F472525

General Info

Members Datasets Scaffolds Average Seq Length
650 370 1298 259

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10000076|Ga0207709_10000076132
Length 300
Sequence MAAILDENNSQMKHPRVSGPEAWLGIVGRVFFPTSPGDSDTMSYENIDVRTEAGKVGIITLNRPKALNALNDALMTELGQALKAFDADDAIGCIILTGSERAFAAGADIAAMAKYSFIDTYKGDYITRNWETIRSIRKPVIAAVSGFALGGGCELAMMCDFIIAADNAKFGQPEIKIGVIPGAGGTQRLPRAVGKSKAMDMALTARMMDAAEAERAGLVSRVVPFEKLADEALGAALIIAGFSQIAVMAAKESVNRAFESGLSDGVMFERRLFHALFATQDQKEGMDAFLAKRQPDFKNA

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
173 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
174 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
175 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
176 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
214 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
219 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
220 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
221 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
222 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
227 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
228 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
292 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
304 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
313 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
314 2547132374 Acidovorax radicis N35 Isolate Unclassified
315 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
316 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
317 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
318 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
319 2643221570 Acidovorax sp. Root568 Isolate Unclassified
320 2643221596 Acidovorax sp. Root70 Isolate Unclassified
321 2643221609 Acidovorax sp. Root217 Isolate Unclassified
322 2643221611 Acidovorax sp. Root219 Isolate Unclassified
323 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
324 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
325 2643221652 Acidovorax sp. Root402 Isolate Unclassified
326 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
327 2643221672 Variovorax sp. Root434 Isolate Unclassified
328 2643221683 Variovorax sp. Root473 Isolate Unclassified
329 2643221717 Acidovorax sp. Root267 Isolate Unclassified
330 2721755523 Delftia sp. HK171 Isolate Unclassified
331 2738541277 Variovorax sp. GV051 Isolate Unclassified
332 2738541307 Variovorax sp. GV008 Isolate Unclassified
333 2738543012 Acidovorax sp. CF301 Isolate Unclassified
334 2738543013 Variovorax sp. BT01 Isolate Unclassified
335 2738543019 Variovorax sp. GV040 Isolate Unclassified
336 2816332133 Acidovorax radicis 2721A Isolate Unclassified
337 2818991446 Variovorax sp. 1180 Isolate Unclassified
338 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
339 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
340 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
341 2842677519 Variovorax sp. R-72495 Isolate Unclassified
342 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
343 2842733646 Variovorax sp. R-72446 Isolate Unclassified
344 2842747753 Variovorax sp. R-72060 Isolate Unclassified
345 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
346 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
347 2885198086 Variovorax sp. 679 Isolate Unclassified
348 2885211737 Variovorax sp. 553 Isolate Unclassified
349 2899924645 Variovorax sp. 369 Isolate Unclassified
350 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
351 2904456579 Variovorax sp. 2002 Isolate Unclassified
352 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
353 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
354 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
355 2928037797 Variovorax sp. 1126 Isolate Unclassified
356 2928044640 Variovorax sp. 1128 Isolate Unclassified
357 2928051484 Variovorax sp. 1133 Isolate Unclassified
358 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
359 2928070936 Variovorax gossypii 1167 Isolate Unclassified
360 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
361 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
362 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
363 2929520902 Variovorax beijingensis 502 Isolate Unclassified
364 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
365 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
366 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
367 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
368 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
369 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
370 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.31
Metatranscriptomes 0.46
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.85
Nodule 1.38
Rhizoplane 2.15
Rhizosphere 55.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10000076 3300025935 Bacteria 173292
2 JGI24739J22299_10052958 3300001989 Bacteria 1304
3 JGI25155J39150_1000029 3300002704 Bacteria 118964
4 JGI25156J39149_1000272 3300002705 Bacteria 35071
5 JGI25154J39366_1000053 3300002738 Bacteria 119466
6 JGI25157J39369_1000046 3300002741 Bacteria 119470
7 JGI25150J39212_1004866 3300002774 Bacteria 2928
8 JGI25150J39212_1011896 3300002774 Bacteria 1560
9 JGI25150J39212_1015851 3300002774 Bacteria 1247
10 JGI25159J45721_1005232 3300002987 Bacteria 4107
11 JGI25159J45721_1014942 3300002987 Bacteria 1723
12 JGI25151J46595_10001446 3300003187 Bacteria 16098
13 JGI25151J46595_10003511 3300003187 Bacteria 8633
14 JGI25151J46595_10008613 3300003187 Bacteria 4889
15 JGI25151J46595_10011783 3300003187 Bacteria 4006
16 JGI25153J46596_10002887 3300003215 Bacteria 9753
17 JGI25153J46596_10026617 3300003215 Bacteria 2043
18 JGI25160J50197_1008376 3300003354 Bacteria 3946
19 JGI25160J50197_1010335 3300003354 Bacteria 3382
20 JGI25160J50197_1030576 3300003354 Bacteria 1400
21 JGI25161J50226_1000046 3300003374 Bacteria 116165
22 JGI25161J50226_1004960 3300003374 Bacteria 2692
23 Ga0006562J51391_1044074 3300003578 Bacteria 1655
24 Ga0006562J51391_1045467 3300003578 Bacteria 6752
25 Ga0006562J51391_1045469 3300003578 Bacteria 3632
26 Ga0055535_1000289 3300003761 Bacteria 53058
27 Ga0055542_1000036 3300003762 Bacteria 227346
28 Ga0055526_1004155 3300003771 Bacteria 8815
29 Ga0055526_1005732 3300003771 Bacteria 7017
30 Ga0055537_1000623 3300003773 Bacteria 19351
31 Ga0055524_1000044 3300003775 Bacteria 151631
32 Ga0055524_1000469 3300003775 Bacteria 32369
33 Ga0055524_1022088 3300003775 Bacteria 2088
34 Ga0055536_1014715 3300003781 Bacteria 2723
35 Ga0055534_1000397 3300003784 Bacteria 26870
36 Ga0055528_1008275 3300003790 Bacteria 4486
37 Ga0055530_10000630 3300003791 Bacteria 30400
38 Ga0055530_10003088 3300003791 Bacteria 9896
39 Ga0055540_1000063 3300003792 Bacteria 127901
40 Ga0055540_1000173 3300003792 Bacteria 63434
41 Ga0055540_1007713 3300003792 Bacteria 4007
42 Ga0055531_10000276 3300003794 Bacteria 52882
43 Ga0055531_10014054 3300003794 Bacteria 3637
44 Ga0055543_1001803 3300004625 Bacteria 7904
45 Ga0055543_1002615 3300004625 Bacteria 5812
46 Ga0065165_1056801 3300005262 Bacteria 1086
47 Ga0065704_10196713 3300005289 Bacteria 1164
48 Ga0065704_10220127 3300005289 Bacteria 1077
49 Ga0065707_10152043 3300005295 Bacteria 1648
50 Ga0070658_10079968 3300005327 Bacteria 2684
51 Ga0070658_10180959 3300005327 Bacteria 1774
52 Ga0070658_10209465 3300005327 Bacteria 1647
53 Ga0070670_100091617 3300005331 Bacteria 2613
54 Ga0068868_100565144 3300005338 Bacteria 1004
55 Ga0070661_100001470 3300005344 Bacteria 16360
56 Ga0070668_100249499 3300005347 Bacteria 1473
57 Ga0070668_100463328 3300005347 Bacteria 1092
58 Ga0070669_100081971 3300005353 Bacteria 2404
59 Ga0070669_100148324 3300005353 Bacteria 1814
60 Ga0070669_100164412 3300005353 Bacteria 1727
61 Ga0070675_100024440 3300005354 Bacteria 4838
62 Ga0070671_100025509 3300005355 Bacteria 4851
63 Ga0070671_100047940 3300005355 Bacteria 3552
64 Ga0070673_100020985 3300005364 Bacteria 4723
65 Ga0070659_100001712 3300005366 Bacteria 15775
66 Ga0070659_100089034 3300005366 Bacteria 2472
67 Ga0070667_100015275 3300005367 Bacteria 6346
68 Ga0070708_100111340 3300005445 Bacteria 2517
69 Ga0070663_100091088 3300005455 Bacteria 2259
70 Ga0070678_100228320 3300005456 Bacteria 1551
71 Ga0070662_100040739 3300005457 Bacteria 3309
72 Ga0068867_100069959 3300005459 Bacteria 2622
73 Ga0068867_100149273 3300005459 Bacteria 1835
74 Ga0070685_10407842 3300005466 Bacteria 943
75 Ga0070706_100003421 3300005467 Bacteria 15654
76 Ga0068853_100012883 3300005539 Bacteria 6814
77 Ga0068853_100224713 3300005539 Bacteria 1716
78 Ga0070672_100039085 3300005543 Bacteria 3632
79 Ga0070672_100165814 3300005543 Bacteria 1835
80 Ga0070665_100085161 3300005548 Bacteria 3166
81 Ga0070665_100105115 3300005548 Bacteria 2825
82 Ga0070665_100345199 3300005548 Bacteria 1494
83 Ga0070665_100506427 3300005548 Bacteria 1219
84 Ga0068855_100022176 3300005563 Bacteria 7609
85 Ga0068855_100089597 3300005563 Bacteria 3552
86 Ga0068855_100116141 3300005563 Bacteria 3067
87 Ga0070664_100002031 3300005564 Bacteria 16231
88 Ga0070664_100013022 3300005564 Bacteria 6767
89 Ga0070664_100693134 3300005564 Bacteria 949
90 Ga0068857_100064053 3300005577 Bacteria 3269
91 Ga0068857_100354154 3300005577 Bacteria 1360
92 Ga0068854_100124322 3300005578 Bacteria 1963
93 Ga0068852_100056642 3300005616 Bacteria 3389
94 Ga0068852_100242356 3300005616 Bacteria 1724
95 Ga0068859_100044987 3300005617 Bacteria 4435
96 Ga0068864_100032354 3300005618 Bacteria 4444
97 Ga0068864_100104975 3300005618 Bacteria 2511
98 Ga0068851_10014047 3300005834 Bacteria 3797
99 Ga0068863_100034397 3300005841 Bacteria 4827
100 Ga0068863_100414650 3300005841 Bacteria 1319
101 Ga0068863_100541600 3300005841 Bacteria 1149
102 Ga0068860_100080422 3300005843 Bacteria 3099
103 Ga0068860_100258559 3300005843 Bacteria 1697
104 Ga0068862_100199483 3300005844 Bacteria 1804
105 Ga0081455_10153923 3300005937 Bacteria 1770
106 Ga0075365_10003479 3300006038 Bacteria 8122
107 Ga0075365_10076520 3300006038 Bacteria 2259
108 Ga0075365_10132489 3300006038 Bacteria 1726
109 Ga0075365_10138900 3300006038 Bacteria 1686
110 Ga0075368_10054797 3300006042 Bacteria 1589
111 Ga0075363_100082242 3300006048 Bacteria 1762
112 Ga0075364_10091292 3300006051 Bacteria 2021
113 Ga0075432_10033726 3300006058 Bacteria 1776
114 Ga0075362_10003327 3300006177 Bacteria 5602
115 Ga0075362_10015585 3300006177 Bacteria 3094
116 Ga0075362_10017376 3300006177 Bacteria 2963
117 Ga0075362_10024283 3300006177 Bacteria 2570
118 Ga0075362_10099598 3300006177 Bacteria 1357
119 Ga0075367_10028530 3300006178 Bacteria 3185
120 Ga0075367_10045067 3300006178 Bacteria 2587
121 Ga0075367_10083729 3300006178 Bacteria 1933
122 Ga0075366_10001341 3300006195 Bacteria 12307
123 Ga0075366_10007913 3300006195 Bacteria 5880
124 Ga0075366_10022118 3300006195 Bacteria 3698
125 Ga0075366_10053794 3300006195 Bacteria 2392
126 Ga0075366_10061318 3300006195 Bacteria 2235
127 Ga0075366_10065134 3300006195 Bacteria 2167
128 Ga0075366_10102128 3300006195 Bacteria 1721
129 Ga0075366_10105054 3300006195 Bacteria 1697
130 Ga0075366_10131971 3300006195 Bacteria 1507
131 Ga0097621_100111445 3300006237 Bacteria 2312
132 Ga0075370_10001058 3300006353 Bacteria 11460
133 Ga0075370_10009223 3300006353 Bacteria 5112
134 Ga0075370_10033362 3300006353 Bacteria 2882
135 Ga0075370_10161389 3300006353 Bacteria 1315
136 Ga0068871_100151985 3300006358 Bacteria 1975
137 Ga0097620_100044987 3300006931 Bacteria 4435
138 Ga0079104_1000037 3300006946 Bacteria 189207
139 Ga0079104_1000294 3300006946 Bacteria 63150
140 Ga0079104_1008514 3300006946 Bacteria 3581
141 Ga0079104_1026331 3300006946 Bacteria 1504
142 Ga0105240_10001543 3300009093 Bacteria 39121
143 Ga0105240_10002814 3300009093 Bacteria 27490
144 Ga0105240_10351882 3300009093 Bacteria 1671
145 Ga0105245_10182584 3300009098 Bacteria 2005
146 Ga0105245_10418446 3300009098 Bacteria 1343
147 Ga0105247_10124116 3300009101 Bacteria 1676
148 Ga0105243_10015400 3300009148 Bacteria 5782
149 Ga0105243_10054766 3300009148 Bacteria 3167
150 Ga0105243_10122609 3300009148 Bacteria 2194
151 Ga0105241_10381380 3300009174 Bacteria 1232
152 Ga0105237_10002372 3300009545 Bacteria 23375
153 Ga0105237_10014572 3300009545 Bacteria 8216
154 Ga0105237_10053518 3300009545 Bacteria 4048
155 Ga0105238_10027529 3300009551 Bacteria 5794
156 Ga0105238_10508411 3300009551 Bacteria 1206
157 Ga0105238_10596867 3300009551 Bacteria 1112
158 Ga0105239_10001168 3300010375 Bacteria 36102
159 Ga0105239_10016215 3300010375 Bacteria 8242
160 Ga0157347_1005573 3300012502 Bacteria 1208
161 Ga0157347_1009747 3300012502 Bacteria 999
162 Ga0157373_10003982 3300013100 Bacteria 11140
163 Ga0157371_10108489 3300013102 Bacteria 1970
164 Ga0157370_10007530 3300013104 Bacteria 11828
165 Ga0157370_10374199 3300013104 Bacteria 1312
166 Ga0157369_10050951 3300013105 Bacteria 4482
167 Ga0157378_10271907 3300013297 Bacteria 1630
168 Ga0163162_10021978 3300013306 Bacteria 6286
169 Ga0157372_10804912 3300013307 Bacteria 1092
170 Ga0157375_10192299 3300013308 Bacteria 2196
171 Ga0157375_10295556 3300013308 Bacteria 1783
172 Ga0182008_10000191 3300014497 Bacteria 48580
173 Ga0182008_10003941 3300014497 Bacteria 8786
174 Ga0182008_10005474 3300014497 Bacteria 7230
175 Ga0182008_10006656 3300014497 Bacteria 6434
176 Ga0182008_10026178 3300014497 Bacteria 2959
177 Ga0157376_10175324 3300014969 Bacteria 1955
178 Ga0157376_10708669 3300014969 Bacteria 1012
179 Ga0182006_1001724 3300015261 Bacteria 12705
180 Ga0182006_1058840 3300015261 Bacteria 1456
181 Ga0182007_10002842 3300015262 Bacteria 8423
182 Ga0182005_1025809 3300015265 Bacteria 1604
183 Ga0183362_10005 3300015683 Bacteria 437616
184 Ga0163161_10000244 3300017792 Bacteria 49165
185 Ga0163161_10128426 3300017792 Bacteria 1910
186 Ga0163161_10131556 3300017792 Bacteria 1888
187 Ga0163161_10181282 3300017792 Bacteria 1615
188 Ga0209435_100003 3300025206 Bacteria 669534
189 Ga0209436_106712 3300025208 Bacteria 2488
190 Ga0209672_101200 3300025228 Bacteria 10518
191 Ga0209147_100961 3300025229 Bacteria 12646
192 Ga0209258_100091 3300025242 Bacteria 227454
193 Ga0207425_1000183 3300025245 Bacteria 51638
194 Ga0207425_1000933 3300025245 Bacteria 13901
195 Ga0207425_1009626 3300025245 Bacteria 2394
196 Ga0207425_1033787 3300025245 Bacteria 1006
197 Ga0209646_1000008 3300025246 Bacteria 669534
198 Ga0209026_1000007 3300025250 Bacteria 669534
199 Ga0209148_1000033 3300025254 Bacteria 555508
200 Ga0209759_1000026 3300025256 Bacteria 311743
201 Ga0209129_1000091 3300025258 Bacteria 175716
202 Ga0209129_1004863 3300025258 Bacteria 5026
203 Ga0209565_1000020 3300025263 Bacteria 432627
204 Ga0209565_1000200 3300025263 Bacteria 71490
205 Ga0209565_1000270 3300025263 Bacteria 52764
206 Ga0209565_1000507 3300025263 Bacteria 28238
207 Ga0209565_1001022 3300025263 Bacteria 14301
208 Ga0209565_1027612 3300025263 Bacteria 1128
209 Ga0209565_1028856 3300025263 Bacteria 1093
210 Ga0209673_1000009 3300025273 Bacteria 620735
211 Ga0209673_1000012 3300025273 Bacteria 579480
212 Ga0209673_1000072 3300025273 Bacteria 236935
213 Ga0209673_1000154 3300025273 Bacteria 146394
214 Ga0209673_1000772 3300025273 Bacteria 43167
215 Ga0209673_1007609 3300025273 Bacteria 4951
216 Ga0209130_1000064 3300025284 Bacteria 196568
217 Ga0209130_1000140 3300025284 Bacteria 115434
218 Ga0209130_1000203 3300025284 Bacteria 80023
219 Ga0209130_1000225 3300025284 Bacteria 74120
220 Ga0209675_1000014 3300025291 Bacteria 421902
221 Ga0209675_1000144 3300025291 Bacteria 94908
222 Ga0209675_1000447 3300025291 Bacteria 32004
223 Ga0209675_1001399 3300025291 Bacteria 14004
224 Ga0209676_1000051 3300025292 Bacteria 389016
225 Ga0209676_1000088 3300025292 Bacteria 263010
226 Ga0209676_1000267 3300025292 Bacteria 109237
227 Ga0209676_1000966 3300025292 Bacteria 34669
228 Ga0209676_1002156 3300025292 Bacteria 14892
229 Ga0209676_1009167 3300025292 Bacteria 4305
230 Ga0209025_1000207 3300025294 Bacteria 140774
231 Ga0209025_1000356 3300025294 Bacteria 98547
232 Ga0209025_1001327 3300025294 Bacteria 33484
233 Ga0209025_1001509 3300025294 Bacteria 29944
234 Ga0209025_1007756 3300025294 Bacteria 7907
235 Ga0209025_1008400 3300025294 Bacteria 7443
236 Ga0209025_1013276 3300025294 Bacteria 5193
237 Ga0209564_1000103 3300025295 Bacteria 221166
238 Ga0209564_1000530 3300025295 Bacteria 62121
239 Ga0209564_1000797 3300025295 Bacteria 43362
240 Ga0209564_1000945 3300025295 Bacteria 37432
241 Ga0209564_1001673 3300025295 Bacteria 21213
242 Ga0209758_1000092 3300025297 Bacteria 241910
243 Ga0209758_1000327 3300025297 Bacteria 89663
244 Ga0209758_1010345 3300025297 Bacteria 5599
245 Ga0209758_1010394 3300025297 Bacteria 5577
246 Ga0209758_1015192 3300025297 Bacteria 4013
247 Ga0209050_1000044 3300025298 Bacteria 391114
248 Ga0209050_1000110 3300025298 Bacteria 216664
249 Ga0209050_1000916 3300025298 Bacteria 38869
250 Ga0209050_1000983 3300025298 Bacteria 36304
251 Ga0209050_1005037 3300025298 Bacteria 8559
252 Ga0209256_1000003 3300025299 Bacteria 1661127
253 Ga0209256_1000036 3300025299 Bacteria 386664
254 Ga0209256_1000065 3300025299 Bacteria 248104
255 Ga0209256_1000094 3300025299 Bacteria 208177
256 Ga0207426_1000084 3300025302 Bacteria 298123
257 Ga0207426_1000116 3300025302 Bacteria 225245
258 Ga0207426_1000124 3300025302 Bacteria 218145
259 Ga0207426_1001529 3300025302 Bacteria 18859
260 Ga0209051_1000031 3300025303 Bacteria 391114
261 Ga0209051_1000069 3300025303 Bacteria 219208
262 Ga0209051_1000114 3300025303 Bacteria 152303
263 Ga0209051_1000230 3300025303 Bacteria 94027
264 Ga0209051_1000379 3300025303 Bacteria 63486
265 Ga0209051_1000685 3300025303 Bacteria 37585
266 Ga0209051_1001139 3300025303 Bacteria 24282
267 Ga0209051_1001228 3300025303 Bacteria 23035
268 Ga0209051_1002160 3300025303 Bacteria 14589
269 Ga0209257_1000015 3300025304 Bacteria 908141
270 Ga0209257_1000058 3300025304 Bacteria 381686
271 Ga0209257_1000093 3300025304 Bacteria 263088
272 Ga0209257_1000141 3300025304 Bacteria 201130
273 Ga0209257_1000575 3300025304 Bacteria 61759
274 Ga0207656_10007635 3300025321 Bacteria 3948
275 Ga0207655_1001961 3300025728 Bacteria 17580
276 Ga0207642_10169774 3300025899 Bacteria 1179
277 Ga0207710_10101190 3300025900 Bacteria 1359
278 Ga0207680_10353356 3300025903 Bacteria 1033
279 Ga0207645_10162906 3300025907 Bacteria 1459
280 Ga0207645_10265362 3300025907 Bacteria 1138
281 Ga0207705_10352441 3300025909 Bacteria 1134
282 Ga0207705_10400712 3300025909 Bacteria 1061
283 Ga0207684_10053942 3300025910 Bacteria 3411
284 Ga0207654_10291750 3300025911 Bacteria 1106
285 Ga0207695_10005159 3300025913 Bacteria 17488
286 Ga0207695_10068733 3300025913 Bacteria 3629
287 Ga0207695_10163527 3300025913 Bacteria 2155
288 Ga0207695_10256385 3300025913 Bacteria 1648
289 Ga0207671_10013375 3300025914 Bacteria 6538
290 Ga0207671_10044087 3300025914 Bacteria 3298
291 Ga0207671_10252773 3300025914 Bacteria 1386
292 Ga0207657_10031330 3300025919 Bacteria 4818
293 Ga0207657_10186173 3300025919 Bacteria 1677
294 Ga0207649_10010410 3300025920 Bacteria 5110
295 Ga0207649_10136167 3300025920 Bacteria 1675
296 Ga0207652_10382497 3300025921 Bacteria 1270
297 Ga0207681_10002439 3300025923 Bacteria 11796
298 Ga0207681_10170720 3300025923 Bacteria 1648
299 Ga0207681_10176916 3300025923 Bacteria 1622
300 Ga0207694_10042635 3300025924 Bacteria 3500
301 Ga0207650_10160955 3300025925 Bacteria 1778
302 Ga0207687_10120309 3300025927 Bacteria 1963
303 Ga0207644_10038729 3300025931 Bacteria 3361
304 Ga0207644_10186148 3300025931 Bacteria 1630
305 Ga0207690_10002101 3300025932 Bacteria 12197
306 Ga0207690_10022892 3300025932 Bacteria 3892
307 Ga0207706_10042818 3300025933 Bacteria 4012
308 Ga0207686_10011859 3300025934 Bacteria 4782
309 Ga0207709_10000472 3300025935 Bacteria 36896
310 Ga0207709_10002379 3300025935 Bacteria 11866
311 Ga0207709_10042383 3300025935 Bacteria 2737
312 Ga0207691_10015393 3300025940 Bacteria 7277
313 Ga0207691_10223290 3300025940 Bacteria 1633
314 Ga0207689_10137037 3300025942 Bacteria 2015
315 Ga0207689_10347778 3300025942 Bacteria 1232
316 Ga0207689_10391223 3300025942 Bacteria 1158
317 Ga0207679_10000088 3300025945 Bacteria 79836
318 Ga0207679_10027321 3300025945 Bacteria 3945
319 Ga0207667_10039365 3300025949 Bacteria 5039
320 Ga0207667_10117417 3300025949 Bacteria 2742
321 Ga0207651_10013397 3300025960 Bacteria 4692
322 Ga0207651_10266560 3300025960 Bacteria 1409
323 Ga0207651_10298052 3300025960 Bacteria 1340
324 Ga0207668_10058976 3300025972 Bacteria 2686
325 Ga0207640_10320841 3300025981 Bacteria 1233
326 Ga0207677_10010744 3300026023 Bacteria 5190
327 Ga0207677_10014817 3300026023 Bacteria 4566
328 Ga0207677_10383172 3300026023 Bacteria 1187
329 Ga0207639_10019378 3300026041 Bacteria 4851
330 Ga0207639_10139927 3300026041 Bacteria 2015
331 Ga0207678_10026992 3300026067 Bacteria 5008
332 Ga0207641_10008372 3300026088 Bacteria 8547
333 Ga0207641_10523579 3300026088 Bacteria 1154
334 Ga0207648_10013164 3300026089 Bacteria 7711
335 Ga0207648_10065424 3300026089 Bacteria 3170
336 Ga0207648_10502337 3300026089 Bacteria 1110
337 Ga0207676_10033357 3300026095 Bacteria 3889
338 Ga0207676_10132659 3300026095 Bacteria 2120
339 Ga0207676_10324649 3300026095 Bacteria 1414
340 Ga0207674_10016085 3300026116 Bacteria 8194
341 Ga0207674_10034413 3300026116 Bacteria 5296
342 Ga0207674_10362917 3300026116 Bacteria 1400
343 Ga0207674_10402966 3300026116 Bacteria 1322
344 Ga0207674_10434698 3300026116 Bacteria 1268
345 Ga0207675_100032073 3300026118 Bacteria 4893
346 Ga0207675_100384680 3300026118 Bacteria 1380
347 Ga0207683_10031829 3300026121 Bacteria 4580
348 Ga0207683_10276400 3300026121 Bacteria 1535
349 Ga0207698_10044076 3300026142 Bacteria 3348
350 Ga0209281_1000002 3300027111 Bacteria 1924012
351 Ga0209281_1000423 3300027111 Bacteria 63126
352 Ga0209281_1019020 3300027111 Bacteria 1362
353 Ga0209970_1000026 3300027614 Bacteria 19518
354 Ga0209282_1000298 3300027666 Bacteria 24501
355 Ga0209971_1000744 3300027682 Bacteria 8388
356 Ga0209974_10005128 3300027876 Bacteria 4627
357 Ga0209974_10010577 3300027876 Bacteria 3113
358 Ga0209974_10016653 3300027876 Bacteria 2440
359 Ga0268266_10006260 3300028379 Bacteria 10924
360 Ga0268266_10026800 3300028379 Bacteria 4904
361 Ga0268266_10345295 3300028379 Bacteria 1398
362 Ga0268265_10174867 3300028380 Bacteria 1839
363 Ga0268265_10352528 3300028380 Bacteria 1344
364 Ga0268264_10051817 3300028381 Bacteria 3421
365 Ga0307517_10139084 3300028786 Bacteria 1713
366 Ga0307515_10000419 3300028794 Bacteria 102271
367 Ga0307515_10003462 3300028794 Bacteria 33182
368 Ga0307515_10007779 3300028794 Bacteria 21087
369 Ga0307515_10048555 3300028794 Bacteria 6414
370 Ga0307515_10149053 3300028794 Bacteria 2457
371 Ga0307515_10160465 3300028794 Bacteria 2296
372 Ga0307515_10196436 3300028794 Bacteria 1908
373 Ga0307512_10061877 3300030522 Bacteria 2878
374 Ga0316176_1093739 3300030732 Bacteria 1374
375 Ga0314311_1200241 3300030733 Bacteria 1827
376 Ga0316179_1078761 3300030734 Bacteria 1798
377 Ga0316183_1110470 3300030742 Bacteria 3052
378 Ga0265330_10000044 3300031235 Bacteria 113679
379 Ga0265330_10037185 3300031235 Bacteria 2168
380 Ga0265332_10000046 3300031238 Bacteria 113777
381 Ga0265332_10003009 3300031238 Bacteria 8269
382 Ga0265325_10013967 3300031241 Bacteria 4554
383 Ga0265340_10006278 3300031247 Bacteria 6550
384 Ga0265327_10000945 3300031251 Bacteria 42267
385 Ga0265327_10005555 3300031251 Bacteria 10470
386 Ga0265316_10056195 3300031344 Bacteria 3076
387 Ga0307513_10000008 3300031456 Bacteria 442128
388 Ga0307513_10000316 3300031456 Bacteria 69426
389 Ga0307513_10029422 3300031456 Bacteria 6263
390 Ga0307513_10189360 3300031456 Bacteria 1911
391 Ga0307513_10350444 3300031456 Bacteria 1224
392 Ga0307513_10440379 3300031456 Bacteria 1029
393 Ga0307509_10000904 3300031507 Bacteria 50711
394 Ga0307509_10011898 3300031507 Bacteria 10462
395 Ga0307509_10154799 3300031507 Bacteria 2200
396 Ga0307509_10249323 3300031507 Bacteria 1561
397 Ga0307408_100000229 3300031548 Bacteria 59103
398 Ga0307408_100052417 3300031548 Bacteria 2942
399 Ga0307408_100066336 3300031548 Bacteria 2650
400 Ga0307408_100196146 3300031548 Bacteria 1630
401 Ga0307408_100257436 3300031548 Bacteria 1442
402 Ga0307408_100327357 3300031548 Bacteria 1293
403 Ga0307408_100547679 3300031548 Bacteria 1020
404 Ga0307514_10001645 3300031649 Bacteria 26056
405 Ga0307514_10005374 3300031649 Bacteria 11477
406 Ga0307514_10017019 3300031649 Bacteria 5984
407 Ga0265314_10000130 3300031711 Bacteria 113776
408 Ga0265314_10008127 3300031711 Bacteria 9029
409 Ga0265342_10027415 3300031712 Bacteria 3561
410 Ga0307516_10005347 3300031730 Bacteria 15436
411 Ga0307516_10036692 3300031730 Bacteria 4905
412 Ga0307516_10412981 3300031730 Bacteria 1008
413 Ga0307405_10071808 3300031731 Bacteria 2228
414 Ga0307405_10332780 3300031731 Bacteria 1164
415 Ga0307413_10056778 3300031824 Bacteria 2390
416 Ga0307406_10000319 3300031901 Bacteria 28062
417 Ga0307406_10459303 3300031901 Bacteria 1023
418 Ga0307412_10247479 3300031911 Bacteria 1382
419 Ga0307416_100035902 3300032002 Bacteria 3793
420 Ga0307411_10088171 3300032005 Bacteria 2157
421 Ga0307510_10000122 3300033180 Bacteria 62024
422 Ga0307510_10288971 3300033180 Bacteria 1106
423 Ga0373939_0048742 3300035114 Bacteria 1307
424 Ga0373931_0114117 3300035691 Bacteria 1536
425 Ga0373933_0433548 3300035724 Bacteria 859
426 Ga0373925_0013137 3300037068 Bacteria 5993
427 Ga0395899_0010475 3300037312 Bacteria 7100
428 Ga0395900_0038355 3300037418 Bacteria 4937
429 Ga0395900_0043581 3300037418 Bacteria 4624
430 Ga0395898_0026798 3300037466 Bacteria 5793
431 Ga0395898_0051820 3300037466 Bacteria 4011
432 Ga0395898_0091650 3300037466 Bacteria 2924
433 Ga0395898_0834481 3300037466 Bacteria 861
434 Ga0395905_0011798 3300037471 Bacteria 8437
435 Ga0395905_0014547 3300037471 Bacteria 7507
436 Ga0395905_0066757 3300037471 Bacteria 3369
437 Ga0395905_0081260 3300037471 Bacteria 3037
438 Ga0395905_0084626 3300037471 Bacteria 2972
439 Ga0395905_0177666 3300037471 Bacteria 1998
440 Ga0395905_0354791 3300037471 Bacteria 1359
441 Ga0439436_0008463 3300041404 Bacteria 3164
442 Ga0439439_0010418 3300041406 Bacteria 2222
443 Ga0439439_0011894 3300041406 Bacteria 2099
444 Ga0439465_0004738 3300041413 Bacteria 4385
445 Ga0451853_2883190 3300041512 Bacteria 1576
446 Ga0439431_0042692 3300041997 Bacteria 1159
447 Ga0439433_0011584 3300041999 Bacteria 1933
448 Ga0439442_009514 3300042002 Bacteria 1967
449 Ga0439445_0007498 3300042004 Bacteria 2533
450 Ga0439445_0032908 3300042004 Bacteria 1353
451 Ga0439432_001103 3300042006 Bacteria 10265
452 Ga0439432_008450 3300042006 Bacteria 3615
453 Ga0439449_0000682 3300042007 Bacteria 12925
454 Ga0439449_0002069 3300042007 Bacteria 7898
455 Ga0439452_004403 3300042010 Bacteria 4727
456 Ga0439452_004644 3300042010 Bacteria 4559
457 Ga0439455_0001526 3300042012 Bacteria 3906
458 Ga0439457_040827 3300042014 Bacteria 1034
459 Ga0439462_0005434 3300042015 Bacteria 3141
460 Ga0450919_000440 3300042121 Bacteria 5139
461 Ga0450921_000658 3300042123 Bacteria 1754
462 Ga0450921_001695 3300042123 Bacteria 1376
463 Ga0450898_007415 3300042134 Bacteria 1708
464 Ga0450906_005936 3300042145 Bacteria 2485
465 Ga0439446_0029223 3300042156 Bacteria 1590
466 Ga0439446_0052999 3300042156 Bacteria 1215
467 Ga0439458_0066148 3300042157 Bacteria 908
468 Ga0439434_0001557 3300042435 Bacteria 6612
469 Ga0439434_0017164 3300042435 Bacteria 2165
470 Ga0439434_0054867 3300042435 Bacteria 1240
471 Ga0439460_0063482 3300042461 Bacteria 1132
472 Ga0450918_000195 3300042531 Bacteria 13613
473 Ga0450893_0016345 3300042532 Bacteria 1256
474 Ga0451577_0000340 3300042876 Bacteria 87523
475 Ga0451577_0004391 3300042876 Bacteria 14903
476 Ga0466969_0213469 3300044656 Bacteria 878
477 Ga0453683_0007043 3300044673 Bacteria 7660
478 Ga0466965_0009394 3300044683 Bacteria 4544
479 Ga0466965_0022297 3300044683 Bacteria 3054
480 Ga0466961_0054566 3300044693 Bacteria 2548
481 Ga0466964_0003116 3300044706 Bacteria 6026
482 Ga0453684_0000793 3300044712 Bacteria 108286
483 Ga0453684_0079742 3300044712 Bacteria 4091
484 Ga0466971_0118285 3300044719 Bacteria 1225
485 Ga0466957_0071907 3300044842 Bacteria 2140
486 Ga0466957_0443580 3300044842 Bacteria 893
487 Ga0466960_0050222 3300044901 Bacteria 2010
488 Ga0466959_0109790 3300045049 Bacteria 1969
489 Ga0451576_0020223 3300045051 Bacteria 7250
490 Ga0451576_0023961 3300045051 Bacteria 6597
491 Ga0451576_0126897 3300045051 Bacteria 2658
492 Ga0466958_0342029 3300045836 Bacteria 962
493 Ga0466967_0195272 3300045976 Bacteria 1914
494 Ga0495590_0004862 3300046457 Bacteria 5373
495 Ga0495639_0002239 3300046475 Bacteria 8498
496 Ga0495616_0000288 3300046513 Bacteria 40663
497 Ga0495631_0000187 3300046518 Bacteria 42155
498 Ga0495632_0009885 3300046519 Bacteria 5703
499 Ga0495637_0000830 3300046520 Bacteria 20412
500 Ga0495643_0050204 3300046522 Bacteria 2247
501 Ga0495642_0045448 3300046528 Bacteria 1795
502 Ga0495642_0145725 3300046528 Bacteria 1023
503 Ga0495654_0004560 3300046530 Bacteria 8192
504 Ga0495621_0011136 3300046539 Bacteria 2773
505 Ga0495597_0000721 3300046542 Bacteria 26390
506 Ga0495597_0009303 3300046542 Bacteria 4864
507 Ga0495622_0068598 3300046557 Bacteria 1638
508 Ga0495622_0141931 3300046557 Bacteria 1090
509 Ga0495633_0029065 3300046558 Bacteria 2690
510 Ga0495656_0001085 3300046615 Bacteria 8809
511 Ga0495668_0197976 3300046616 Bacteria 1100
512 Ga0495625_0001236 3300046660 Bacteria 32273
513 Ga0495625_0041071 3300046660 Bacteria 3368
514 Ga0495625_0047397 3300046660 Bacteria 3098
515 Ga0495661_0138377 3300046665 Bacteria 1327
516 Ga0495588_0007292 3300046674 Bacteria 5026
517 Ga0495588_0182152 3300046674 Bacteria 1110
518 Ga0495658_0388872 3300046683 Bacteria 889
519 Ga0495624_0076460 3300046690 Bacteria 2077
520 Ga0495670_0062043 3300046691 Bacteria 1880
521 Ga0495671_0007995 3300046692 Bacteria 5978
522 Ga0495649_0013765 3300046694 Bacteria 4657
523 Ga0495660_0055595 3300046810 Bacteria 2142
524 Ga0495676_0032357 3300047321 Bacteria 4415
525 Ga0495687_000327 3300047443 Bacteria 61677
526 Ga0495677_0013572 3300047445 Bacteria 2966
527 Ga0495681_0087967 3300047470 Bacteria 1376
528 Ga0495593_0008355 3300047673 Bacteria 6025
529 Ga0495593_0168172 3300047673 Bacteria 1106
530 Ga0495626_0027261 3300048091 Bacteria 2779
531 Ga0496100_0025814 3300048903 Bacteria 3595
532 Ga0496101_0001647 3300048904 Bacteria 13387
533 Ga0496101_0013086 3300048904 Bacteria 5550
534 Ga0496102_0071013 3300048905 Bacteria 3197
535 Ga0496103_0159333 3300048906 Bacteria 1447
536 Ga0496104_0024430 3300048907 Bacteria 5557
537 Ga0496105_0011915 3300048908 Bacteria 6884
538 Ga0496109_0210562 3300048912 Bacteria 1828
539 Ga0496109_0341157 3300048912 Bacteria 1415
540 Ga0496110_0076278 3300048913 Bacteria 2980
541 Ga0496113_0115852 3300048916 Bacteria 2091
542 Ga0496116_0122546 3300048919 Bacteria 1501
543 Ga0496121_0071081 3300048924 Bacteria 2800
544 Ga0496122_0000324 3300048925 Bacteria 104220
545 Ga0496123_0000160 3300048926 Bacteria 135310
546 Ga0496123_0124326 3300048926 Bacteria 1443
547 Ga0496124_0073204 3300048927 Bacteria 2836
548 Ga0496125_0010589 3300048928 Bacteria 9317
549 Ga0496125_0013806 3300048928 Bacteria 7912
550 Ga0496125_0078801 3300048928 Bacteria 2530
551 Ga0496126_0246918 3300048929 Bacteria 1489
552 Ga0501031_0033045 3300049568 Bacteria 3373
553 Ga0501034_0313959 3300049571 Bacteria 1501
554 Ga0501257_088789 3300049686 Bacteria 803
555 Ga0501262_003744 3300049759 Bacteria 1754
556 Ga0501044_0680562 3300049823 Bacteria 915
557 nmdc:mga03683_11698_c1 3300050489 Bacteria 3186
558 nmdc:mga03683_17684_c1 3300050489 Bacteria 2702
559 nmdc:mga03683_23445_c1 3300050489 Bacteria 2404
560 nmdc:mga03683_26319_c1 3300050489 Bacteria 2294
561 nmdc:mga03683_451_c1 3300050489 Bacteria 11851
562 nmdc:mga03n38_27152_c1 3300050490 Bacteria 2372
563 nmdc:mga00v17_13181_c1 3300050491 Bacteria 4581
564 nmdc:mga0yw44_10136_c1 3300050492 Bacteria 4801
565 nmdc:mga0yw44_77697_c1 3300050492 Bacteria 2074
566 nmdc:mga0k408_10712_c1 3300050493 Bacteria 4968
567 nmdc:mga0k408_21637_c1 3300050493 Bacteria 3614
568 nmdc:mga0k408_31612_c1 3300050493 Bacteria 3023
569 nmdc:mga0k408_43748_c1 3300050493 Bacteria 2582
570 nmdc:mga0k408_52493_c1 3300050493 Bacteria 2363
571 nmdc:mga0k408_73747_c1 3300050493 Bacteria 1994
572 nmdc:mga06z11_157852_c1 3300050494 Bacteria 1294
573 nmdc:mga07m45_110669_c1 3300050496 Bacteria 1582
574 nmdc:mga07m45_13783_c1 3300050496 Bacteria 4294
575 nmdc:mga07m45_28985_c1 3300050496 Bacteria 3058
576 nmdc:mga0sz30_26342_c1 3300050516 Bacteria 2383
577 nmdc:mga0sz30_55858_c1 3300050516 Bacteria 1681
578 nmdc:mga0sz30_83571_c1 3300050516 Bacteria 1383
579 Ga0500651_0000267 3300053093 Bacteria 30991
580 Ga0500593_000228 3300053117 Bacteria 23190
581 Ga0500607_001572 3300053121 Bacteria 20173
582 Ga0500608_048380 3300053122 Bacteria 2043
583 Ga0500658_0000239 3300053134 Bacteria 25725
584 Ga0500658_0000484 3300053134 Bacteria 17027
585 Ga0500559_0012276 3300053136 Bacteria 3644
586 Ga0500590_051358 3300053148 Bacteria 2094
587 Ga0500627_0040034 3300053158 Bacteria 2009
588 Ga0500645_000574 3300053730 Bacteria 23829
589 Ga0590075_016087 3300059424 Bacteria 1839
590 2511243615 2511231002 Bacteria 5042903
591 2513226969 2513020051 Bacteria 6053213
592 2513228363 2513020051 Bacteria 6053213
593 2548497803 2547132374 Bacteria 5530232
594 2599626235 2599185214 Bacteria 8209958
595 2599675874 2599185226 Bacteria 8233575
596 2599682242 2599185227 Bacteria 8246414
597 2599695893 2599185229 Bacteria 8216126
598 2643867247 2643221570 Bacteria 5103772
599 2643990165 2643221596 Bacteria 5006805
600 2644059297 2643221609 Bacteria 6756331
601 2644075664 2643221611 Bacteria 6820941
602 2644164051 2643221628 Bacteria 5745828
603 2644243975 2643221644 Bacteria 6865017
604 2644295655 2643221652 Bacteria 5140275
605 2644302939 2643221654 Bacteria 5273570
606 2644399911 2643221672 Bacteria 6322190
607 2644466759 2643221683 Bacteria 5749203
608 2644645194 2643221717 Bacteria 5676132
609 2722885628 2721755523 Bacteria 6430384
610 2738721468 2738541277 Bacteria 7458140
611 2738880826 2738541307 Bacteria 8606193
612 2739240792 2738543012 Bacteria 7115078
613 2739249674 2738543013 Bacteria 5618633
614 2739281137 2738543019 Bacteria 7459457
615 2816472130 2816332133 Bacteria 7249298
616 2819601505 2818991446 Bacteria 7757362
617 2831272228 2831265667 Bacteria 7184833
618 2838059392 2838054893 Bacteria 7451788
619 2839141700 2839138175 Bacteria 6549354
620 2842678659 2842677519 Bacteria 5615038
621 2842718407 2842718218 Bacteria 4560148
622 2842733922 2842733646 Bacteria 5716726
623 2842752686 2842747753 Bacteria 5578255
624 2881104960 2881101125 Bacteria 4590519
625 2885193184 2885192300 Bacteria 5882526
626 2885202866 2885198086 Bacteria 7212419
627 2885216737 2885211737 Bacteria 7212420
628 2899930950 2899924645 Bacteria 7487985
629 2904452738 2904449895 Bacteria 6927402
630 2904460234 2904456579 Bacteria 6819253
631 2904547145 2904541872 Bacteria 8915136
632 2919463644 2919462493 Bacteria 5817112
633 2919706261 2919704043 Bacteria 5560311
634 2928040815 2928037797 Bacteria 7273642
635 2928047657 2928044640 Bacteria 7271509
636 2928055438 2928051484 Bacteria 7773759
637 2928069543 2928064002 Bacteria 7419480
638 2928075514 2928070936 Bacteria 8062541
639 2928089443 2928084124 Bacteria 7159212
640 2928117941 2928115317 Bacteria 6477646
641 2929165699 2929160207 Bacteria 9075316
642 2929525700 2929520902 Bacteria 6765052
643 2945909647 2945909444 Bacteria 7065066
644 2945945734 2945945610 Bacteria 5951079
645 2945975388 2945972063 Bacteria 6086495
646 2945988379 2945984333 Bacteria 7358892
647 2954769165 2954767861 Bacteria 5535784
648 2974320629 2974320154 Bacteria 4571377
649 2990711115 2990710928 Bacteria 5002431
650 Ga0207709_10000076
651 JGI24739J22299_10052958
652 JGI25155J39150_1000029
653 JGI25156J39149_1000272
654 JGI25154J39366_1000053
655 JGI25157J39369_1000046
656 JGI25150J39212_1004866
657 JGI25150J39212_1011896
658 JGI25150J39212_1015851
659 JGI25159J45721_1005232
660 JGI25159J45721_1014942
661 JGI25151J46595_10001446
662 JGI25151J46595_10003511
663 JGI25151J46595_10008613
664 JGI25151J46595_10011783
665 JGI25153J46596_10002887
666 JGI25153J46596_10026617
667 JGI25160J50197_1008376
668 JGI25160J50197_1010335
669 JGI25160J50197_1030576
670 JGI25161J50226_1000046
671 JGI25161J50226_1004960
672 Ga0006562J51391_1044074
673 Ga0006562J51391_1045467
674 Ga0006562J51391_1045469
675 Ga0055535_1000289
676 Ga0055542_1000036
677 Ga0055526_1004155
678 Ga0055526_1005732
679 Ga0055537_1000623
680 Ga0055524_1000044
681 Ga0055524_1000469
682 Ga0055524_1022088
683 Ga0055536_1014715
684 Ga0055534_1000397
685 Ga0055528_1008275
686 Ga0055530_10000630
687 Ga0055530_10003088
688 Ga0055540_1000063
689 Ga0055540_1000173
690 Ga0055540_1007713
691 Ga0055531_10000276
692 Ga0055531_10014054
693 Ga0055543_1001803
694 Ga0055543_1002615
695 Ga0065165_1056801
696 Ga0065704_10196713
697 Ga0065704_10220127
698 Ga0065707_10152043
699 Ga0070658_10079968
700 Ga0070658_10180959
701 Ga0070658_10209465
702 Ga0070670_100091617
703 Ga0068868_100565144
704 Ga0070661_100001470
705 Ga0070668_100249499
706 Ga0070668_100463328
707 Ga0070669_100081971
708 Ga0070669_100148324
709 Ga0070669_100164412
710 Ga0070675_100024440
711 Ga0070671_100025509
712 Ga0070671_100047940
713 Ga0070673_100020985
714 Ga0070659_100001712
715 Ga0070659_100089034
716 Ga0070667_100015275
717 Ga0070708_100111340
718 Ga0070663_100091088
719 Ga0070678_100228320
720 Ga0070662_100040739
721 Ga0068867_100069959
722 Ga0068867_100149273
723 Ga0070685_10407842
724 Ga0070706_100003421
725 Ga0068853_100012883
726 Ga0068853_100224713
727 Ga0070672_100039085
728 Ga0070672_100165814
729 Ga0070665_100085161
730 Ga0070665_100105115
731 Ga0070665_100345199
732 Ga0070665_100506427
733 Ga0068855_100022176
734 Ga0068855_100089597
735 Ga0068855_100116141
736 Ga0070664_100002031
737 Ga0070664_100013022
738 Ga0070664_100693134
739 Ga0068857_100064053
740 Ga0068857_100354154
741 Ga0068854_100124322
742 Ga0068852_100056642
743 Ga0068852_100242356
744 Ga0068859_100044987
745 Ga0068864_100032354
746 Ga0068864_100104975
747 Ga0068851_10014047
748 Ga0068863_100034397
749 Ga0068863_100414650
750 Ga0068863_100541600
751 Ga0068860_100080422
752 Ga0068860_100258559
753 Ga0068862_100199483
754 Ga0081455_10153923
755 Ga0075365_10003479
756 Ga0075365_10076520
757 Ga0075365_10132489
758 Ga0075365_10138900
759 Ga0075368_10054797
760 Ga0075363_100082242
761 Ga0075364_10091292
762 Ga0075432_10033726
763 Ga0075362_10003327
764 Ga0075362_10015585
765 Ga0075362_10017376
766 Ga0075362_10024283
767 Ga0075362_10099598
768 Ga0075367_10028530
769 Ga0075367_10045067
770 Ga0075367_10083729
771 Ga0075366_10001341
772 Ga0075366_10007913
773 Ga0075366_10022118
774 Ga0075366_10053794
775 Ga0075366_10061318
776 Ga0075366_10065134
777 Ga0075366_10102128
778 Ga0075366_10105054
779 Ga0075366_10131971
780 Ga0097621_100111445
781 Ga0075370_10001058
782 Ga0075370_10009223
783 Ga0075370_10033362
784 Ga0075370_10161389
785 Ga0068871_100151985
786 Ga0097620_100044987
787 Ga0079104_1000037
788 Ga0079104_1000294
789 Ga0079104_1008514
790 Ga0079104_1026331
791 Ga0105240_10001543
792 Ga0105240_10002814
793 Ga0105240_10351882
794 Ga0105245_10182584
795 Ga0105245_10418446
796 Ga0105247_10124116
797 Ga0105243_10015400
798 Ga0105243_10054766
799 Ga0105243_10122609
800 Ga0105241_10381380
801 Ga0105237_10002372
802 Ga0105237_10014572
803 Ga0105237_10053518
804 Ga0105238_10027529
805 Ga0105238_10508411
806 Ga0105238_10596867
807 Ga0105239_10001168
808 Ga0105239_10016215
809 Ga0157347_1005573
810 Ga0157347_1009747
811 Ga0157373_10003982
812 Ga0157371_10108489
813 Ga0157370_10007530
814 Ga0157370_10374199
815 Ga0157369_10050951
816 Ga0157378_10271907
817 Ga0163162_10021978
818 Ga0157372_10804912
819 Ga0157375_10192299
820 Ga0157375_10295556
821 Ga0182008_10000191
822 Ga0182008_10003941
823 Ga0182008_10005474
824 Ga0182008_10006656
825 Ga0182008_10026178
826 Ga0157376_10175324
827 Ga0157376_10708669
828 Ga0182006_1001724
829 Ga0182006_1058840
830 Ga0182007_10002842
831 Ga0182005_1025809
832 Ga0183362_10005
833 Ga0163161_10000244
834 Ga0163161_10128426
835 Ga0163161_10131556
836 Ga0163161_10181282
837 Ga0209435_100003
838 Ga0209436_106712
839 Ga0209672_101200
840 Ga0209147_100961
841 Ga0209258_100091
842 Ga0207425_1000183
843 Ga0207425_1000933
844 Ga0207425_1009626
845 Ga0207425_1033787
846 Ga0209646_1000008
847 Ga0209026_1000007
848 Ga0209148_1000033
849 Ga0209759_1000026
850 Ga0209129_1000091
851 Ga0209129_1004863
852 Ga0209565_1000020
853 Ga0209565_1000200
854 Ga0209565_1000270
855 Ga0209565_1000507
856 Ga0209565_1001022
857 Ga0209565_1027612
858 Ga0209565_1028856
859 Ga0209673_1000009
860 Ga0209673_1000012
861 Ga0209673_1000072
862 Ga0209673_1000154
863 Ga0209673_1000772
864 Ga0209673_1007609
865 Ga0209130_1000064
866 Ga0209130_1000140
867 Ga0209130_1000203
868 Ga0209130_1000225
869 Ga0209675_1000014
870 Ga0209675_1000144
871 Ga0209675_1000447
872 Ga0209675_1001399
873 Ga0209676_1000051
874 Ga0209676_1000088
875 Ga0209676_1000267
876 Ga0209676_1000966
877 Ga0209676_1002156
878 Ga0209676_1009167
879 Ga0209025_1000207
880 Ga0209025_1000356
881 Ga0209025_1001327
882 Ga0209025_1001509
883 Ga0209025_1007756
884 Ga0209025_1008400
885 Ga0209025_1013276
886 Ga0209564_1000103
887 Ga0209564_1000530
888 Ga0209564_1000797
889 Ga0209564_1000945
890 Ga0209564_1001673
891 Ga0209758_1000092
892 Ga0209758_1000327
893 Ga0209758_1010345
894 Ga0209758_1010394
895 Ga0209758_1015192
896 Ga0209050_1000044
897 Ga0209050_1000110
898 Ga0209050_1000916
899 Ga0209050_1000983
900 Ga0209050_1005037
901 Ga0209256_1000003
902 Ga0209256_1000036
903 Ga0209256_1000065
904 Ga0209256_1000094
905 Ga0207426_1000084
906 Ga0207426_1000116
907 Ga0207426_1000124
908 Ga0207426_1001529
909 Ga0209051_1000031
910 Ga0209051_1000069
911 Ga0209051_1000114
912 Ga0209051_1000230
913 Ga0209051_1000379
914 Ga0209051_1000685
915 Ga0209051_1001139
916 Ga0209051_1001228
917 Ga0209051_1002160
918 Ga0209257_1000015
919 Ga0209257_1000058
920 Ga0209257_1000093
921 Ga0209257_1000141
922 Ga0209257_1000575
923 Ga0207656_10007635
924 Ga0207655_1001961
925 Ga0207642_10169774
926 Ga0207710_10101190
927 Ga0207680_10353356
928 Ga0207645_10162906
929 Ga0207645_10265362
930 Ga0207705_10352441
931 Ga0207705_10400712
932 Ga0207684_10053942
933 Ga0207654_10291750
934 Ga0207695_10005159
935 Ga0207695_10068733
936 Ga0207695_10163527
937 Ga0207695_10256385
938 Ga0207671_10013375
939 Ga0207671_10044087
940 Ga0207671_10252773
941 Ga0207657_10031330
942 Ga0207657_10186173
943 Ga0207649_10010410
944 Ga0207649_10136167
945 Ga0207652_10382497
946 Ga0207681_10002439
947 Ga0207681_10170720
948 Ga0207681_10176916
949 Ga0207694_10042635
950 Ga0207650_10160955
951 Ga0207687_10120309
952 Ga0207644_10038729
953 Ga0207644_10186148
954 Ga0207690_10002101
955 Ga0207690_10022892
956 Ga0207706_10042818
957 Ga0207686_10011859
958 Ga0207709_10000472
959 Ga0207709_10002379
960 Ga0207709_10042383
961 Ga0207691_10015393
962 Ga0207691_10223290
963 Ga0207689_10137037
964 Ga0207689_10347778
965 Ga0207689_10391223
966 Ga0207679_10000088
967 Ga0207679_10027321
968 Ga0207667_10039365
969 Ga0207667_10117417
970 Ga0207651_10013397
971 Ga0207651_10266560
972 Ga0207651_10298052
973 Ga0207668_10058976
974 Ga0207640_10320841
975 Ga0207677_10010744
976 Ga0207677_10014817
977 Ga0207677_10383172
978 Ga0207639_10019378
979 Ga0207639_10139927
980 Ga0207678_10026992
981 Ga0207641_10008372
982 Ga0207641_10523579
983 Ga0207648_10013164
984 Ga0207648_10065424
985 Ga0207648_10502337
986 Ga0207676_10033357
987 Ga0207676_10132659
988 Ga0207676_10324649
989 Ga0207674_10016085
990 Ga0207674_10034413
991 Ga0207674_10362917
992 Ga0207674_10402966
993 Ga0207674_10434698
994 Ga0207675_100032073
995 Ga0207675_100384680
996 Ga0207683_10031829
997 Ga0207683_10276400
998 Ga0207698_10044076
999 Ga0209281_1000002
1000 Ga0209281_1000423
1001 Ga0209281_1019020
1002 Ga0209970_1000026
1003 Ga0209282_1000298
1004 Ga0209971_1000744
1005 Ga0209974_10005128
1006 Ga0209974_10010577
1007 Ga0209974_10016653
1008 Ga0268266_10006260
1009 Ga0268266_10026800
1010 Ga0268266_10345295
1011 Ga0268265_10174867
1012 Ga0268265_10352528
1013 Ga0268264_10051817
1014 Ga0307517_10139084
1015 Ga0307515_10000419
1016 Ga0307515_10003462
1017 Ga0307515_10007779
1018 Ga0307515_10048555
1019 Ga0307515_10149053
1020 Ga0307515_10160465
1021 Ga0307515_10196436
1022 Ga0307512_10061877
1023 Ga0316176_1093739
1024 Ga0314311_1200241
1025 Ga0316179_1078761
1026 Ga0316183_1110470
1027 Ga0265330_10000044
1028 Ga0265330_10037185
1029 Ga0265332_10000046
1030 Ga0265332_10003009
1031 Ga0265325_10013967
1032 Ga0265340_10006278
1033 Ga0265327_10000945
1034 Ga0265327_10005555
1035 Ga0265316_10056195
1036 Ga0307513_10000008
1037 Ga0307513_10000316
1038 Ga0307513_10029422
1039 Ga0307513_10189360
1040 Ga0307513_10350444
1041 Ga0307513_10440379
1042 Ga0307509_10000904
1043 Ga0307509_10011898
1044 Ga0307509_10154799
1045 Ga0307509_10249323
1046 Ga0307408_100000229
1047 Ga0307408_100052417
1048 Ga0307408_100066336
1049 Ga0307408_100196146
1050 Ga0307408_100257436
1051 Ga0307408_100327357
1052 Ga0307408_100547679
1053 Ga0307514_10001645
1054 Ga0307514_10005374
1055 Ga0307514_10017019
1056 Ga0265314_10000130
1057 Ga0265314_10008127
1058 Ga0265342_10027415
1059 Ga0307516_10005347
1060 Ga0307516_10036692
1061 Ga0307516_10412981
1062 Ga0307405_10071808
1063 Ga0307405_10332780
1064 Ga0307413_10056778
1065 Ga0307406_10000319
1066 Ga0307406_10459303
1067 Ga0307412_10247479
1068 Ga0307416_100035902
1069 Ga0307411_10088171
1070 Ga0307510_10000122
1071 Ga0307510_10288971
1072 Ga0373939_0048742
1073 Ga0373931_0114117
1074 Ga0373933_0433548
1075 Ga0373925_0013137
1076 Ga0395899_0010475
1077 Ga0395900_0038355
1078 Ga0395900_0043581
1079 Ga0395898_0026798
1080 Ga0395898_0051820
1081 Ga0395898_0091650
1082 Ga0395898_0834481
1083 Ga0395905_0011798
1084 Ga0395905_0014547
1085 Ga0395905_0066757
1086 Ga0395905_0081260
1087 Ga0395905_0084626
1088 Ga0395905_0177666
1089 Ga0395905_0354791
1090 Ga0439436_0008463
1091 Ga0439439_0010418
1092 Ga0439439_0011894
1093 Ga0439465_0004738
1094 Ga0451853_2883190
1095 Ga0439431_0042692
1096 Ga0439433_0011584
1097 Ga0439442_009514
1098 Ga0439445_0007498
1099 Ga0439445_0032908
1100 Ga0439432_001103
1101 Ga0439432_008450
1102 Ga0439449_0000682
1103 Ga0439449_0002069
1104 Ga0439452_004403
1105 Ga0439452_004644
1106 Ga0439455_0001526
1107 Ga0439457_040827
1108 Ga0439462_0005434
1109 Ga0450919_000440
1110 Ga0450921_000658
1111 Ga0450921_001695
1112 Ga0450898_007415
1113 Ga0450906_005936
1114 Ga0439446_0029223
1115 Ga0439446_0052999
1116 Ga0439458_0066148
1117 Ga0439434_0001557
1118 Ga0439434_0017164
1119 Ga0439434_0054867
1120 Ga0439460_0063482
1121 Ga0450918_000195
1122 Ga0450893_0016345
1123 Ga0451577_0000340
1124 Ga0451577_0004391
1125 Ga0466969_0213469
1126 Ga0453683_0007043
1127 Ga0466965_0009394
1128 Ga0466965_0022297
1129 Ga0466961_0054566
1130 Ga0466964_0003116
1131 Ga0453684_0000793
1132 Ga0453684_0079742
1133 Ga0466971_0118285
1134 Ga0466957_0071907
1135 Ga0466957_0443580
1136 Ga0466960_0050222
1137 Ga0466959_0109790
1138 Ga0451576_0020223
1139 Ga0451576_0023961
1140 Ga0451576_0126897
1141 Ga0466958_0342029
1142 Ga0466967_0195272
1143 Ga0495590_0004862
1144 Ga0495639_0002239
1145 Ga0495616_0000288
1146 Ga0495631_0000187
1147 Ga0495632_0009885
1148 Ga0495637_0000830
1149 Ga0495643_0050204
1150 Ga0495642_0045448
1151 Ga0495642_0145725
1152 Ga0495654_0004560
1153 Ga0495621_0011136
1154 Ga0495597_0000721
1155 Ga0495597_0009303
1156 Ga0495622_0068598
1157 Ga0495622_0141931
1158 Ga0495633_0029065
1159 Ga0495656_0001085
1160 Ga0495668_0197976
1161 Ga0495625_0001236
1162 Ga0495625_0041071
1163 Ga0495625_0047397
1164 Ga0495661_0138377
1165 Ga0495588_0007292
1166 Ga0495588_0182152
1167 Ga0495658_0388872
1168 Ga0495624_0076460
1169 Ga0495670_0062043
1170 Ga0495671_0007995
1171 Ga0495649_0013765
1172 Ga0495660_0055595
1173 Ga0495676_0032357
1174 Ga0495687_000327
1175 Ga0495677_0013572
1176 Ga0495681_0087967
1177 Ga0495593_0008355
1178 Ga0495593_0168172
1179 Ga0495626_0027261
1180 Ga0496100_0025814
1181 Ga0496101_0001647
1182 Ga0496101_0013086
1183 Ga0496102_0071013
1184 Ga0496103_0159333
1185 Ga0496104_0024430
1186 Ga0496105_0011915
1187 Ga0496109_0210562
1188 Ga0496109_0341157
1189 Ga0496110_0076278
1190 Ga0496113_0115852
1191 Ga0496116_0122546
1192 Ga0496121_0071081
1193 Ga0496122_0000324
1194 Ga0496123_0000160
1195 Ga0496123_0124326
1196 Ga0496124_0073204
1197 Ga0496125_0010589
1198 Ga0496125_0013806
1199 Ga0496125_0078801
1200 Ga0496126_0246918
1201 Ga0501031_0033045
1202 Ga0501034_0313959
1203 Ga0501257_088789
1204 Ga0501262_003744
1205 Ga0501044_0680562
1206 nmdc:mga03683_11698_c1
1207 nmdc:mga03683_17684_c1
1208 nmdc:mga03683_23445_c1
1209 nmdc:mga03683_26319_c1
1210 nmdc:mga03683_451_c1
1211 nmdc:mga03n38_27152_c1
1212 nmdc:mga00v17_13181_c1
1213 nmdc:mga0yw44_10136_c1
1214 nmdc:mga0yw44_77697_c1
1215 nmdc:mga0k408_10712_c1
1216 nmdc:mga0k408_21637_c1
1217 nmdc:mga0k408_31612_c1
1218 nmdc:mga0k408_43748_c1
1219 nmdc:mga0k408_52493_c1
1220 nmdc:mga0k408_73747_c1
1221 nmdc:mga06z11_157852_c1
1222 nmdc:mga07m45_110669_c1
1223 nmdc:mga07m45_13783_c1
1224 nmdc:mga07m45_28985_c1
1225 nmdc:mga0sz30_26342_c1
1226 nmdc:mga0sz30_55858_c1
1227 nmdc:mga0sz30_83571_c1
1228 Ga0500651_0000267
1229 Ga0500593_000228
1230 Ga0500607_001572
1231 Ga0500608_048380
1232 Ga0500658_0000239
1233 Ga0500658_0000484
1234 Ga0500559_0012276
1235 Ga0500590_051358
1236 Ga0500627_0040034
1237 Ga0500645_000574
1238 Ga0590075_016087
1239 2511243615
1240 2513226969
1241 2513228363
1242 2548497803
1243 2599626235
1244 2599675874
1245 2599682242
1246 2599695893
1247 2643867247
1248 2643990165
1249 2644059297
1250 2644075664
1251 2644164051
1252 2644243975
1253 2644295655
1254 2644302939
1255 2644399911
1256 2644466759
1257 2644645194
1258 2722885628
1259 2738721468
1260 2738880826
1261 2739240792
1262 2739249674
1263 2739281137
1264 2816472130
1265 2819601505
1266 2831272228
1267 2838059392
1268 2839141700
1269 2842678659
1270 2842718407
1271 2842733922
1272 2842752686
1273 2881104960
1274 2885193184
1275 2885202866
1276 2885216737
1277 2899930950
1278 2904452738
1279 2904460234
1280 2904547145
1281 2919463644
1282 2919706261
1283 2928040815
1284 2928047657
1285 2928055438
1286 2928069543
1287 2928075514
1288 2928089443
1289 2928117941
1290 2929165699
1291 2929525700
1292 2945909647
1293 2945945734
1294 2945975388
1295 2945988379
1296 2954769165
1297 2974320629
1298 2990711115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

51

300

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

56

238

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.9708 3 235
3moy-assembly1.cif.gz_A crystal structure of probable enoyl-coa hydratase from mycobacterium smegmatis 0.9693 1 255
5xzd-assembly1.cif.gz_F structure of acryloyl-coa hydratase acuh from roseovarius nubinhibens ism 0.9664 3 235
4fjw-assembly1.cif.gz_D crystal structure of the apo form of the e131q mtb crotonase 0.9663 1 256
3h81-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis 0.9637 2 258
ID Description Score Start End Superfamily
af_Q7ZZ04_32_233_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.972 1 199 3.90.226.10
af_Q54BX7_16_236_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9714 2 194 3.90.226.10
4fzwB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9645 2 197 3.90.226.10
2qq3L01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9599 3 198 3.90.226.10
af_Q7ZZ04_32_233_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9532 1 199 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A0L0DKA5-F1-model_v4 Enoyl-CoA hydratase 0.9795 2 211 GO:0005739
GO:0006635
GO:0016836
AF-A0A640JBL3-F1-model_v4 deleted 0.979 1 258
AF-A0A7S3ZB57-F1-model_v4 Enoyl-CoA hydratase 0.9785 1 205 GO:0005739
GO:0006635
GO:0016836
AF-A0A7J7AMY3-F1-model_v4 deleted 0.9776 1 216
AF-A0A6V7GZV5-F1-model_v4 Enoyl-CoA hydratase 0.9775 1 213 GO:0005739
GO:0006635
GO:0016836

Map