | Ga0105240_100219763 | 743 |
| 426 | 3300009174 | Ga0105241_10028095 | Ga0105241_100280952 | 743 |
| 427 | 3300009545 | Ga0105237_10002758 | Ga0105237_1000275820 | 743 |
| 428 | 3300009545 | Ga0105237_10043839 | Ga0105237_100438393 | 743 |
| 429 | 3300013100 | Ga0157373_10026043 | Ga0157373_100260432 | 743 |
| 430 | 3300013102 | Ga0157371_10010752 | Ga0157371_100107522 | 743 |
| 431 | 3300013104 | Ga0157370_10008065 | Ga0157370_100080659 | 743 |
| 432 | 3300013105 | Ga0157369_10026883 | Ga0157369_100268831 | 743 |
| 433 | 3300013307 | Ga0157372_10074061 | Ga0157372_100740612 | 743 |
| 434 | 3300025250 | Ga0209026_1004101 | Ga0209026_10041013 | 743 |
| 435 | 3300025256 | Ga0209759_1003490 | Ga0209759_10034902 | 743 |
| 436 | 3300025272 | Ga0209455_1000151 | Ga0209455_100015129 | 743 |
| 437 | 3300025911 | Ga0207654_10013085 | Ga0207654_100130852 | 743 |
| 438 | 3300025913 | Ga0207695_10023730 | Ga0207695_100237303 | 743 |
| 439 | 3300025914 | Ga0207671_10016749 | Ga0207671_100167491 | 743 |
| 440 | 3300025919 | Ga0207657_10011933 | Ga0207657_100119339 | 743 |
| 441 | 3300025921 | Ga0207652_10082698 | Ga0207652_100826981 | 743 |
| 442 | 3300025924 | Ga0207694_10006112 | Ga0207694_100061123 | 743 |
| 443 | 3300025929 | Ga0207664_10014221 | Ga0207664_100142214 | 743 |
| 444 | 3300025945 | Ga0207679_10001606 | Ga0207679_100016063 | 743 |
| 445 | 3300025949 | Ga0207667_10024812 | Ga0207667_100248122 | 743 |
| 446 | 3300025949 | Ga0207667_10028456 | Ga0207667_100284565 | 743 |
| 447 | 3300026078 | Ga0207702_10010382 | Ga0207702_100103821 | 743 |
| 448 | 3300026116 | Ga0207674_10000545 | Ga0207674_1000054530 | 743 |
| 449 | 3300026142 | Ga0207698_10004012 | Ga0207698_100040127 | 743 |
| 450 | 3300049586 | Ga0501070_0049236 | Ga0501070_0049236_287_2587 | 744 |
| 451 | 3300025981 | Ga0207640_10039381 | Ga0207640_100393812 | 745 |
| 452 | 3300044712 | Ga0453684_0042322 | Ga0453684_0042322_1113_3395 | 745 |
| 453 | 3300049586 | Ga0501070_0050287 | Ga0501070_0050287_77_2377 | 745 |
| 454 | 3300005327 | Ga0070658_10019021 | Ga0070658_100190213 | 747 |
| 455 | 3300005336 | Ga0070680_100026632 | Ga0070680_1000266322 | 747 |
| 456 | 3300005366 | Ga0070659_100009381 | Ga0070659_1000093815 | 747 |
| 457 | 3300005458 | Ga0070681_10064082 | Ga0070681_100640822 | 747 |
| 458 | 3300005530 | Ga0070679_100025625 | Ga0070679_1000256253 | 747 |
| 459 | 3300005563 | Ga0068855_100093402 | Ga0068855_1000934021 | 747 |
| 460 | 3300005577 | Ga0068857_100050763 | Ga0068857_1000507632 | 747 |
| 461 | 3300009545 | Ga0105237_10027552 | Ga0105237_100275524 | 747 |
| 462 | 3300013102 | Ga0157371_10018158 | Ga0157371_100181586 | 747 |
| 463 | 3300013307 | Ga0157372_10116464 | Ga0157372_101164641 | 747 |
| 464 | 3300025912 | Ga0207707_10028455 | Ga0207707_100284552 | 747 |
| 465 | 3300025921 | Ga0207652_10048349 | Ga0207652_100483493 | 747 |
| 466 | 3300025932 | Ga0207690_10028895 | Ga0207690_100288952 | 747 |
| 467 | 3300025949 | Ga0207667_10093106 | Ga0207667_100931062 | 747 |
| 468 | 3300025981 | Ga0207640_10010970 | Ga0207640_100109703 | 747 |
| 469 | 3300026067 | Ga0207678_10025723 | Ga0207678_100257235 | 747 |
| 470 | 3300049822 | Ga0501035_0003222 | Ga0501035_0003222_9124_11433 | 747 |
| 471 | 3300049823 | Ga0501044_0012042 | Ga0501044_0012042_4655_6964 | 747 |
| 472 | 3300005841 | Ga0068863_100088822 | Ga0068863_1000888222 | 748 |
| 473 | 3300046511 | Ga0495608_0010440 | Ga0495608_0010440_1400_3682 | 748 |
| 474 | 3300046559 | Ga0495667_0000278 | Ga0495667_0000278_8595_10877 | 748 |
| 475 | 3300005344 | Ga0070661_100016691 | Ga0070661_1000166912 | 749 |
| 476 | 3300009545 | Ga0105237_10022252 | Ga0105237_100222525 | 749 |
| 477 | 3300025904 | Ga0207647_10002407 | Ga0207647_100024078 | 749 |
| 478 | 3300025919 | Ga0207657_10007736 | Ga0207657_100077365 | 749 |
| 479 | 3300025932 | Ga0207690_10004619 | Ga0207690_100046196 | 749 |
| 480 | 3300025933 | Ga0207706_10006836 | Ga0207706_100068368 | 749 |
| 481 | 3300025949 | Ga0207667_10020791 | Ga0207667_100207913 | 749 |
| 482 | 3300049822 | Ga0501035_0081612 | Ga0501035_0081612_236_2587 | 749 |
| 483 | 3300049823 | Ga0501044_0022787 | Ga0501044_0022787_80_2431 | 749 |
| 484 | 3300028794 | Ga0307515_10003432 | Ga0307515_100034329 | 751 |
| 485 | 3300005435 | Ga0070714_100028495 | Ga0070714_1000284954 | 752 |
| 486 | 3300025929 | Ga0207664_10026108 | Ga0207664_100261084 | 752 |
| 487 | 3300049744 | Ga0501083_0033535 | Ga0501083_0033535_744_3056 | 753 |
| 488 | 3300005339 | Ga0070660_100019147 | Ga0070660_1000191473 | 754 |
| 489 | 3300005458 | Ga0070681_10000099 | Ga0070681_1000009924 | 754 |
| 490 | 3300013104 | Ga0157370_10036401 | Ga0157370_100364012 | 754 |
| 491 | 3300013105 | Ga0157369_10069526 | Ga0157369_100695262 | 754 |
| 492 | 3300025912 | Ga0207707_10000128 | Ga0207707_100001287 | 754 |
| 493 | 3300025919 | Ga0207657_10017493 | Ga0207657_100174934 | 754 |
| 494 | 3300009093 | Ga0105240_10009341 | Ga0105240_100093415 | 755 |
| 495 | 3300009094 | Ga0111539_10006023 | Ga0111539_100060237 | 755 |
| 496 | 3300009098 | Ga0105245_10005760 | Ga0105245_100057608 | 755 |
| 497 | 3300009174 | Ga0105241_10000844 | Ga0105241_1000084411 | 755 |
| 498 | 3300009545 | Ga0105237_10005799 | Ga0105237_100057998 | 755 |
| 499 | 3300013100 | Ga0157373_10011109 | Ga0157373_100111095 | 755 |
| 500 | 3300013104 | Ga0157370_10007936 | Ga0157370_100079364 | 755 |
| 501 | 3300013307 | Ga0157372_10001074 | Ga0157372_1000107416 | 755 |
| 502 | 3300050511 | nmdc:mga08y16_18544_c1 | nmdc:mga08y16_18544_c1_1139_3451 | 755 |
| 503 | 3300009093 | Ga0105240_10068000 | Ga0105240_100680002 | 756 |
| 504 | 3300025913 | Ga0207695_10026148 | Ga0207695_100261485 | 756 |
| 505 | iso_pu_bacteria | 2537561836 | 2538833742 | 756 |
| 506 | iso_pu_bacteria | 2643221562 | 2643831068 | 756 |
| 507 | iso_pu_bacteria | 2883291878 | 2883292593 | 756 |
| 508 | iso_pu_bacteria | 2895395659 | 2895396262 | 756 |
| 509 | 3300005366 | Ga0070659_100037459 | Ga0070659_1000374592 | 757 |
| 510 | 3300005530 | Ga0070679_100106657 | Ga0070679_1001066571 | 757 |
| 511 | 3300005563 | Ga0068855_100001853 | Ga0068855_10000185318 | 757 |
| 512 | 3300025932 | Ga0207690_10012223 | Ga0207690_100122232 | 757 |
| 513 | 3300025949 | Ga0207667_10002534 | Ga0207667_100025343 | 757 |
| 514 | 3300026067 | Ga0207678_10087243 | Ga0207678_100872431 | 757 |
| 515 | 3300044712 | Ga0453684_0058424 | Ga0453684_0058424_1211_3544 | 757 |
| 516 | 3300053093 | Ga0500651_0008389 | Ga0500651_0008389_3667_5961 | 757 |
| 517 | 3300005327 | Ga0070658_10041659 | Ga0070658_100416591 | 758 |
| 518 | 3300025909 | Ga0207705_10044927 | Ga0207705_100449271 | 758 |
| 519 | 3300046472 | Ga0495580_0065513 | Ga0495580_0065513_60_2372 | 758 |
| 520 | 3300046526 | Ga0495666_0009232 | Ga0495666_0009232_2321_4633 | 758 |
| 521 | 3300049579 | Ga0501043_0002546 | Ga0501043_0002546_5798_8104 | 758 |
| 522 | 3300049580 | Ga0501046_0003075 | Ga0501046_0003075_7305_9611 | 758 |
| 523 | 3300049581 | Ga0501047_0000298 | Ga0501047_0000298_47431_49737 | 758 |
| 524 | iso_pu_bacteria | 2939611941 | 2939614614 | 758 |
| 525 | 3300005458 | Ga0070681_10023219 | Ga0070681_100232194 | 759 |
| 526 | 3300005578 | Ga0068854_100041686 | Ga0068854_1000416863 | 759 |
| 527 | 3300013104 | Ga0157370_10004714 | Ga0157370_100047142 | 759 |
| 528 | 3300013105 | Ga0157369_10000191 | Ga0157369_1000019146 | 759 |
| 529 | 3300013307 | Ga0157372_10018328 | Ga0157372_100183283 | 759 |
| 530 | iso_pu_bacteria | 2643221577 | 2643896379 | 759 |
| 531 | iso_pu_bacteria | 2643221685 | 2644478860 | 759 |
| 532 | 3300005337 | Ga0070682_100002070 | Ga0070682_1000020705 | 760 |
| 533 | 3300005366 | Ga0070659_100018001 | Ga0070659_1000180012 | 760 |
| 534 | 3300005458 | Ga0070681_10014204 | Ga0070681_100142045 | 760 |
| 535 | 3300005530 | Ga0070679_100133524 | Ga0070679_1001335241 | 760 |
| 536 | 3300005539 | Ga0068853_100019581 | Ga0068853_1000195811 | 760 |
| 537 | 3300005539 | Ga0068853_100058872 | Ga0068853_1000588721 | 760 |
| 538 | 3300005546 | Ga0070696_100015156 | Ga0070696_1000151562 | 760 |
| 539 | 3300005563 | Ga0068855_100012611 | Ga0068855_1000126112 | 760 |
| 540 | 3300013100 | Ga0157373_10004598 | Ga0157373_1000459810 | 760 |
| 541 | 3300013102 | Ga0157371_10010207 | Ga0157371_100102072 | 760 |
| 542 | 3300013104 | Ga0157370_10044230 | Ga0157370_100442304 | 760 |
| 543 | 3300013307 | Ga0157372_10040910 | Ga0157372_100409105 | 760 |
| 544 | 3300025912 | Ga0207707_10013471 | Ga0207707_100134714 | 760 |
| 545 | 3300025932 | Ga0207690_10033828 | Ga0207690_100338282 | 760 |
| 546 | 3300025949 | Ga0207667_10011114 | Ga0207667_100111145 | 760 |
| 547 | 3300026041 | Ga0207639_10006352 | Ga0207639_100063527 | 760 |
| 548 | 3300045051 | Ga0451576_0012158 | Ga0451576_0012158_6767_9106 | 760 |
| 549 | 3300049571 | Ga0501034_0010411 | Ga0501034_0010411_6645_9086 | 760 |
| 550 | 3300049573 | Ga0501037_0025396 | Ga0501037_0025396_1364_3805 | 760 |
| 551 | 3300049822 | Ga0501035_0064939 | Ga0501035_0064939_200_2641 | 760 |
| 552 | 3300049823 | Ga0501044_0080958 | Ga0501044_0080958_181_2622 | 760 |
| 553 | 3300005546 | Ga0070696_100001810 | Ga0070696_1000018104 | 761 |
| 554 | 3300046471 | Ga0495650_0000061 | Ga0495650_0000061_95901_98207 | 761 |
| 555 | 3300025928 | Ga0207700_10070096 | Ga0207700_100700962 | 762 |
| 556 | 3300046457 | Ga0495590_0000005 | Ga0495590_0000005_180252_182597 | 762 |
| 557 | 3300046460 | Ga0495638_0000105 | Ga0495638_0000105_11209_13518 | 762 |
| 558 | 3300046471 | Ga0495650_0002094 | Ga0495650_0002094_11189_13498 | 762 |
| 559 | 3300046475 | Ga0495639_0000560 | Ga0495639_0000560_12401_14710 | 762 |
| 560 | 3300046506 | Ga0495583_0000740 | Ga0495583_0000740_28007_30316 | 762 |
| 561 | 3300046524 | Ga0495648_0000008 | Ga0495648_0000008_243676_245985 | 762 |
| 562 | 3300046528 | Ga0495642_0000948 | Ga0495642_0000948_9132_11441 | 762 |
| 563 | 3300046538 | Ga0495609_0004469 | Ga0495609_0004469_4553_6862 | 762 |
| 564 | 3300046557 | Ga0495622_0000280 | Ga0495622_0000280_11324_13633 | 762 |
| 565 | 3300046558 | Ga0495633_0000238 | Ga0495633_0000238_11323_13632 | 762 |
| 566 | 3300046616 | Ga0495668_0000065 | Ga0495668_0000065_154217_156562 | 762 |
| 567 | 3300046660 | Ga0495625_0000954 | Ga0495625_0000954_24917_27226 | 762 |
| 568 | 3300046810 | Ga0495660_0003991 | Ga0495660_0003991_1638_3983 | 762 |
| 569 | 3300048913 | Ga0496110_0002400 | Ga0496110_0002400_2339_4675 | 762 |
| 570 | 3300048914 | Ga0496111_0002866 | Ga0496111_0002866_802_3138 | 762 |
| 571 | 3300049459 | Ga0495678_006025 | Ga0495678_006025_1083_3392 | 762 |
| 572 | 3300049459 | Ga0495678_012546 | Ga0495678_012546_1196_3541 | 762 |
| 573 | 3300049585 | Ga0501069_0010891 | Ga0501069_0010891_2214_4736 | 762 |
| 574 | 3300049586 | Ga0501070_0003957 | Ga0501070_0003957_5374_7689 | 762 |
| 575 | 3300049589 | Ga0501073_0005956 | Ga0501073_0005956_2635_4950 | 762 |
| 576 | 3300049744 | Ga0501083_0003320 | Ga0501083_0003320_6960_9275 | 762 |
| 577 | 3300009098 | Ga0105245_10073375 | Ga0105245_100733752 | 763 |
| 578 | 3300013104 | Ga0157370_10035733 | Ga0157370_100357333 | 763 |
| 579 | 3300003794 | Ga0055531_10000052 | Ga0055531_1000005270 | 764 |
| 580 | 3300005344 | Ga0070661_100000034 | Ga0070661_1000000342 | 764 |
| 581 | 3300009176 | Ga0105242_10047060 | Ga0105242_100470601 | 764 |
| 582 | 3300025298 | Ga0209050_1003113 | Ga0209050_10031132 | 764 |
| 583 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021656 | 764 |
| 584 | 3300025913 | Ga0207695_10065293 | Ga0207695_100652934 | 764 |
| 585 | 3300025920 | Ga0207649_10000045 | Ga0207649_100000452 | 764 |
| 586 | 3300048925 | Ga0496122_0002269 | Ga0496122_0002269_22974_25286 | 764 |
| 587 | 3300026095 | Ga0207676_10003457 | Ga0207676_100034572 | 765 |
| 588 | iso_pu_bacteria | 2643221644 | 2644243107 | 765 |
| 589 | iso_pu_bacteria | 2643221646 | 2644258000 | 765 |
| 590 | iso_pu_bacteria | 2739367664 | 2739652386 | 765 |
| 591 | iso_pu_bacteria | 2739367865 | 2740030860 | 765 |
| 592 | 3300005364 | Ga0070673_100002604 | Ga0070673_1000026046 | 766 |
| 593 | 3300025960 | Ga0207651_10001351 | Ga0207651_100013515 | 766 |
| 594 | 3300001979 | JGI24740J21852_10000067 | JGI24740J21852_1000006716 | 768 |
| 595 | 3300005327 | Ga0070658_10000088 | Ga0070658_1000008868 | 768 |
| 596 | 3300005563 | Ga0068855_100000173 | Ga0068855_10000017319 | 768 |
| 597 | 3300005577 | Ga0068857_100000037 | Ga0068857_10000003752 | 768 |
| 598 | 3300005578 | Ga0068854_100000155 | Ga0068854_10000015527 | 768 |
| 599 | 3300005614 | Ga0068856_100011636 | Ga0068856_1000116365 | 768 |
| 600 | 3300005616 | Ga0068852_100000060 | Ga0068852_10000006011 | 768 |
| 601 | 3300009093 | Ga0105240_10001752 | Ga0105240_1000175229 | 768 |
| 602 | 3300009545 | Ga0105237_10000378 | Ga0105237_1000037866 | 768 |
| 603 | 3300009551 | Ga0105238_10003191 | Ga0105238_100031918 | 768 |
| 604 | 3300010375 | Ga0105239_10000232 | Ga0105239_1000023265 | 768 |
| 605 | 3300013100 | Ga0157373_10004623 | Ga0157373_100046237 | 768 |
| 606 | 3300013104 | Ga0157370_10001010 | Ga0157370_100010108 | 768 |
| 607 | 3300013307 | Ga0157372_10003085 | Ga0157372_1000308512 | 768 |
| 608 | 3300025909 | Ga0207705_10000138 | Ga0207705_1000013819 | 768 |
| 609 | 3300025913 | Ga0207695_10008932 | Ga0207695_100089327 | 768 |
| 610 | 3300025914 | Ga0207671_10000222 | Ga0207671_1000022220 | 768 |
| 611 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001666 | 768 |
| 612 | 3300025981 | Ga0207640_10000041 | Ga0207640_1000004184 | 768 |
| 613 | 3300026041 | Ga0207639_10000081 | Ga0207639_1000008166 | 768 |
| 614 | 3300026078 | Ga0207702_10008745 | Ga0207702_100087455 | 768 |
| 615 | 3300026116 | Ga0207674_10001824 | Ga0207674_100018247 | 768 |
| 616 | 3300026142 | Ga0207698_10000054 | Ga0207698_1000005465 | 768 |
| 617 | 3300053148 | Ga0500590_000002 | Ga0500590_000002_69957_72311 | 768 |
| 618 | 3300001904 | JGI24736J21556_1000979 | JGI24736J21556_10009793 | 769 |
| 619 | 3300001979 | JGI24740J21852_10000027 | JGI24740J21852_1000002728 | 769 |
| 620 | 3300002067 | JGI24735J21928_10000290 | JGI24735J21928_100002906 | 769 |
| 621 | 3300005289 | Ga0065704_10080853 | Ga0065704_100808533 | 769 |
| 622 | 3300005327 | Ga0070658_10051938 | Ga0070658_100519383 | 769 |
| 623 | 3300005563 | Ga0068855_100007890 | Ga0068855_10000789017 | 769 |
| 624 | 3300005563 | Ga0068855_100016025 | Ga0068855_1000160255 | 769 |
| 625 | 3300005577 | Ga0068857_100039091 | Ga0068857_1000390912 | 769 |
| 626 | 3300005616 | Ga0068852_100011081 | Ga0068852_1000110813 | 769 |
| 627 | 3300009011 | Ga0105251_10000071 | Ga0105251_1000007117 | 769 |
| 628 | 3300009551 | Ga0105238_10011466 | Ga0105238_100114666 | 769 |
| 629 | 3300009551 | Ga0105238_10052291 | Ga0105238_100522913 | 769 |
| 630 | 3300013104 | Ga0157370_10007614 | Ga0157370_100076147 | 769 |
| 631 | 3300013104 | Ga0157370_10028669 | Ga0157370_100286696 | 769 |
| 632 | 3300013105 | Ga0157369_10058846 | Ga0157369_100588463 | 769 |
| 633 | 3300025735 | Ga0207713_1001241 | Ga0207713_100124120 | 769 |
| 634 | 3300025904 | Ga0207647_10000037 | Ga0207647_1000003757 | 769 |
| 635 | 3300025909 | Ga0207705_10002495 | Ga0207705_1000249519 | 769 |
| 636 | 3300025913 | Ga0207695_10093082 | Ga0207695_100930822 | 769 |
| 637 | 3300025924 | Ga0207694_10016693 | Ga0207694_100166932 | 769 |
| 638 | 3300025949 | Ga0207667_10004327 | Ga0207667_1000432716 | 769 |
| 639 | 3300026041 | Ga0207639_10033829 | Ga0207639_100338292 | 769 |
| 640 | 3300026142 | Ga0207698_10020871 | Ga0207698_100208713 | 769 |
| 641 | 3300048903 | Ga0496100_0000293 | Ga0496100_0000293_5967_8294 | 769 |
| 642 | 3300048909 | Ga0496106_0000047 | Ga0496106_0000047_62743_65070 | 769 |
| 643 | 3300048910 | Ga0496107_0000232 | Ga0496107_0000232_4514_6841 | 769 |
| 644 | 3300048919 | Ga0496116_0000193 | Ga0496116_0000193_22316_24643 | 769 |
| 645 | 3300048920 | Ga0496117_0001656 | Ga0496117_0001656_22230_24557 | 769 |
| 646 | 3300048921 | Ga0496118_0000156 | Ga0496118_0000156_22658_24985 | 769 |
| 647 | 3300048928 | Ga0496125_0004416 | Ga0496125_0004416_11487_13814 | 769 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF22085
NorB_cytochrome_c-like
Nitric oxide reductase subunit B, cytochrome c-like domain
93
267
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qq6-assembly1.cif.gz_B | cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) val495ala mutant from alcaligenes xylosoxidans | 0.9301 | 14 | 750 |
| 3ayf-assembly1.cif.gz_A | crystal structure of nitric oxide reductase | 0.9264 | 15 | 751 |
| 6qq6-assembly1.cif.gz_B | cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) val495ala mutant from alcaligenes xylosoxidans | 0.9215 | 14 | 750 |
| 8bgw-assembly1.cif.gz_B | cryoem structure of quinol-dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans at 2.2 a resolution | 0.9111 | 18 | 757 |
| 6qq5-assembly1.cif.gz_B | cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) from alcaligenes xylosoxidans | 0.9055 | 18 | 750 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aygA01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9186 | 234 | 751 | 1.20.210.10 |
| 3aygA01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8438 | 234 | 751 | 1.20.210.10 |
| 4xydA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8414 | 285 | 755 | 1.20.210.10 |
| 4xydA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8218 | 285 | 755 | 1.20.210.10 |
| 5djqA00 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.7156 | 274 | 760 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328ZV12-F1-model_v4 | deleted | 0.9904 | 622 | 758 |
|
| AF-A0A539E8K1-F1-model_v4 | Nitric oxide reductase subunit B | 0.987 | 640 | 753 |
GO:0016020
|
| AF-A0A522JJ32-F1-model_v4 | Nitric-oxide reductase large subunit | 0.9852 | 15 | 173 |
GO:0016020
|
| AF-A0A2E5Y8S1-F1-model_v4 | Nitric-oxide reductase large subunit | 0.9833 | 29 | 757 |
GO:0004129
GO:0009060 GO:0016020 GO:0020037 |
| AF-A0A7R7TWK5-F1-model_v4 | Nitric oxide reductase | 0.9809 | 597 | 754 |
GO:0004129
GO:0009060 GO:0016020 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar