F472540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 297 | 646 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0230488|Ga0453684_0230488_1200_1964 |
| Length | 254 |
| Sequence | MTIIKPKRCSKRGRVHWMRPHSLTRGGVGVSLRQKEVCKDDERGKMKDIVLIDAGTGNLRSVQKALENVGASVERTDDPQKVLAAKKVVLPGVGAFGDFMDGMKAKGLDDAVKQVVSRGVPMLGICVGMQALFEIGEEMGEHEGLGLLRGTVVKFADTLSVKIPHTGWNQVQVTRRGLRQKEAALFDQIQDGAYVYFNHSYYCQAGDPSDVIAEVDYGIRYACAVRRENVFGVQFHPEKSQAVGLRILKNFVEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 3 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 4 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 171 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 175 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 179 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 180 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 186 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 195 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 202 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 206 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 207 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 297 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0.31 |
| Rhizoplane | 1.08 |
| Rhizosphere | 94.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_8347333 | 2162886011 | Unclassified | 1213 |
| 2 | JGI24745J21846_1017595 | 3300002073 | Bacteria | 832 |
| 3 | rootL2_10013282 | 3300003322 | Bacteria | 16779 |
| 4 | JGI25404J52841_10000484 | 3300003659 | Bacteria | 5735 |
| 5 | Ga0065165_1010199 | 3300005262 | Bacteria | 4096 |
| 6 | Ga0065704_10028029 | 3300005289 | Bacteria | 1345 |
| 7 | Ga0065704_10295538 | 3300005289 | Unclassified | 895 |
| 8 | Ga0065712_10088085 | 3300005290 | Bacteria | 2539 |
| 9 | Ga0065715_10007118 | 3300005293 | Bacteria | 3336 |
| 10 | Ga0065707_10002920 | 3300005295 | Bacteria | 10925 |
| 11 | Ga0065707_10084472 | 3300005295 | Bacteria | 7165 |
| 12 | Ga0065707_10153845 | 3300005295 | Unclassified | 1629 |
| 13 | Ga0065707_10343331 | 3300005295 | Bacteria | 916 |
| 14 | Ga0070658_10016196 | 3300005327 | Bacteria | 5964 |
| 15 | Ga0070676_10006282 | 3300005328 | Bacteria | 6346 |
| 16 | Ga0070676_10063748 | 3300005328 | Bacteria | 2196 |
| 17 | Ga0070683_100221656 | 3300005329 | Bacteria | 1798 |
| 18 | Ga0070683_100768096 | 3300005329 | Bacteria | 923 |
| 19 | Ga0070690_100002748 | 3300005330 | Bacteria | 9497 |
| 20 | Ga0070690_100170034 | 3300005330 | Bacteria | 1499 |
| 21 | Ga0070670_100244692 | 3300005331 | Bacteria | 1562 |
| 22 | Ga0070670_100553201 | 3300005331 | Bacteria | 1027 |
| 23 | Ga0070677_10001462 | 3300005333 | Bacteria | 7469 |
| 24 | Ga0070677_10047607 | 3300005333 | Bacteria | 1719 |
| 25 | Ga0070677_10057988 | 3300005333 | Bacteria | 1589 |
| 26 | Ga0068869_100042368 | 3300005334 | Bacteria | 3263 |
| 27 | Ga0068869_100066274 | 3300005334 | Bacteria | 2660 |
| 28 | Ga0068869_100170023 | 3300005334 | Bacteria | 1702 |
| 29 | Ga0068869_100186069 | 3300005334 | Bacteria | 1630 |
| 30 | Ga0070666_10015997 | 3300005335 | Bacteria | 4793 |
| 31 | Ga0070666_10024914 | 3300005335 | Bacteria | 3899 |
| 32 | Ga0070680_100587069 | 3300005336 | Bacteria | 956 |
| 33 | Ga0068868_100062155 | 3300005338 | Bacteria | 2959 |
| 34 | Ga0068868_100402318 | 3300005338 | Bacteria | 1182 |
| 35 | Ga0070660_100270924 | 3300005339 | Bacteria | 1388 |
| 36 | Ga0070689_100065829 | 3300005340 | Bacteria | 2823 |
| 37 | Ga0070689_100130185 | 3300005340 | Bacteria | 2017 |
| 38 | Ga0070691_10063165 | 3300005341 | Bacteria | 1785 |
| 39 | Ga0070687_100001643 | 3300005343 | Bacteria | 7985 |
| 40 | Ga0070661_100586168 | 3300005344 | Unclassified | 900 |
| 41 | Ga0070668_100026632 | 3300005347 | Bacteria | 4388 |
| 42 | Ga0070669_100008311 | 3300005353 | Bacteria | 7412 |
| 43 | Ga0070669_100144637 | 3300005353 | Bacteria | 1836 |
| 44 | Ga0070675_100004051 | 3300005354 | Bacteria | 11124 |
| 45 | Ga0070675_100010384 | 3300005354 | Bacteria | 7273 |
| 46 | Ga0070675_100042811 | 3300005354 | Bacteria | 3700 |
| 47 | Ga0070674_100000382 | 3300005356 | Bacteria | 22209 |
| 48 | Ga0070674_100172151 | 3300005356 | Bacteria | 1652 |
| 49 | Ga0070674_100524855 | 3300005356 | Bacteria | 990 |
| 50 | Ga0070674_100875057 | 3300005356 | Bacteria | 781 |
| 51 | Ga0070673_100008003 | 3300005364 | Bacteria | 7002 |
| 52 | Ga0070673_100046554 | 3300005364 | Bacteria | 3370 |
| 53 | Ga0070673_100097452 | 3300005364 | Bacteria | 2415 |
| 54 | Ga0070673_100263468 | 3300005364 | Bacteria | 1506 |
| 55 | Ga0070688_100006025 | 3300005365 | Bacteria | 6433 |
| 56 | Ga0070688_100097721 | 3300005365 | Bacteria | 1931 |
| 57 | Ga0070688_100363995 | 3300005365 | Bacteria | 1062 |
| 58 | Ga0070659_100045339 | 3300005366 | Bacteria | 3444 |
| 59 | Ga0070659_100076117 | 3300005366 | Bacteria | 2676 |
| 60 | Ga0070659_100126655 | 3300005366 | Bacteria | 2072 |
| 61 | Ga0070659_100482557 | 3300005366 | Bacteria | 1055 |
| 62 | Ga0070667_100054359 | 3300005367 | Bacteria | 3380 |
| 63 | Ga0070667_100363178 | 3300005367 | Unclassified | 1313 |
| 64 | Ga0070709_10563698 | 3300005434 | Bacteria | 873 |
| 65 | Ga0070714_100010038 | 3300005435 | Bacteria | 7470 |
| 66 | Ga0070714_100021490 | 3300005435 | Bacteria | 5280 |
| 67 | Ga0070714_100069618 | 3300005435 | Bacteria | 3040 |
| 68 | Ga0070714_100083015 | 3300005435 | Bacteria | 2793 |
| 69 | Ga0070713_100086314 | 3300005436 | Bacteria | 2691 |
| 70 | Ga0070710_10120622 | 3300005437 | Bacteria | 1587 |
| 71 | Ga0070710_10614665 | 3300005437 | Bacteria | 758 |
| 72 | Ga0070705_100000746 | 3300005440 | Bacteria | 18450 |
| 73 | Ga0070705_100027012 | 3300005440 | Bacteria | 3129 |
| 74 | Ga0070700_100149346 | 3300005441 | Bacteria | 1597 |
| 75 | Ga0070700_100214599 | 3300005441 | Bacteria | 1360 |
| 76 | Ga0070694_100000370 | 3300005444 | Bacteria | 24146 |
| 77 | Ga0070694_100007196 | 3300005444 | Bacteria | 6775 |
| 78 | Ga0070694_100434530 | 3300005444 | Unclassified | 1033 |
| 79 | Ga0070708_100862973 | 3300005445 | Unclassified | 850 |
| 80 | Ga0070663_100272236 | 3300005455 | Bacteria | 1347 |
| 81 | Ga0070678_100007020 | 3300005456 | Bacteria | 6656 |
| 82 | Ga0070678_100048413 | 3300005456 | Bacteria | 3061 |
| 83 | Ga0070678_100511463 | 3300005456 | Bacteria | 1061 |
| 84 | Ga0070662_100031985 | 3300005457 | Bacteria | 3696 |
| 85 | Ga0070662_100055147 | 3300005457 | Bacteria | 2883 |
| 86 | Ga0070662_100551165 | 3300005457 | Bacteria | 966 |
| 87 | Ga0070681_10134031 | 3300005458 | Bacteria | 2408 |
| 88 | Ga0068867_100026117 | 3300005459 | Bacteria | 4192 |
| 89 | Ga0070685_10014872 | 3300005466 | Bacteria | 4128 |
| 90 | Ga0070706_100444829 | 3300005467 | Bacteria | 1206 |
| 91 | Ga0070707_100388659 | 3300005468 | Bacteria | 1355 |
| 92 | Ga0070707_100753836 | 3300005468 | Bacteria | 937 |
| 93 | Ga0070698_100002906 | 3300005471 | Bacteria | 18858 |
| 94 | Ga0070698_100043358 | 3300005471 | Bacteria | 4612 |
| 95 | Ga0070698_100062542 | 3300005471 | Bacteria | 3755 |
| 96 | Ga0070698_100064147 | 3300005471 | Bacteria | 3702 |
| 97 | Ga0070698_100316745 | 3300005471 | Bacteria | 1490 |
| 98 | Ga0070699_100010615 | 3300005518 | Bacteria | 7973 |
| 99 | Ga0070699_100025646 | 3300005518 | Bacteria | 5081 |
| 100 | Ga0070699_100027001 | 3300005518 | Bacteria | 4952 |
| 101 | Ga0070699_100195114 | 3300005518 | Bacteria | 1799 |
| 102 | Ga0070699_100200506 | 3300005518 | Bacteria | 1774 |
| 103 | Ga0070699_100361912 | 3300005518 | Bacteria | 1308 |
| 104 | Ga0070699_100443775 | 3300005518 | Bacteria | 1176 |
| 105 | Ga0070699_100743837 | 3300005518 | Bacteria | 897 |
| 106 | Ga0070679_100532034 | 3300005530 | Bacteria | 1119 |
| 107 | Ga0070697_100156129 | 3300005536 | Bacteria | 1926 |
| 108 | Ga0070672_100008378 | 3300005543 | Bacteria | 7067 |
| 109 | Ga0070672_100145010 | 3300005543 | Bacteria | 1961 |
| 110 | Ga0070672_100379393 | 3300005543 | Bacteria | 1209 |
| 111 | Ga0070686_100009633 | 3300005544 | Bacteria | 5430 |
| 112 | Ga0070695_100000707 | 3300005545 | Bacteria | 17815 |
| 113 | Ga0070696_100000965 | 3300005546 | Bacteria | 18625 |
| 114 | Ga0070696_100058484 | 3300005546 | Bacteria | 2692 |
| 115 | Ga0070693_100052188 | 3300005547 | Bacteria | 2344 |
| 116 | Ga0070665_100024814 | 3300005548 | Bacteria | 6040 |
| 117 | Ga0070704_100003273 | 3300005549 | Bacteria | 9255 |
| 118 | Ga0070704_100171290 | 3300005549 | Bacteria | 1727 |
| 119 | Ga0070704_100276743 | 3300005549 | Bacteria | 1389 |
| 120 | Ga0070704_100277490 | 3300005549 | Bacteria | 1387 |
| 121 | Ga0070664_100001259 | 3300005564 | Bacteria | 20292 |
| 122 | Ga0070664_100002281 | 3300005564 | Bacteria | 15422 |
| 123 | Ga0070664_100117700 | 3300005564 | Bacteria | 2324 |
| 124 | Ga0070664_100621224 | 3300005564 | Bacteria | 1003 |
| 125 | Ga0068857_100120196 | 3300005577 | Bacteria | 2365 |
| 126 | Ga0068857_100362462 | 3300005577 | Bacteria | 1344 |
| 127 | Ga0070702_100010489 | 3300005615 | Bacteria | 4564 |
| 128 | Ga0070702_100114043 | 3300005615 | Bacteria | 1681 |
| 129 | Ga0068852_100363944 | 3300005616 | Bacteria | 1415 |
| 130 | Ga0068859_100037935 | 3300005617 | Bacteria | 4835 |
| 131 | Ga0068859_100126054 | 3300005617 | Bacteria | 2629 |
| 132 | Ga0068859_100419971 | 3300005617 | Bacteria | 1434 |
| 133 | Ga0068859_100848281 | 3300005617 | Bacteria | 1000 |
| 134 | Ga0068864_100028638 | 3300005618 | Bacteria | 4710 |
| 135 | Ga0068864_100045866 | 3300005618 | Bacteria | 3750 |
| 136 | Ga0068864_100229397 | 3300005618 | Bacteria | 1717 |
| 137 | Ga0068864_100372277 | 3300005618 | Bacteria | 1352 |
| 138 | Ga0068864_101382912 | 3300005618 | Bacteria | 705 |
| 139 | Ga0068866_10593310 | 3300005718 | Bacteria | 747 |
| 140 | Ga0068861_100024564 | 3300005719 | Bacteria | 4359 |
| 141 | Ga0068870_10001437 | 3300005840 | Bacteria | 9631 |
| 142 | Ga0068870_10233041 | 3300005840 | Bacteria | 1133 |
| 143 | Ga0068863_100022046 | 3300005841 | Bacteria | 6081 |
| 144 | Ga0068863_100351447 | 3300005841 | Bacteria | 1435 |
| 145 | Ga0068858_100222421 | 3300005842 | Bacteria | 1788 |
| 146 | Ga0068860_100030930 | 3300005843 | Bacteria | 5147 |
| 147 | Ga0068862_100001194 | 3300005844 | Bacteria | 24496 |
| 148 | Ga0068862_100060116 | 3300005844 | Bacteria | 3263 |
| 149 | Ga0081455_10548479 | 3300005937 | Bacteria | 765 |
| 150 | Ga0081540_1000343 | 3300005983 | Bacteria | 47660 |
| 151 | Ga0070717_10007369 | 3300006028 | Bacteria | 8170 |
| 152 | Ga0070717_10010026 | 3300006028 | Bacteria | 7131 |
| 153 | Ga0075366_10039914 | 3300006195 | Unclassified | 2775 |
| 154 | Ga0097621_100090626 | 3300006237 | Bacteria | 2559 |
| 155 | Ga0068871_100013047 | 3300006358 | Bacteria | 6159 |
| 156 | Ga0068871_100096532 | 3300006358 | Bacteria | 2470 |
| 157 | Ga0068871_100501909 | 3300006358 | Bacteria | 1093 |
| 158 | Ga0075428_100000957 | 3300006844 | Bacteria | 30618 |
| 159 | Ga0075428_100027050 | 3300006844 | Bacteria | 6351 |
| 160 | Ga0075428_100047493 | 3300006844 | Bacteria | 4715 |
| 161 | Ga0075428_100281666 | 3300006844 | Bacteria | 1789 |
| 162 | Ga0075428_100608648 | 3300006844 | Bacteria | 1167 |
| 163 | Ga0075430_100000407 | 3300006846 | Bacteria | 31945 |
| 164 | Ga0075430_100079986 | 3300006846 | Bacteria | 2738 |
| 165 | Ga0075430_100268739 | 3300006846 | Bacteria | 1412 |
| 166 | Ga0075430_100348066 | 3300006846 | Bacteria | 1224 |
| 167 | Ga0075431_100014511 | 3300006847 | Bacteria | 7971 |
| 168 | Ga0075431_100017673 | 3300006847 | Bacteria | 7250 |
| 169 | Ga0075431_100137881 | 3300006847 | Bacteria | 2515 |
| 170 | Ga0075433_10001626 | 3300006852 | Bacteria | 16666 |
| 171 | Ga0075433_10008473 | 3300006852 | Bacteria | 8207 |
| 172 | Ga0075433_10122556 | 3300006852 | Bacteria | 2309 |
| 173 | Ga0075433_10169508 | 3300006852 | Bacteria | 1943 |
| 174 | Ga0075434_100011034 | 3300006871 | Bacteria | 8502 |
| 175 | Ga0075434_100060774 | 3300006871 | Bacteria | 3759 |
| 176 | Ga0075434_100074269 | 3300006871 | Bacteria | 3394 |
| 177 | Ga0075434_100080961 | 3300006871 | Bacteria | 3244 |
| 178 | Ga0075429_100008849 | 3300006880 | Bacteria | 8750 |
| 179 | Ga0075429_100045620 | 3300006880 | Bacteria | 3813 |
| 180 | Ga0075429_100051941 | 3300006880 | Bacteria | 3566 |
| 181 | Ga0075429_100186245 | 3300006880 | Bacteria | 1819 |
| 182 | Ga0075429_100646611 | 3300006880 | Unclassified | 926 |
| 183 | Ga0068865_100019564 | 3300006881 | Bacteria | 4382 |
| 184 | Ga0068865_100044873 | 3300006881 | Bacteria | 3028 |
| 185 | Ga0068865_100308639 | 3300006881 | Bacteria | 1269 |
| 186 | Ga0097620_100037937 | 3300006931 | Bacteria | 4835 |
| 187 | Ga0097620_100126058 | 3300006931 | Bacteria | 2629 |
| 188 | Ga0097620_100419969 | 3300006931 | Bacteria | 1434 |
| 189 | Ga0097620_100848259 | 3300006931 | Bacteria | 1000 |
| 190 | Ga0099826_10000048 | 3300006948 | Bacteria | 74895 |
| 191 | Ga0075435_100512230 | 3300007076 | Bacteria | 1038 |
| 192 | Ga0111539_10000937 | 3300009094 | Bacteria | 38215 |
| 193 | Ga0111539_10000967 | 3300009094 | Bacteria | 37722 |
| 194 | Ga0111539_10019325 | 3300009094 | Bacteria | 8412 |
| 195 | Ga0111539_10057520 | 3300009094 | Bacteria | 4618 |
| 196 | Ga0111539_10129980 | 3300009094 | Unclassified | 2949 |
| 197 | Ga0111539_10862984 | 3300009094 | Bacteria | 1053 |
| 198 | Ga0105245_10002584 | 3300009098 | Bacteria | 16303 |
| 199 | Ga0105245_10496610 | 3300009098 | Bacteria | 1236 |
| 200 | Ga0114129_10013246 | 3300009147 | Bacteria | 11746 |
| 201 | Ga0114129_10017625 | 3300009147 | Bacteria | 10167 |
| 202 | Ga0114129_10020095 | 3300009147 | Bacteria | 9506 |
| 203 | Ga0114129_10026025 | 3300009147 | Bacteria | 8285 |
| 204 | Ga0114129_10028768 | 3300009147 | Bacteria | 7873 |
| 205 | Ga0114129_10034743 | 3300009147 | Bacteria | 7122 |
| 206 | Ga0114129_10053445 | 3300009147 | Bacteria | 5664 |
| 207 | Ga0114129_10164109 | 3300009147 | Bacteria | 3032 |
| 208 | Ga0114129_10247158 | 3300009147 | Bacteria | 2396 |
| 209 | Ga0114129_10302722 | 3300009147 | Bacteria | 2130 |
| 210 | Ga0114129_10657669 | 3300009147 | Bacteria | 1352 |
| 211 | Ga0114129_10792452 | 3300009147 | Bacteria | 1210 |
| 212 | Ga0114129_11210104 | 3300009147 | Bacteria | 940 |
| 213 | Ga0105243_10094326 | 3300009148 | Bacteria | 2471 |
| 214 | Ga0105243_10143083 | 3300009148 | Bacteria | 2043 |
| 215 | Ga0105243_10547539 | 3300009148 | Bacteria | 1105 |
| 216 | Ga0105243_10584187 | 3300009148 | Bacteria | 1073 |
| 217 | Ga0105241_10218667 | 3300009174 | Bacteria | 1600 |
| 218 | Ga0105241_10455451 | 3300009174 | Bacteria | 1132 |
| 219 | Ga0105242_10173243 | 3300009176 | Bacteria | 1898 |
| 220 | Ga0105242_10351275 | 3300009176 | Bacteria | 1362 |
| 221 | Ga0105242_10388503 | 3300009176 | Unclassified | 1299 |
| 222 | Ga0105248_10038535 | 3300009177 | Bacteria | 5349 |
| 223 | Ga0105248_10051528 | 3300009177 | Bacteria | 4619 |
| 224 | Ga0105248_10357202 | 3300009177 | Bacteria | 1645 |
| 225 | Ga0105238_10039789 | 3300009551 | Bacteria | 4767 |
| 226 | Ga0105238_10094723 | 3300009551 | Bacteria | 2974 |
| 227 | Ga0105249_10025302 | 3300009553 | Bacteria | 5342 |
| 228 | Ga0105249_11132369 | 3300009553 | Unclassified | 853 |
| 229 | Ga0105249_11137840 | 3300009553 | Bacteria | 851 |
| 230 | Ga0105239_10020840 | 3300010375 | Bacteria | 7232 |
| 231 | Ga0105246_10012177 | 3300011119 | Bacteria | 5359 |
| 232 | Ga0105246_10130692 | 3300011119 | Bacteria | 1875 |
| 233 | Ga0157373_10019614 | 3300013100 | Bacteria | 4918 |
| 234 | Ga0157370_10791486 | 3300013104 | Unclassified | 863 |
| 235 | Ga0157378_10006769 | 3300013297 | Bacteria | 10014 |
| 236 | Ga0157378_10010539 | 3300013297 | Bacteria | 8077 |
| 237 | Ga0163162_10021845 | 3300013306 | Bacteria | 6304 |
| 238 | Ga0163162_10056855 | 3300013306 | Bacteria | 3940 |
| 239 | Ga0163162_10113990 | 3300013306 | Bacteria | 2802 |
| 240 | Ga0157372_10346283 | 3300013307 | Bacteria | 1731 |
| 241 | Ga0157375_10057570 | 3300013308 | Bacteria | 3843 |
| 242 | Ga0157375_10119828 | 3300013308 | Bacteria | 2739 |
| 243 | Ga0157375_10483841 | 3300013308 | Bacteria | 1403 |
| 244 | Ga0157375_11395635 | 3300013308 | Bacteria | 825 |
| 245 | Ga0163163_10043571 | 3300014325 | Bacteria | 4400 |
| 246 | Ga0163163_10112756 | 3300014325 | Bacteria | 2749 |
| 247 | Ga0157380_10007797 | 3300014326 | Bacteria | 7618 |
| 248 | Ga0157380_10010846 | 3300014326 | Bacteria | 6570 |
| 249 | Ga0157380_10258555 | 3300014326 | Bacteria | 1580 |
| 250 | Ga0157380_10509897 | 3300014326 | Unclassified | 1170 |
| 251 | Ga0157377_10010852 | 3300014745 | Bacteria | 4524 |
| 252 | Ga0157377_10017096 | 3300014745 | Bacteria | 3746 |
| 253 | Ga0157377_10101868 | 3300014745 | Bacteria | 1712 |
| 254 | Ga0157377_10157863 | 3300014745 | Bacteria | 1408 |
| 255 | Ga0157379_10053964 | 3300014968 | Bacteria | 3591 |
| 256 | Ga0157376_10096440 | 3300014969 | Bacteria | 2574 |
| 257 | Ga0157376_10724084 | 3300014969 | Bacteria | 1002 |
| 258 | Ga0213875_10010188 | 3300021388 | Bacteria | 4721 |
| 259 | Ga0213875_10081824 | 3300021388 | Bacteria | 1507 |
| 260 | Ga0213875_10089555 | 3300021388 | Bacteria | 1435 |
| 261 | Ga0207697_10000701 | 3300025315 | Bacteria | 19066 |
| 262 | Ga0207682_10000378 | 3300025893 | Bacteria | 20628 |
| 263 | Ga0207682_10006209 | 3300025893 | Bacteria | 4828 |
| 264 | Ga0207682_10108087 | 3300025893 | Bacteria | 1222 |
| 265 | Ga0207692_10354613 | 3300025898 | Bacteria | 905 |
| 266 | Ga0207688_10000628 | 3300025901 | Bacteria | 17382 |
| 267 | Ga0207688_10064495 | 3300025901 | Bacteria | 2069 |
| 268 | Ga0207688_10092509 | 3300025901 | Bacteria | 1738 |
| 269 | Ga0207680_10117032 | 3300025903 | Bacteria | 1738 |
| 270 | Ga0207645_10001911 | 3300025907 | Bacteria | 16819 |
| 271 | Ga0207645_10110203 | 3300025907 | Bacteria | 1781 |
| 272 | Ga0207643_10000925 | 3300025908 | Bacteria | 17575 |
| 273 | Ga0207643_10010788 | 3300025908 | Bacteria | 4927 |
| 274 | Ga0207707_10553279 | 3300025912 | Unclassified | 977 |
| 275 | Ga0207695_10371589 | 3300025913 | Bacteria | 1316 |
| 276 | Ga0207660_10083025 | 3300025917 | Bacteria | 2358 |
| 277 | Ga0207662_10058324 | 3300025918 | Bacteria | 2311 |
| 278 | Ga0207657_10583565 | 3300025919 | Bacteria | 873 |
| 279 | Ga0207649_10060738 | 3300025920 | Bacteria | 2376 |
| 280 | Ga0207649_10558307 | 3300025920 | Unclassified | 877 |
| 281 | Ga0207646_10201736 | 3300025922 | Bacteria | 1797 |
| 282 | Ga0207646_10267344 | 3300025922 | Bacteria | 1546 |
| 283 | Ga0207646_10275793 | 3300025922 | Bacteria | 1520 |
| 284 | Ga0207681_10125365 | 3300025923 | Bacteria | 1890 |
| 285 | Ga0207681_10496619 | 3300025923 | Bacteria | 998 |
| 286 | Ga0207694_10061145 | 3300025924 | Bacteria | 2931 |
| 287 | Ga0207694_10200947 | 3300025924 | Bacteria | 1621 |
| 288 | Ga0207650_10006335 | 3300025925 | Bacteria | 8065 |
| 289 | Ga0207659_10004292 | 3300025926 | Bacteria | 8618 |
| 290 | Ga0207659_10012850 | 3300025926 | Bacteria | 5346 |
| 291 | Ga0207659_10024302 | 3300025926 | Bacteria | 4058 |
| 292 | Ga0207659_10034223 | 3300025926 | Bacteria | 3501 |
| 293 | Ga0207687_10043361 | 3300025927 | Bacteria | 3099 |
| 294 | Ga0207687_10133765 | 3300025927 | Bacteria | 1873 |
| 295 | Ga0207700_10698984 | 3300025928 | Bacteria | 905 |
| 296 | Ga0207664_10018238 | 3300025929 | Bacteria | 5160 |
| 297 | Ga0207664_10038395 | 3300025929 | Bacteria | 3713 |
| 298 | Ga0207664_10532492 | 3300025929 | Bacteria | 1053 |
| 299 | Ga0207690_10174801 | 3300025932 | Bacteria | 1612 |
| 300 | Ga0207690_10178091 | 3300025932 | Bacteria | 1598 |
| 301 | Ga0207706_10041238 | 3300025933 | Bacteria | 4092 |
| 302 | Ga0207706_10042421 | 3300025933 | Bacteria | 4032 |
| 303 | Ga0207706_10298736 | 3300025933 | Bacteria | 1403 |
| 304 | Ga0207706_10837028 | 3300025933 | Unclassified | 780 |
| 305 | Ga0207686_10086326 | 3300025934 | Bacteria | 2061 |
| 306 | Ga0207686_10412108 | 3300025934 | Bacteria | 1032 |
| 307 | Ga0207709_10329660 | 3300025935 | Bacteria | 1145 |
| 308 | Ga0207670_10071424 | 3300025936 | Bacteria | 2401 |
| 309 | Ga0207670_10102224 | 3300025936 | Bacteria | 2049 |
| 310 | Ga0207670_10454502 | 3300025936 | Bacteria | 1033 |
| 311 | Ga0207669_10000517 | 3300025937 | Bacteria | 16886 |
| 312 | Ga0207704_10067906 | 3300025938 | Bacteria | 2245 |
| 313 | Ga0207704_10171661 | 3300025938 | Bacteria | 1556 |
| 314 | Ga0207691_10005381 | 3300025940 | Bacteria | 12358 |
| 315 | Ga0207691_10023122 | 3300025940 | Bacteria | 5853 |
| 316 | Ga0207691_10025557 | 3300025940 | Bacteria | 5542 |
| 317 | Ga0207691_10485310 | 3300025940 | Bacteria | 1050 |
| 318 | Ga0207691_10953006 | 3300025940 | Unclassified | 717 |
| 319 | Ga0207689_10001594 | 3300025942 | Bacteria | 21468 |
| 320 | Ga0207689_10014043 | 3300025942 | Bacteria | 6816 |
| 321 | Ga0207689_10066220 | 3300025942 | Bacteria | 2971 |
| 322 | Ga0207689_10073568 | 3300025942 | Bacteria | 2807 |
| 323 | Ga0207661_10639358 | 3300025944 | Bacteria | 978 |
| 324 | Ga0207679_10030495 | 3300025945 | Bacteria | 3766 |
| 325 | Ga0207679_10030688 | 3300025945 | Bacteria | 3755 |
| 326 | Ga0207679_10593989 | 3300025945 | Bacteria | 997 |
| 327 | Ga0207667_10083019 | 3300025949 | Bacteria | 3318 |
| 328 | Ga0207651_10038468 | 3300025960 | Bacteria | 3145 |
| 329 | Ga0207651_10287766 | 3300025960 | Bacteria | 1361 |
| 330 | Ga0207712_10020945 | 3300025961 | Bacteria | 4289 |
| 331 | Ga0207668_10026763 | 3300025972 | Bacteria | 3750 |
| 332 | Ga0207668_10289143 | 3300025972 | Bacteria | 1348 |
| 333 | Ga0207668_10573722 | 3300025972 | Bacteria | 980 |
| 334 | Ga0207658_10068874 | 3300025986 | Bacteria | 2672 |
| 335 | Ga0207677_10368247 | 3300026023 | Bacteria | 1209 |
| 336 | Ga0207703_10415509 | 3300026035 | Unclassified | 1251 |
| 337 | Ga0207703_11126334 | 3300026035 | Bacteria | 754 |
| 338 | Ga0207708_10008381 | 3300026075 | Bacteria | 7651 |
| 339 | Ga0207708_10022355 | 3300026075 | Bacteria | 4776 |
| 340 | Ga0207708_10198880 | 3300026075 | Bacteria | 1598 |
| 341 | Ga0207708_10331459 | 3300026075 | Bacteria | 1244 |
| 342 | Ga0207702_10066986 | 3300026078 | Bacteria | 3080 |
| 343 | Ga0207641_10007161 | 3300026088 | Bacteria | 9311 |
| 344 | Ga0207648_10005974 | 3300026089 | Bacteria | 12169 |
| 345 | Ga0207648_10066022 | 3300026089 | Bacteria | 3155 |
| 346 | Ga0207648_10110545 | 3300026089 | Bacteria | 2412 |
| 347 | Ga0207648_10120681 | 3300026089 | Bacteria | 2305 |
| 348 | Ga0207676_10024241 | 3300026095 | Bacteria | 4487 |
| 349 | Ga0207676_10456637 | 3300026095 | Bacteria | 1205 |
| 350 | Ga0207674_10091188 | 3300026116 | Bacteria | 3038 |
| 351 | Ga0207674_10158407 | 3300026116 | Bacteria | 2219 |
| 352 | Ga0207675_100012877 | 3300026118 | Bacteria | 7814 |
| 353 | Ga0207675_100049984 | 3300026118 | Bacteria | 3902 |
| 354 | Ga0207675_100207046 | 3300026118 | Bacteria | 1885 |
| 355 | Ga0207675_100263578 | 3300026118 | Bacteria | 1671 |
| 356 | Ga0207683_10018406 | 3300026121 | Bacteria | 5961 |
| 357 | Ga0207683_10521239 | 3300026121 | Bacteria | 1098 |
| 358 | Ga0207683_10744142 | 3300026121 | Unclassified | 909 |
| 359 | Ga0207698_10185000 | 3300026142 | Bacteria | 1849 |
| 360 | Ga0207698_10433619 | 3300026142 | Bacteria | 1264 |
| 361 | Ga0209282_1000066 | 3300027666 | Bacteria | 87072 |
| 362 | Ga0207428_10001370 | 3300027907 | Bacteria | 25833 |
| 363 | Ga0207428_10001377 | 3300027907 | Bacteria | 25761 |
| 364 | Ga0207428_10003546 | 3300027907 | Bacteria | 15078 |
| 365 | Ga0207428_10304272 | 3300027907 | Bacteria | 1179 |
| 366 | Ga0268265_10023143 | 3300028380 | Bacteria | 4376 |
| 367 | Ga0268265_10299680 | 3300028380 | Bacteria | 1447 |
| 368 | Ga0268265_10833005 | 3300028380 | Bacteria | 901 |
| 369 | Ga0268264_10009037 | 3300028381 | Bacteria | 8267 |
| 370 | Ga0268264_10950229 | 3300028381 | Bacteria | 865 |
| 371 | Ga0316182_1155512 | 3300030745 | Bacteria | 2754 |
| 372 | Ga0316182_1171651 | 3300030745 | Bacteria | 2684 |
| 373 | Ga0307513_10010905 | 3300031456 | Bacteria | 11350 |
| 374 | Ga0307408_100052597 | 3300031548 | Bacteria | 2938 |
| 375 | Ga0307408_100054766 | 3300031548 | Bacteria | 2885 |
| 376 | Ga0307408_100111987 | 3300031548 | Bacteria | 2098 |
| 377 | Ga0307408_100115010 | 3300031548 | Bacteria | 2074 |
| 378 | Ga0307408_100197185 | 3300031548 | Bacteria | 1627 |
| 379 | Ga0316575_10047892 | 3300031665 | Bacteria | 1699 |
| 380 | Ga0316575_10080144 | 3300031665 | Bacteria | 1317 |
| 381 | Ga0316579_10039683 | 3300031691 | Bacteria | 2182 |
| 382 | Ga0265314_10001478 | 3300031711 | Bacteria | 26143 |
| 383 | Ga0316576_10119634 | 3300031727 | Bacteria | 1977 |
| 384 | Ga0316578_10009462 | 3300031728 | Bacteria | 5016 |
| 385 | Ga0316578_10478552 | 3300031728 | Bacteria | 735 |
| 386 | Ga0316577_10006149 | 3300031733 | Bacteria | 6327 |
| 387 | Ga0316577_10014824 | 3300031733 | Bacteria | 4285 |
| 388 | Ga0316577_10055102 | 3300031733 | Bacteria | 2219 |
| 389 | Ga0316577_10092918 | 3300031733 | Bacteria | 1689 |
| 390 | Ga0316577_10115741 | 3300031733 | Bacteria | 1505 |
| 391 | Ga0316577_10381695 | 3300031733 | Bacteria | 800 |
| 392 | Ga0307413_10383889 | 3300031824 | Bacteria | 1095 |
| 393 | Ga0307413_10620748 | 3300031824 | Bacteria | 887 |
| 394 | Ga0307410_10007671 | 3300031852 | Bacteria | 5922 |
| 395 | Ga0307410_10041277 | 3300031852 | Bacteria | 3042 |
| 396 | Ga0307410_10115491 | 3300031852 | Bacteria | 1949 |
| 397 | Ga0307410_10525049 | 3300031852 | Bacteria | 977 |
| 398 | Ga0307406_10108406 | 3300031901 | Bacteria | 1907 |
| 399 | Ga0307406_10142006 | 3300031901 | Bacteria | 1701 |
| 400 | Ga0307407_10043843 | 3300031903 | Bacteria | 2517 |
| 401 | Ga0307412_10096525 | 3300031911 | Bacteria | 2081 |
| 402 | Ga0307412_10098464 | 3300031911 | Unclassified | 2063 |
| 403 | Ga0307409_100016937 | 3300031995 | Bacteria | 4841 |
| 404 | Ga0307416_100029545 | 3300032002 | Bacteria | 4097 |
| 405 | Ga0307416_100117086 | 3300032002 | Bacteria | 2364 |
| 406 | Ga0307416_100752467 | 3300032002 | Bacteria | 1067 |
| 407 | Ga0307414_10397949 | 3300032004 | Bacteria | 1195 |
| 408 | Ga0307411_10027803 | 3300032005 | Bacteria | 3429 |
| 409 | Ga0307411_10041838 | 3300032005 | Bacteria | 2919 |
| 410 | Ga0307411_10043240 | 3300032005 | Bacteria | 2881 |
| 411 | Ga0307415_100023986 | 3300032126 | Bacteria | 3800 |
| 412 | Ga0307415_101005694 | 3300032126 | Bacteria | 775 |
| 413 | Ga0316585_10057566 | 3300032137 | Bacteria | 1252 |
| 414 | Ga0316585_10080425 | 3300032137 | Bacteria | 1061 |
| 415 | Ga0373940_0005259 | 3300035088 | Bacteria | 2792 |
| 416 | Ga0373944_0126183 | 3300035089 | Bacteria | 886 |
| 417 | Ga0373945_0067394 | 3300035116 | Bacteria | 1348 |
| 418 | Ga0373946_0311730 | 3300035171 | Bacteria | 780 |
| 419 | Ga0373942_0044532 | 3300035207 | Bacteria | 1223 |
| 420 | Ga0373931_0024741 | 3300035691 | Bacteria | 3045 |
| 421 | Ga0373927_0000877 | 3300035695 | Bacteria | 22917 |
| 422 | Ga0373927_0516174 | 3300035695 | Archaea | 790 |
| 423 | Ga0316582_0020285 | 3300036647 | Bacteria | 3905 |
| 424 | Ga0316582_0053666 | 3300036647 | Bacteria | 2564 |
| 425 | Ga0316582_0060279 | 3300036647 | Bacteria | 2432 |
| 426 | Ga0316584_0001965 | 3300036712 | Bacteria | 12831 |
| 427 | Ga0316584_0011979 | 3300036712 | Bacteria | 6109 |
| 428 | Ga0316584_0650675 | 3300036712 | Bacteria | 726 |
| 429 | Ga0373925_0000619 | 3300037068 | Bacteria | 33906 |
| 430 | Ga0373925_0267422 | 3300037068 | Bacteria | 1375 |
| 431 | Ga0395900_0109043 | 3300037418 | Bacteria | 2844 |
| 432 | Ga0395900_0386577 | 3300037418 | Bacteria | 1366 |
| 433 | Ga0395905_0001509 | 3300037471 | Bacteria | 27821 |
| 434 | Ga0316581_0002269 | 3300037588 | Bacteria | 4556 |
| 435 | Ga0316581_0015740 | 3300037588 | Bacteria | 2165 |
| 436 | Ga0436364_0183835 | 3300037853 | Bacteria | 1037 |
| 437 | Ga0436364_0334136 | 3300037853 | Bacteria | 2801 |
| 438 | Ga0436364_1193035 | 3300037853 | Bacteria | 6898 |
| 439 | Ga0400490_56435 | 3300038726 | Bacteria | 4635 |
| 440 | Ga0400489_73490 | 3300039093 | Bacteria | 42457 |
| 441 | Ga0400489_76266 | 3300039093 | Bacteria | 1161 |
| 442 | Ga0436365_0055431 | 3300039437 | Bacteria | 809 |
| 443 | Ga0436365_0461265 | 3300039437 | Bacteria | 3511 |
| 444 | Ga0436363_0394035 | 3300039450 | Unclassified | 1460 |
| 445 | Ga0439450_020510 | 3300042008 | Bacteria | 1411 |
| 446 | Ga0439462_0069144 | 3300042015 | Unclassified | 958 |
| 447 | Ga0439435_0032586 | 3300042436 | Bacteria | 1422 |
| 448 | Ga0451577_0005780 | 3300042876 | Bacteria | 12536 |
| 449 | Ga0466969_0296577 | 3300044656 | Unclassified | 732 |
| 450 | Ga0466972_0068060 | 3300044658 | Bacteria | 1701 |
| 451 | Ga0453683_0000751 | 3300044673 | Bacteria | 32744 |
| 452 | Ga0453683_0000845 | 3300044673 | Bacteria | 29598 |
| 453 | Ga0453683_0019144 | 3300044673 | Bacteria | 4385 |
| 454 | Ga0453683_0019430 | 3300044673 | Bacteria | 4351 |
| 455 | Ga0466965_0106623 | 3300044683 | Bacteria | 1437 |
| 456 | Ga0466966_0073122 | 3300044684 | Bacteria | 2145 |
| 457 | Ga0466966_0101704 | 3300044684 | Bacteria | 1777 |
| 458 | Ga0453684_0000044 | 3300044712 | Bacteria | 585643 |
| 459 | Ga0453684_0006346 | 3300044712 | Bacteria | 22552 |
| 460 | Ga0453684_0023147 | 3300044712 | Bacteria | 9170 |
| 461 | Ga0453684_0027034 | 3300044712 | Bacteria | 8252 |
| 462 | Ga0453684_0035665 | 3300044712 | Bacteria | 6871 |
| 463 | Ga0453684_0042935 | 3300044712 | Bacteria | 6086 |
| 464 | Ga0453684_0044547 | 3300044712 | Bacteria | 5934 |
| 465 | Ga0453684_0054823 | 3300044712 | Bacteria | 5188 |
| 466 | Ga0453684_0058878 | 3300044712 | Bacteria | 4958 |
| 467 | Ga0453684_0105276 | 3300044712 | Bacteria | 3441 |
| 468 | Ga0453684_0106869 | 3300044712 | Bacteria | 3409 |
| 469 | Ga0453684_0162323 | 3300044712 | Unclassified | 2642 |
| 470 | Ga0453684_0173439 | 3300044712 | Bacteria | 2539 |
| 471 | Ga0453684_0230488 | 3300044712 | Bacteria | 2138 |
| 472 | Ga0453684_0323615 | 3300044712 | Bacteria | 1745 |
| 473 | Ga0453684_0331656 | 3300044712 | Unclassified | 1720 |
| 474 | Ga0453684_0381510 | 3300044712 | Unclassified | 1582 |
| 475 | Ga0453684_0656887 | 3300044712 | Bacteria | 1144 |
| 476 | Ga0453684_0685478 | 3300044712 | Bacteria | 1115 |
| 477 | Ga0453684_0760972 | 3300044712 | Bacteria | 1048 |
| 478 | Ga0453684_1007825 | 3300044712 | Unclassified | 885 |
| 479 | Ga0453684_1067445 | 3300044712 | Unclassified | 855 |
| 480 | Ga0466970_0022802 | 3300044765 | Bacteria | 3267 |
| 481 | Ga0466959_0003996 | 3300045049 | Bacteria | 9801 |
| 482 | Ga0466959_0025843 | 3300045049 | Bacteria | 4354 |
| 483 | Ga0466959_0351463 | 3300045049 | Bacteria | 1005 |
| 484 | Ga0451576_0009324 | 3300045051 | Bacteria | 11396 |
| 485 | Ga0451576_0024922 | 3300045051 | Bacteria | 6455 |
| 486 | Ga0451576_0048913 | 3300045051 | Bacteria | 4438 |
| 487 | Ga0451576_0076393 | 3300045051 | Unclassified | 3485 |
| 488 | Ga0451576_0171716 | 3300045051 | Bacteria | 2263 |
| 489 | Ga0451576_0212808 | 3300045051 | Bacteria | 2018 |
| 490 | Ga0451576_0415085 | 3300045051 | Bacteria | 1412 |
| 491 | Ga0451576_0483280 | 3300045051 | Bacteria | 1301 |
| 492 | Ga0451576_0501266 | 3300045051 | Bacteria | 1275 |
| 493 | Ga0451576_0649266 | 3300045051 | Unclassified | 1109 |
| 494 | Ga0466958_0008664 | 3300045836 | Bacteria | 5648 |
| 495 | Ga0466958_0036525 | 3300045836 | Bacteria | 2941 |
| 496 | Ga0466967_0044879 | 3300045976 | Bacteria | 3837 |
| 497 | Ga0466967_0403018 | 3300045976 | Bacteria | 1331 |
| 498 | Ga0495603_0059674 | 3300046455 | Bacteria | 2255 |
| 499 | Ga0495603_0117581 | 3300046455 | Bacteria | 1550 |
| 500 | Ga0495603_0164153 | 3300046455 | Bacteria | 1288 |
| 501 | Ga0495629_0002871 | 3300046459 | Bacteria | 13168 |
| 502 | Ga0495580_0000641 | 3300046472 | Bacteria | 29670 |
| 503 | Ga0495580_0013676 | 3300046472 | Bacteria | 6184 |
| 504 | Ga0495582_0092109 | 3300046473 | Bacteria | 1691 |
| 505 | Ga0495605_0000498 | 3300046474 | Bacteria | 33768 |
| 506 | Ga0495605_0033767 | 3300046474 | Bacteria | 2595 |
| 507 | Ga0495639_0152379 | 3300046475 | Bacteria | 1116 |
| 508 | Ga0495639_0240730 | 3300046475 | Bacteria | 893 |
| 509 | Ga0495662_0148668 | 3300046476 | Bacteria | 1154 |
| 510 | Ga0495584_0000037 | 3300046491 | Bacteria | 93892 |
| 511 | Ga0495584_0025348 | 3300046491 | Bacteria | 3006 |
| 512 | Ga0495584_0073883 | 3300046491 | Bacteria | 1713 |
| 513 | Ga0495594_0004891 | 3300046499 | Bacteria | 6897 |
| 514 | Ga0495594_0089263 | 3300046499 | Bacteria | 1726 |
| 515 | Ga0495596_0091050 | 3300046500 | Bacteria | 1184 |
| 516 | Ga0495607_0000961 | 3300046501 | Bacteria | 26647 |
| 517 | Ga0495607_0043698 | 3300046501 | Bacteria | 2647 |
| 518 | Ga0495606_0031701 | 3300046507 | Bacteria | 3671 |
| 519 | Ga0495606_0124092 | 3300046507 | Bacteria | 1542 |
| 520 | Ga0495616_0095550 | 3300046513 | Bacteria | 1400 |
| 521 | Ga0495643_0004358 | 3300046522 | Bacteria | 9925 |
| 522 | Ga0495643_0005453 | 3300046522 | Bacteria | 8602 |
| 523 | Ga0495643_0058556 | 3300046522 | Bacteria | 2050 |
| 524 | Ga0495644_0262574 | 3300046523 | Bacteria | 672 |
| 525 | Ga0495648_0003051 | 3300046524 | Bacteria | 14986 |
| 526 | Ga0495648_0050064 | 3300046524 | Bacteria | 2556 |
| 527 | Ga0495642_0013883 | 3300046528 | Bacteria | 3119 |
| 528 | Ga0495642_0070881 | 3300046528 | Bacteria | 1457 |
| 529 | Ga0495654_0008763 | 3300046530 | Bacteria | 5567 |
| 530 | Ga0495598_0028879 | 3300046537 | Bacteria | 1541 |
| 531 | Ga0495598_0077173 | 3300046537 | Bacteria | 1061 |
| 532 | Ga0495598_0188512 | 3300046537 | Bacteria | 739 |
| 533 | Ga0495609_0006777 | 3300046538 | Bacteria | 5799 |
| 534 | Ga0495609_0043757 | 3300046538 | Bacteria | 2010 |
| 535 | Ga0495621_0005334 | 3300046539 | Bacteria | 3685 |
| 536 | Ga0495621_0020422 | 3300046539 | Bacteria | 2174 |
| 537 | Ga0495645_0343761 | 3300046543 | Bacteria | 963 |
| 538 | Ga0495668_0007671 | 3300046616 | Bacteria | 6865 |
| 539 | Ga0495659_0036011 | 3300046664 | Bacteria | 1746 |
| 540 | Ga0495661_0001505 | 3300046665 | Bacteria | 19415 |
| 541 | Ga0495661_0005604 | 3300046665 | Bacteria | 8905 |
| 542 | Ga0495661_0008756 | 3300046665 | Bacteria | 6983 |
| 543 | Ga0495588_0030217 | 3300046674 | Bacteria | 2722 |
| 544 | Ga0495658_0036949 | 3300046683 | Bacteria | 2698 |
| 545 | Ga0495669_0002671 | 3300046684 | Bacteria | 7300 |
| 546 | Ga0495669_0091290 | 3300046684 | Bacteria | 1406 |
| 547 | Ga0495669_0111569 | 3300046684 | Bacteria | 1277 |
| 548 | Ga0495670_0210218 | 3300046691 | Bacteria | 1032 |
| 549 | Ga0495649_0001229 | 3300046694 | Bacteria | 19728 |
| 550 | Ga0495649_0027410 | 3300046694 | Bacteria | 3162 |
| 551 | Ga0495649_0354164 | 3300046694 | Bacteria | 741 |
| 552 | Ga0495589_0001577 | 3300046794 | Bacteria | 13107 |
| 553 | Ga0495589_0002196 | 3300046794 | Bacteria | 10981 |
| 554 | Ga0495589_0105626 | 3300046794 | Bacteria | 1361 |
| 555 | Ga0495660_0000033 | 3300046810 | Bacteria | 212425 |
| 556 | Ga0495660_0014126 | 3300046810 | Bacteria | 4624 |
| 557 | Ga0495581_0500994 | 3300047315 | Unclassified | 706 |
| 558 | Ga0495604_0111911 | 3300047317 | Bacteria | 1990 |
| 559 | Ga0495674_0492619 | 3300047319 | Bacteria | 981 |
| 560 | Ga0495672_0001901 | 3300047320 | Bacteria | 19859 |
| 561 | Ga0495672_0002129 | 3300047320 | Bacteria | 18558 |
| 562 | Ga0495672_0073834 | 3300047320 | Bacteria | 1922 |
| 563 | Ga0495676_0017131 | 3300047321 | Bacteria | 6412 |
| 564 | Ga0495683_0004048 | 3300047323 | Bacteria | 8411 |
| 565 | Ga0495683_0006783 | 3300047323 | Bacteria | 6225 |
| 566 | Ga0495687_000344 | 3300047443 | Bacteria | 59580 |
| 567 | Ga0495677_0002111 | 3300047445 | Bacteria | 7883 |
| 568 | Ga0495677_0032453 | 3300047445 | Bacteria | 1902 |
| 569 | Ga0495685_031336 | 3300047447 | Bacteria | 1828 |
| 570 | Ga0495626_0000160 | 3300048091 | Bacteria | 83120 |
| 571 | Ga0496101_0363508 | 3300048904 | Bacteria | 1138 |
| 572 | Ga0496108_0264391 | 3300048911 | Bacteria | 1497 |
| 573 | Ga0496109_0350357 | 3300048912 | Bacteria | 1395 |
| 574 | Ga0496109_0615328 | 3300048912 | Bacteria | 1023 |
| 575 | Ga0496110_0339636 | 3300048913 | Bacteria | 1368 |
| 576 | Ga0496110_0549034 | 3300048913 | Bacteria | 1050 |
| 577 | Ga0496111_0259682 | 3300048914 | Bacteria | 1289 |
| 578 | Ga0496116_0001420 | 3300048919 | Bacteria | 26933 |
| 579 | Ga0496122_0045465 | 3300048925 | Bacteria | 3412 |
| 580 | Ga0496122_0082972 | 3300048925 | Bacteria | 2224 |
| 581 | Ga0496123_0002004 | 3300048926 | Bacteria | 26310 |
| 582 | Ga0496123_0003975 | 3300048926 | Bacteria | 16012 |
| 583 | Ga0496124_0104882 | 3300048927 | Bacteria | 2285 |
| 584 | Ga0496124_0315035 | 3300048927 | Bacteria | 1123 |
| 585 | Ga0496125_0000807 | 3300048928 | Bacteria | 50911 |
| 586 | Ga0496126_0002667 | 3300048929 | Bacteria | 23631 |
| 587 | Ga0501036_0123288 | 3300049572 | Bacteria | 2189 |
| 588 | Ga0501036_0594649 | 3300049572 | Bacteria | 918 |
| 589 | Ga0501046_0360902 | 3300049580 | Unclassified | 1054 |
| 590 | Ga0501048_0119875 | 3300049582 | Bacteria | 1859 |
| 591 | Ga0501071_0269908 | 3300049587 | Unclassified | 1286 |
| 592 | Ga0501072_0987788 | 3300049588 | Unclassified | 656 |
| 593 | Ga0501074_0369458 | 3300049590 | Unclassified | 1018 |
| 594 | Ga0501075_0066467 | 3300049591 | Bacteria | 2721 |
| 595 | Ga0501075_0105020 | 3300049591 | Unclassified | 2147 |
| 596 | Ga0501075_0392314 | 3300049591 | Bacteria | 1058 |
| 597 | Ga0501076_0319150 | 3300049592 | Unclassified | 1274 |
| 598 | Ga0501045_0101486 | 3300049824 | Unclassified | 2130 |
| 599 | nmdc:mga0k408_14188_c2 | 3300050493 | Unclassified | 3886 |
| 600 | nmdc:mga05p37_119351_c1 | 3300050507 | Bacteria | 3240 |
| 601 | nmdc:mga05p37_241_c1 | 3300050507 | Bacteria | 55841 |
| 602 | nmdc:mga05p37_273235_c1 | 3300050507 | Bacteria | 2018 |
| 603 | nmdc:mga05p37_7132_c1 | 3300050507 | Bacteria | 13178 |
| 604 | nmdc:mga05p37_724645_c1 | 3300050507 | Bacteria | 1101 |
| 605 | nmdc:mga05p37_99269_c1 | 3300050507 | Bacteria | 3586 |
| 606 | nmdc:mga09592_10011_c1 | 3300050508 | Bacteria | 7710 |
| 607 | nmdc:mga09592_10619_c1 | 3300050508 | Bacteria | 7499 |
| 608 | nmdc:mga09592_168895_c1 | 3300050508 | Bacteria | 1891 |
| 609 | nmdc:mga09592_27132_c1 | 3300050508 | Bacteria | 4751 |
| 610 | nmdc:mga09592_45514_c1 | 3300050508 | Bacteria | 3696 |
| 611 | nmdc:mga09592_50982_c1 | 3300050508 | Bacteria | 3491 |
| 612 | nmdc:mga09592_615488_c1 | 3300050508 | Bacteria | 929 |
| 613 | nmdc:mga09592_69779_c1 | 3300050508 | Bacteria | 2981 |
| 614 | nmdc:mga0qj67_31529_c1 | 3300050509 | Bacteria | 4129 |
| 615 | nmdc:mga0qj67_60595_c1 | 3300050509 | Bacteria | 3004 |
| 616 | nmdc:mga0qj67_898_c1 | 3300050509 | Bacteria | 20435 |
| 617 | nmdc:mga06r32_123159_c1 | 3300050510 | Bacteria | 2559 |
| 618 | nmdc:mga06r32_336659_c1 | 3300050510 | Bacteria | 1494 |
| 619 | nmdc:mga06r32_4916_c1 | 3300050510 | Bacteria | 12037 |
| 620 | nmdc:mga06r32_705086_c1 | 3300050510 | Bacteria | 975 |
| 621 | nmdc:mga06r32_7152_c1 | 3300050510 | Bacteria | 10057 |
| 622 | nmdc:mga08y16_142240_c1 | 3300050511 | Bacteria | 2494 |
| 623 | nmdc:mga08y16_196413_c1 | 3300050511 | Bacteria | 2091 |
| 624 | nmdc:mga08y16_2371_c1 | 3300050511 | Bacteria | 14345 |
| 625 | nmdc:mga08y16_333519_c1 | 3300050511 | Bacteria | 1560 |
| 626 | nmdc:mga08y16_52853_c1 | 3300050511 | Bacteria | 4249 |
| 627 | nmdc:mga08y16_743_c1 | 3300050511 | Bacteria | 31040 |
| 628 | nmdc:mga0n895_105523_c1 | 3300050512 | Bacteria | 2830 |
| 629 | nmdc:mga0n895_31629_c1 | 3300050512 | Bacteria | 5069 |
| 630 | nmdc:mga0n895_363130_c1 | 3300050512 | Bacteria | 1466 |
| 631 | nmdc:mga0n895_77249_c1 | 3300050512 | Bacteria | 3312 |
| 632 | nmdc:mga0n895_83538_c1 | 3300050512 | Bacteria | 3186 |
| 633 | nmdc:mga0n895_90797_c1 | 3300050512 | Bacteria | 3057 |
| 634 | nmdc:mga0rr50_608263_c1 | 3300050513 | Unclassified | 932 |
| 635 | nmdc:mga0a205_139050_c1 | 3300050515 | Bacteria | 2329 |
| 636 | nmdc:mga0a205_233846_c1 | 3300050515 | Bacteria | 1720 |
| 637 | nmdc:mga0a205_2928_c1 | 3300050515 | Bacteria | 15120 |
| 638 | nmdc:mga0a205_5356_c1 | 3300050515 | Bacteria | 11561 |
| 639 | nmdc:mga0a205_61143_c1 | 3300050515 | Bacteria | 3638 |
| 640 | nmdc:mga0a205_72610_c1 | 3300050515 | Bacteria | 3325 |
| 641 | Ga0495601_0459638 | 3300053077 | Bacteria | 823 |
| 642 | Ga0501084_0296031 | 3300054114 | Bacteria | 1367 |
| 643 | Ga0590077_008463 | 3300059426 | Bacteria | 2107 |
| 644 | Ga0501082_0039026 | 3300060353 | Bacteria | 4096 |
| 645 | Ga0466962_0018348 | 3300061719 | Bacteria | 3366 |
| 646 | Ga0530510_0659933 | 3300061734 | Bacteria | 796 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042015 | Ga0439462_0069144 | Ga0439462_0069144_365_931 | 186 |
| 2 | 3300044684 | Ga0466966_0101704 | Ga0466966_0101704_17_586 | 186 |
| 3 | 3300046500 | Ga0495596_0091050 | Ga0495596_0091050_601_1170 | 186 |
| 4 | 3300048926 | Ga0496123_0003975 | Ga0496123_0003975_1909_2478 | 186 |
| 5 | 3300005840 | Ga0068870_10233041 | Ga0068870_102330412 | 187 |
| 6 | 3300035116 | Ga0373945_0067394 | Ga0373945_0067394_172_783 | 192 |
| 7 | 3300035695 | Ga0373927_0516174 | Ga0373927_0516174_136_747 | 192 |
| 8 | 3300037068 | Ga0373925_0267422 | Ga0373925_0267422_669_1280 | 192 |
| 9 | 3300046475 | Ga0495639_0240730 | Ga0495639_0240730_199_810 | 192 |
| 10 | 3300046499 | Ga0495594_0004891 | Ga0495594_0004891_5330_5974 | 192 |
| 11 | 3300046539 | Ga0495621_0005334 | Ga0495621_0005334_849_1493 | 192 |
| 12 | 3300046674 | Ga0495588_0030217 | Ga0495588_0030217_837_1481 | 192 |
| 13 | 3300005356 | Ga0070674_100172151 | Ga0070674_1001721512 | 193 |
| 14 | 3300006881 | Ga0068865_100044873 | Ga0068865_1000448733 | 193 |
| 15 | 3300013308 | Ga0157375_11395635 | Ga0157375_113956351 | 193 |
| 16 | 3300025938 | Ga0207704_10171661 | Ga0207704_101716612 | 193 |
| 17 | 3300025972 | Ga0207668_10289143 | Ga0207668_102891432 | 193 |
| 18 | 3300045051 | Ga0451576_0415085 | Ga0451576_0415085_544_1140 | 193 |
| 19 | 3300046455 | Ga0495603_0059674 | Ga0495603_0059674_263_886 | 193 |
| 20 | 3300046794 | Ga0495589_0105626 | Ga0495589_0105626_309_902 | 193 |
| 21 | 3300048904 | Ga0496101_0363508 | Ga0496101_0363508_301_897 | 193 |
| 22 | 3300005329 | Ga0070683_100221656 | Ga0070683_1002216563 | 194 |
| 23 | 3300005330 | Ga0070690_100170034 | Ga0070690_1001700342 | 194 |
| 24 | 3300005334 | Ga0068869_100066274 | Ga0068869_1000662743 | 194 |
| 25 | 3300005334 | Ga0068869_100186069 | Ga0068869_1001860692 | 194 |
| 26 | 3300005338 | Ga0068868_100402318 | Ga0068868_1004023181 | 194 |
| 27 | 3300005339 | Ga0070660_100270924 | Ga0070660_1002709242 | 194 |
| 28 | 3300005366 | Ga0070659_100126655 | Ga0070659_1001266552 | 194 |
| 29 | 3300005440 | Ga0070705_100027012 | Ga0070705_1000270122 | 194 |
| 30 | 3300005444 | Ga0070694_100007196 | Ga0070694_1000071961 | 194 |
| 31 | 3300005445 | Ga0070708_100862973 | Ga0070708_1008629731 | 194 |
| 32 | 3300005456 | Ga0070678_100048413 | Ga0070678_1000484134 | 194 |
| 33 | 3300005458 | Ga0070681_10134031 | Ga0070681_101340311 | 194 |
| 34 | 3300005468 | Ga0070707_100753836 | Ga0070707_1007538362 | 194 |
| 35 | 3300005471 | Ga0070698_100062542 | Ga0070698_1000625424 | 194 |
| 36 | 3300005518 | Ga0070699_100010615 | Ga0070699_1000106156 | 194 |
| 37 | 3300005546 | Ga0070696_100058484 | Ga0070696_1000584842 | 194 |
| 38 | 3300005547 | Ga0070693_100052188 | Ga0070693_1000521884 | 194 |
| 39 | 3300005549 | Ga0070704_100003273 | Ga0070704_1000032734 | 194 |
| 40 | 3300005564 | Ga0070664_100117700 | Ga0070664_1001177002 | 194 |
| 41 | 3300005577 | Ga0068857_100120196 | Ga0068857_1001201964 | 194 |
| 42 | 3300005618 | Ga0068864_100372277 | Ga0068864_1003722772 | 194 |
| 43 | 3300005841 | Ga0068863_100351447 | Ga0068863_1003514471 | 194 |
| 44 | 3300005843 | Ga0068860_100030930 | Ga0068860_1000309306 | 194 |
| 45 | 3300006358 | Ga0068871_100096532 | Ga0068871_1000965322 | 194 |
| 46 | 3300006871 | Ga0075434_100080961 | Ga0075434_1000809612 | 194 |
| 47 | 3300009098 | Ga0105245_10002584 | Ga0105245_1000258415 | 194 |
| 48 | 3300009098 | Ga0105245_10496610 | Ga0105245_104966102 | 194 |
| 49 | 3300009147 | Ga0114129_10164109 | Ga0114129_101641093 | 194 |
| 50 | 3300009148 | Ga0105243_10094326 | Ga0105243_100943263 | 194 |
| 51 | 3300009174 | Ga0105241_10218667 | Ga0105241_102186672 | 194 |
| 52 | 3300009174 | Ga0105241_10455451 | Ga0105241_104554512 | 194 |
| 53 | 3300009176 | Ga0105242_10173243 | Ga0105242_101732432 | 194 |
| 54 | 3300009176 | Ga0105242_10351275 | Ga0105242_103512752 | 194 |
| 55 | 3300009176 | Ga0105242_10388503 | Ga0105242_103885031 | 194 |
| 56 | 3300009177 | Ga0105248_10051528 | Ga0105248_100515282 | 194 |
| 57 | 3300009551 | Ga0105238_10039789 | Ga0105238_100397893 | 194 |
| 58 | 3300009551 | Ga0105238_10094723 | Ga0105238_100947234 | 194 |
| 59 | 3300009553 | Ga0105249_11137840 | Ga0105249_111378402 | 194 |
| 60 | 3300010375 | Ga0105239_10020840 | Ga0105239_100208406 | 194 |
| 61 | 3300013297 | Ga0157378_10006769 | Ga0157378_100067694 | 194 |
| 62 | 3300013306 | Ga0163162_10113990 | Ga0163162_101139904 | 194 |
| 63 | 3300013307 | Ga0157372_10346283 | Ga0157372_103462832 | 194 |
| 64 | 3300014325 | Ga0163163_10112756 | Ga0163163_101127562 | 194 |
| 65 | 3300014969 | Ga0157376_10724084 | Ga0157376_107240842 | 194 |
| 66 | 3300025912 | Ga0207707_10553279 | Ga0207707_105532791 | 194 |
| 67 | 3300025913 | Ga0207695_10371589 | Ga0207695_103715892 | 194 |
| 68 | 3300025922 | Ga0207646_10275793 | Ga0207646_102757932 | 194 |
| 69 | 3300025924 | Ga0207694_10061145 | Ga0207694_100611454 | 194 |
| 70 | 3300025924 | Ga0207694_10200947 | Ga0207694_102009472 | 194 |
| 71 | 3300025927 | Ga0207687_10043361 | Ga0207687_100433612 | 194 |
| 72 | 3300025934 | Ga0207686_10086326 | Ga0207686_100863263 | 194 |
| 73 | 3300025938 | Ga0207704_10067906 | Ga0207704_100679063 | 194 |
| 74 | 3300025942 | Ga0207689_10014043 | Ga0207689_100140434 | 194 |
| 75 | 3300025945 | Ga0207679_10030495 | Ga0207679_100304955 | 194 |
| 76 | 3300025949 | Ga0207667_10083019 | Ga0207667_100830194 | 194 |
| 77 | 3300026078 | Ga0207702_10066986 | Ga0207702_100669862 | 194 |
| 78 | 3300026116 | Ga0207674_10158407 | Ga0207674_101584072 | 194 |
| 79 | 3300026142 | Ga0207698_10185000 | Ga0207698_101850002 | 194 |
| 80 | 3300028381 | Ga0268264_10009037 | Ga0268264_100090376 | 194 |
| 81 | 3300028381 | Ga0268264_10950229 | Ga0268264_109502292 | 194 |
| 82 | 3300035089 | Ga0373944_0126183 | Ga0373944_0126183_279_872 | 194 |
| 83 | 3300046455 | Ga0495603_0117581 | Ga0495603_0117581_281_874 | 194 |
| 84 | 3300046475 | Ga0495639_0152379 | Ga0495639_0152379_63_656 | 194 |
| 85 | 3300046476 | Ga0495662_0148668 | Ga0495662_0148668_60_653 | 194 |
| 86 | 3300046684 | Ga0495669_0091290 | Ga0495669_0091290_454_1047 | 194 |
| 87 | 3300050512 | nmdc:mga0n895_77249_c1 | nmdc:mga0n895_77249_c1_939_1568 | 194 |
| 88 | 3300050515 | nmdc:mga0a205_61143_c1 | nmdc:mga0a205_61143_c1_1291_1920 | 194 |
| 89 | 3300005341 | Ga0070691_10063165 | Ga0070691_100631652 | 195 |
| 90 | 3300005364 | Ga0070673_100097452 | Ga0070673_1000974522 | 195 |
| 91 | 3300005440 | Ga0070705_100000746 | Ga0070705_10000074610 | 195 |
| 92 | 3300005441 | Ga0070700_100149346 | Ga0070700_1001493462 | 195 |
| 93 | 3300005444 | Ga0070694_100000370 | Ga0070694_10000037012 | 195 |
| 94 | 3300005545 | Ga0070695_100000707 | Ga0070695_1000007074 | 195 |
| 95 | 3300005546 | Ga0070696_100000965 | Ga0070696_10000096517 | 195 |
| 96 | 3300005615 | Ga0070702_100010489 | Ga0070702_1000104891 | 195 |
| 97 | 3300006847 | Ga0075431_100017673 | Ga0075431_1000176736 | 195 |
| 98 | 3300009094 | Ga0111539_10000967 | Ga0111539_1000096730 | 195 |
| 99 | 3300009147 | Ga0114129_10657669 | Ga0114129_106576692 | 195 |
| 100 | 3300009148 | Ga0105243_10584187 | Ga0105243_105841872 | 195 |
| 101 | 3300021388 | Ga0213875_10010188 | Ga0213875_100101883 | 195 |
| 102 | 3300025933 | Ga0207706_10298736 | Ga0207706_102987361 | 195 |
| 103 | 3300025935 | Ga0207709_10329660 | Ga0207709_103296602 | 195 |
| 104 | 3300026121 | Ga0207683_10744142 | Ga0207683_107441422 | 195 |
| 105 | 3300027907 | Ga0207428_10003546 | Ga0207428_100035465 | 195 |
| 106 | 3300037853 | Ga0436364_1193035 | Ga0436364_1193035_4907_5506 | 195 |
| 107 | 3300039437 | Ga0436365_0461265 | Ga0436365_0461265_2368_2967 | 195 |
| 108 | 3300039450 | Ga0436363_0394035 | Ga0436363_0394035_741_1370 | 195 |
| 109 | 3300046455 | Ga0495603_0164153 | Ga0495603_0164153_99_707 | 195 |
| 110 | 3300046472 | Ga0495580_0013676 | Ga0495580_0013676_5035_5634 | 195 |
| 111 | 3300046537 | Ga0495598_0188512 | Ga0495598_0188512_51_665 | 195 |
| 112 | 3300046539 | Ga0495621_0020422 | Ga0495621_0020422_1215_1829 | 195 |
| 113 | 3300046684 | Ga0495669_0111569 | Ga0495669_0111569_119_784 | 195 |
| 114 | 3300047447 | Ga0495685_031336 | Ga0495685_031336_358_1023 | 195 |
| 115 | 3300050507 | nmdc:mga05p37_273235_c1 | nmdc:mga05p37_273235_c1_673_1314 | 195 |
| 116 | 3300050508 | nmdc:mga09592_10619_c1 | nmdc:mga09592_10619_c1_6813_7427 | 195 |
| 117 | 3300050509 | nmdc:mga0qj67_60595_c1 | nmdc:mga0qj67_60595_c1_1661_2275 | 195 |
| 118 | 3300050510 | nmdc:mga06r32_7152_c1 | nmdc:mga06r32_7152_c1_3340_3954 | 195 |
| 119 | 3300050511 | nmdc:mga08y16_2371_c1 | nmdc:mga08y16_2371_c1_3006_3647 | 195 |
| 120 | 3300002073 | JGI24745J21846_1017595 | JGI24745J21846_10175952 | 196 |
| 121 | 3300005290 | Ga0065712_10088085 | Ga0065712_100880853 | 196 |
| 122 | 3300005293 | Ga0065715_10007118 | Ga0065715_100071182 | 196 |
| 123 | 3300005295 | Ga0065707_10084472 | Ga0065707_100844723 | 196 |
| 124 | 3300005328 | Ga0070676_10063748 | Ga0070676_100637481 | 196 |
| 125 | 3300005330 | Ga0070690_100002748 | Ga0070690_1000027485 | 196 |
| 126 | 3300005331 | Ga0070670_100244692 | Ga0070670_1002446922 | 196 |
| 127 | 3300005331 | Ga0070670_100553201 | Ga0070670_1005532011 | 196 |
| 128 | 3300005333 | Ga0070677_10001462 | Ga0070677_100014625 | 196 |
| 129 | 3300005333 | Ga0070677_10047607 | Ga0070677_100476072 | 196 |
| 130 | 3300005333 | Ga0070677_10057988 | Ga0070677_100579882 | 196 |
| 131 | 3300005334 | Ga0068869_100042368 | Ga0068869_1000423684 | 196 |
| 132 | 3300005334 | Ga0068869_100170023 | Ga0068869_1001700233 | 196 |
| 133 | 3300005335 | Ga0070666_10015997 | Ga0070666_100159973 | 196 |
| 134 | 3300005335 | Ga0070666_10024914 | Ga0070666_100249143 | 196 |
| 135 | 3300005338 | Ga0068868_100062155 | Ga0068868_1000621552 | 196 |
| 136 | 3300005340 | Ga0070689_100065829 | Ga0070689_1000658293 | 196 |
| 137 | 3300005340 | Ga0070689_100130185 | Ga0070689_1001301853 | 196 |
| 138 | 3300005353 | Ga0070669_100144637 | Ga0070669_1001446372 | 196 |
| 139 | 3300005354 | Ga0070675_100004051 | Ga0070675_1000040516 | 196 |
| 140 | 3300005354 | Ga0070675_100010384 | Ga0070675_1000103847 | 196 |
| 141 | 3300005354 | Ga0070675_100042811 | Ga0070675_1000428114 | 196 |
| 142 | 3300005356 | Ga0070674_100000382 | Ga0070674_1000003825 | 196 |
| 143 | 3300005356 | Ga0070674_100524855 | Ga0070674_1005248552 | 196 |
| 144 | 3300005356 | Ga0070674_100875057 | Ga0070674_1008750571 | 196 |
| 145 | 3300005364 | Ga0070673_100008003 | Ga0070673_1000080033 | 196 |
| 146 | 3300005364 | Ga0070673_100046554 | Ga0070673_1000465544 | 196 |
| 147 | 3300005364 | Ga0070673_100263468 | Ga0070673_1002634682 | 196 |
| 148 | 3300005365 | Ga0070688_100006025 | Ga0070688_1000060257 | 196 |
| 149 | 3300005365 | Ga0070688_100097721 | Ga0070688_1000977212 | 196 |
| 150 | 3300005365 | Ga0070688_100363995 | Ga0070688_1003639951 | 196 |
| 151 | 3300005366 | Ga0070659_100045339 | Ga0070659_1000453392 | 196 |
| 152 | 3300005366 | Ga0070659_100482557 | Ga0070659_1004825572 | 196 |
| 153 | 3300005367 | Ga0070667_100054359 | Ga0070667_1000543594 | 196 |
| 154 | 3300005367 | Ga0070667_100363178 | Ga0070667_1003631782 | 196 |
| 155 | 3300005441 | Ga0070700_100214599 | Ga0070700_1002145992 | 196 |
| 156 | 3300005455 | Ga0070663_100272236 | Ga0070663_1002722362 | 196 |
| 157 | 3300005456 | Ga0070678_100511463 | Ga0070678_1005114632 | 196 |
| 158 | 3300005457 | Ga0070662_100031985 | Ga0070662_1000319852 | 196 |
| 159 | 3300005457 | Ga0070662_100055147 | Ga0070662_1000551473 | 196 |
| 160 | 3300005457 | Ga0070662_100551165 | Ga0070662_1005511652 | 196 |
| 161 | 3300005459 | Ga0068867_100026117 | Ga0068867_1000261174 | 196 |
| 162 | 3300005466 | Ga0070685_10014872 | Ga0070685_100148722 | 196 |
| 163 | 3300005468 | Ga0070707_100388659 | Ga0070707_1003886592 | 196 |
| 164 | 3300005471 | Ga0070698_100002906 | Ga0070698_1000029064 | 196 |
| 165 | 3300005518 | Ga0070699_100027001 | Ga0070699_1000270015 | 196 |
| 166 | 3300005530 | Ga0070679_100532034 | Ga0070679_1005320342 | 196 |
| 167 | 3300005536 | Ga0070697_100156129 | Ga0070697_1001561292 | 196 |
| 168 | 3300005543 | Ga0070672_100008378 | Ga0070672_1000083782 | 196 |
| 169 | 3300005543 | Ga0070672_100145010 | Ga0070672_1001450102 | 196 |
| 170 | 3300005543 | Ga0070672_100379393 | Ga0070672_1003793932 | 196 |
| 171 | 3300005548 | Ga0070665_100024814 | Ga0070665_1000248146 | 196 |
| 172 | 3300005549 | Ga0070704_100171290 | Ga0070704_1001712903 | 196 |
| 173 | 3300005549 | Ga0070704_100276743 | Ga0070704_1002767432 | 196 |
| 174 | 3300005549 | Ga0070704_100277490 | Ga0070704_1002774902 | 196 |
| 175 | 3300005564 | Ga0070664_100001259 | Ga0070664_10000125910 | 196 |
| 176 | 3300005564 | Ga0070664_100002281 | Ga0070664_10000228112 | 196 |
| 177 | 3300005564 | Ga0070664_100621224 | Ga0070664_1006212242 | 196 |
| 178 | 3300005577 | Ga0068857_100362462 | Ga0068857_1003624622 | 196 |
| 179 | 3300005615 | Ga0070702_100114043 | Ga0070702_1001140432 | 196 |
| 180 | 3300005616 | Ga0068852_100363944 | Ga0068852_1003639442 | 196 |
| 181 | 3300005617 | Ga0068859_100037935 | Ga0068859_1000379354 | 196 |
| 182 | 3300005617 | Ga0068859_100126054 | Ga0068859_1001260544 | 196 |
| 183 | 3300005617 | Ga0068859_100419971 | Ga0068859_1004199712 | 196 |
| 184 | 3300005617 | Ga0068859_100848281 | Ga0068859_1008482811 | 196 |
| 185 | 3300005618 | Ga0068864_100028638 | Ga0068864_1000286385 | 196 |
| 186 | 3300005618 | Ga0068864_100045866 | Ga0068864_1000458664 | 196 |
| 187 | 3300005718 | Ga0068866_10593310 | Ga0068866_105933101 | 196 |
| 188 | 3300005719 | Ga0068861_100024564 | Ga0068861_1000245642 | 196 |
| 189 | 3300005840 | Ga0068870_10001437 | Ga0068870_100014379 | 196 |
| 190 | 3300005841 | Ga0068863_100022046 | Ga0068863_1000220465 | 196 |
| 191 | 3300005844 | Ga0068862_100001194 | Ga0068862_10000119413 | 196 |
| 192 | 3300006237 | Ga0097621_100090626 | Ga0097621_1000906262 | 196 |
| 193 | 3300006358 | Ga0068871_100013047 | Ga0068871_1000130476 | 196 |
| 194 | 3300006358 | Ga0068871_100501909 | Ga0068871_1005019092 | 196 |
| 195 | 3300006844 | Ga0075428_100000957 | Ga0075428_1000009578 | 196 |
| 196 | 3300006844 | Ga0075428_100281666 | Ga0075428_1002816662 | 196 |
| 197 | 3300006846 | Ga0075430_100000407 | Ga0075430_1000004073 | 196 |
| 198 | 3300006846 | Ga0075430_100079986 | Ga0075430_1000799862 | 196 |
| 199 | 3300006846 | Ga0075430_100268739 | Ga0075430_1002687391 | 196 |
| 200 | 3300006847 | Ga0075431_100014511 | Ga0075431_1000145114 | 196 |
| 201 | 3300006852 | Ga0075433_10001626 | Ga0075433_100016264 | 196 |
| 202 | 3300006852 | Ga0075433_10169508 | Ga0075433_101695082 | 196 |
| 203 | 3300006871 | Ga0075434_100011034 | Ga0075434_1000110345 | 196 |
| 204 | 3300006871 | Ga0075434_100060774 | Ga0075434_1000607742 | 196 |
| 205 | 3300006871 | Ga0075434_100074269 | Ga0075434_1000742692 | 196 |
| 206 | 3300006880 | Ga0075429_100008849 | Ga0075429_1000088498 | 196 |
| 207 | 3300006880 | Ga0075429_100045620 | Ga0075429_1000456202 | 196 |
| 208 | 3300006880 | Ga0075429_100646611 | Ga0075429_1006466112 | 196 |
| 209 | 3300006881 | Ga0068865_100019564 | Ga0068865_1000195645 | 196 |
| 210 | 3300006881 | Ga0068865_100308639 | Ga0068865_1003086392 | 196 |
| 211 | 3300006931 | Ga0097620_100037937 | Ga0097620_1000379374 | 196 |
| 212 | 3300006931 | Ga0097620_100126058 | Ga0097620_1001260584 | 196 |
| 213 | 3300006931 | Ga0097620_100419969 | Ga0097620_1004199692 | 196 |
| 214 | 3300006931 | Ga0097620_100848259 | Ga0097620_1008482591 | 196 |
| 215 | 3300007076 | Ga0075435_100512230 | Ga0075435_1005122301 | 196 |
| 216 | 3300009094 | Ga0111539_10000937 | Ga0111539_1000093730 | 196 |
| 217 | 3300009094 | Ga0111539_10019325 | Ga0111539_100193252 | 196 |
| 218 | 3300009094 | Ga0111539_10057520 | Ga0111539_100575204 | 196 |
| 219 | 3300009094 | Ga0111539_10862984 | Ga0111539_108629842 | 196 |
| 220 | 3300009147 | Ga0114129_10017625 | Ga0114129_1001762510 | 196 |
| 221 | 3300009147 | Ga0114129_10034743 | Ga0114129_100347437 | 196 |
| 222 | 3300009147 | Ga0114129_11210104 | Ga0114129_112101042 | 196 |
| 223 | 3300009177 | Ga0105248_10038535 | Ga0105248_100385354 | 196 |
| 224 | 3300009177 | Ga0105248_10357202 | Ga0105248_103572022 | 196 |
| 225 | 3300009553 | Ga0105249_10025302 | Ga0105249_100253024 | 196 |
| 226 | 3300009553 | Ga0105249_11132369 | Ga0105249_111323692 | 196 |
| 227 | 3300011119 | Ga0105246_10130692 | Ga0105246_101306922 | 196 |
| 228 | 3300013306 | Ga0163162_10021845 | Ga0163162_100218452 | 196 |
| 229 | 3300013306 | Ga0163162_10056855 | Ga0163162_100568553 | 196 |
| 230 | 3300013308 | Ga0157375_10057570 | Ga0157375_100575704 | 196 |
| 231 | 3300013308 | Ga0157375_10119828 | Ga0157375_101198282 | 196 |
| 232 | 3300013308 | Ga0157375_10483841 | Ga0157375_104838412 | 196 |
| 233 | 3300014325 | Ga0163163_10043571 | Ga0163163_100435714 | 196 |
| 234 | 3300014326 | Ga0157380_10007797 | Ga0157380_100077973 | 196 |
| 235 | 3300014326 | Ga0157380_10010846 | Ga0157380_100108463 | 196 |
| 236 | 3300014326 | Ga0157380_10258555 | Ga0157380_102585553 | 196 |
| 237 | 3300014326 | Ga0157380_10509897 | Ga0157380_105098972 | 196 |
| 238 | 3300014745 | Ga0157377_10010852 | Ga0157377_100108525 | 196 |
| 239 | 3300014745 | Ga0157377_10017096 | Ga0157377_100170963 | 196 |
| 240 | 3300014745 | Ga0157377_10101868 | Ga0157377_101018682 | 196 |
| 241 | 3300014745 | Ga0157377_10157863 | Ga0157377_101578632 | 196 |
| 242 | 3300014968 | Ga0157379_10053964 | Ga0157379_100539643 | 196 |
| 243 | 3300014969 | Ga0157376_10096440 | Ga0157376_100964402 | 196 |
| 244 | 3300021388 | Ga0213875_10089555 | Ga0213875_100895552 | 196 |
| 245 | 3300025315 | Ga0207697_10000701 | Ga0207697_100007013 | 196 |
| 246 | 3300025893 | Ga0207682_10000378 | Ga0207682_1000037816 | 196 |
| 247 | 3300025893 | Ga0207682_10006209 | Ga0207682_100062092 | 196 |
| 248 | 3300025893 | Ga0207682_10108087 | Ga0207682_101080872 | 196 |
| 249 | 3300025901 | Ga0207688_10000628 | Ga0207688_100006283 | 196 |
| 250 | 3300025901 | Ga0207688_10064495 | Ga0207688_100644953 | 196 |
| 251 | 3300025901 | Ga0207688_10092509 | Ga0207688_100925092 | 196 |
| 252 | 3300025903 | Ga0207680_10117032 | Ga0207680_101170322 | 196 |
| 253 | 3300025907 | Ga0207645_10001911 | Ga0207645_1000191110 | 196 |
| 254 | 3300025907 | Ga0207645_10110203 | Ga0207645_101102032 | 196 |
| 255 | 3300025908 | Ga0207643_10000925 | Ga0207643_1000092515 | 196 |
| 256 | 3300025908 | Ga0207643_10010788 | Ga0207643_100107885 | 196 |
| 257 | 3300025917 | Ga0207660_10083025 | Ga0207660_100830253 | 196 |
| 258 | 3300025918 | Ga0207662_10058324 | Ga0207662_100583242 | 196 |
| 259 | 3300025919 | Ga0207657_10583565 | Ga0207657_105835652 | 196 |
| 260 | 3300025920 | Ga0207649_10060738 | Ga0207649_100607383 | 196 |
| 261 | 3300025922 | Ga0207646_10267344 | Ga0207646_102673442 | 196 |
| 262 | 3300025923 | Ga0207681_10125365 | Ga0207681_101253653 | 196 |
| 263 | 3300025923 | Ga0207681_10496619 | Ga0207681_104966192 | 196 |
| 264 | 3300025925 | Ga0207650_10006335 | Ga0207650_100063355 | 196 |
| 265 | 3300025926 | Ga0207659_10004292 | Ga0207659_100042924 | 196 |
| 266 | 3300025926 | Ga0207659_10012850 | Ga0207659_100128503 | 196 |
| 267 | 3300025926 | Ga0207659_10024302 | Ga0207659_100243023 | 196 |
| 268 | 3300025926 | Ga0207659_10034223 | Ga0207659_100342233 | 196 |
| 269 | 3300025927 | Ga0207687_10133765 | Ga0207687_101337652 | 196 |
| 270 | 3300025932 | Ga0207690_10178091 | Ga0207690_101780912 | 196 |
| 271 | 3300025933 | Ga0207706_10041238 | Ga0207706_100412382 | 196 |
| 272 | 3300025933 | Ga0207706_10042421 | Ga0207706_100424215 | 196 |
| 273 | 3300025933 | Ga0207706_10837028 | Ga0207706_108370282 | 196 |
| 274 | 3300025934 | Ga0207686_10412108 | Ga0207686_104121083 | 196 |
| 275 | 3300025936 | Ga0207670_10071424 | Ga0207670_100714243 | 196 |
| 276 | 3300025936 | Ga0207670_10454502 | Ga0207670_104545022 | 196 |
| 277 | 3300025937 | Ga0207669_10000517 | Ga0207669_1000051711 | 196 |
| 278 | 3300025940 | Ga0207691_10005381 | Ga0207691_1000538112 | 196 |
| 279 | 3300025940 | Ga0207691_10023122 | Ga0207691_100231224 | 196 |
| 280 | 3300025940 | Ga0207691_10025557 | Ga0207691_100255573 | 196 |
| 281 | 3300025940 | Ga0207691_10485310 | Ga0207691_104853102 | 196 |
| 282 | 3300025940 | Ga0207691_10953006 | Ga0207691_109530061 | 196 |
| 283 | 3300025942 | Ga0207689_10001594 | Ga0207689_100015943 | 196 |
| 284 | 3300025942 | Ga0207689_10066220 | Ga0207689_100662202 | 196 |
| 285 | 3300025942 | Ga0207689_10073568 | Ga0207689_100735682 | 196 |
| 286 | 3300025945 | Ga0207679_10030688 | Ga0207679_100306884 | 196 |
| 287 | 3300025945 | Ga0207679_10593989 | Ga0207679_105939891 | 196 |
| 288 | 3300025960 | Ga0207651_10038468 | Ga0207651_100384684 | 196 |
| 289 | 3300025960 | Ga0207651_10287766 | Ga0207651_102877662 | 196 |
| 290 | 3300025961 | Ga0207712_10020945 | Ga0207712_100209454 | 196 |
| 291 | 3300025972 | Ga0207668_10026763 | Ga0207668_100267634 | 196 |
| 292 | 3300025972 | Ga0207668_10573722 | Ga0207668_105737222 | 196 |
| 293 | 3300025986 | Ga0207658_10068874 | Ga0207658_100688742 | 196 |
| 294 | 3300026023 | Ga0207677_10368247 | Ga0207677_103682472 | 196 |
| 295 | 3300026035 | Ga0207703_11126334 | Ga0207703_111263341 | 196 |
| 296 | 3300026075 | Ga0207708_10008381 | Ga0207708_100083813 | 196 |
| 297 | 3300026075 | Ga0207708_10198880 | Ga0207708_101988802 | 196 |
| 298 | 3300026075 | Ga0207708_10331459 | Ga0207708_103314592 | 196 |
| 299 | 3300026088 | Ga0207641_10007161 | Ga0207641_100071615 | 196 |
| 300 | 3300026089 | Ga0207648_10005974 | Ga0207648_100059749 | 196 |
| 301 | 3300026089 | Ga0207648_10066022 | Ga0207648_100660222 | 196 |
| 302 | 3300026089 | Ga0207648_10110545 | Ga0207648_101105453 | 196 |
| 303 | 3300026089 | Ga0207648_10120681 | Ga0207648_101206813 | 196 |
| 304 | 3300026095 | Ga0207676_10024241 | Ga0207676_100242414 | 196 |
| 305 | 3300026095 | Ga0207676_10456637 | Ga0207676_104566372 | 196 |
| 306 | 3300026116 | Ga0207674_10091188 | Ga0207674_100911884 | 196 |
| 307 | 3300026118 | Ga0207675_100012877 | Ga0207675_1000128772 | 196 |
| 308 | 3300026118 | Ga0207675_100049984 | Ga0207675_1000499842 | 196 |
| 309 | 3300026118 | Ga0207675_100207046 | Ga0207675_1002070461 | 196 |
| 310 | 3300026118 | Ga0207675_100263578 | Ga0207675_1002635783 | 196 |
| 311 | 3300026121 | Ga0207683_10018406 | Ga0207683_100184065 | 196 |
| 312 | 3300026121 | Ga0207683_10521239 | Ga0207683_105212392 | 196 |
| 313 | 3300026142 | Ga0207698_10433619 | Ga0207698_104336192 | 196 |
| 314 | 3300027907 | Ga0207428_10001370 | Ga0207428_1000137010 | 196 |
| 315 | 3300027907 | Ga0207428_10001377 | Ga0207428_1000137713 | 196 |
| 316 | 3300027907 | Ga0207428_10304272 | Ga0207428_103042722 | 196 |
| 317 | 3300028380 | Ga0268265_10023143 | Ga0268265_100231433 | 196 |
| 318 | 3300028380 | Ga0268265_10299680 | Ga0268265_102996802 | 196 |
| 319 | 3300028380 | Ga0268265_10833005 | Ga0268265_108330052 | 196 |
| 320 | 3300031548 | Ga0307408_100054766 | Ga0307408_1000547662 | 196 |
| 321 | 3300031824 | Ga0307413_10620748 | Ga0307413_106207482 | 196 |
| 322 | 3300031852 | Ga0307410_10007671 | Ga0307410_100076714 | 196 |
| 323 | 3300031901 | Ga0307406_10142006 | Ga0307406_101420062 | 196 |
| 324 | 3300031903 | Ga0307407_10043843 | Ga0307407_100438433 | 196 |
| 325 | 3300031995 | Ga0307409_100016937 | Ga0307409_1000169373 | 196 |
| 326 | 3300032002 | Ga0307416_100029545 | Ga0307416_1000295453 | 196 |
| 327 | 3300032002 | Ga0307416_100752467 | Ga0307416_1007524672 | 196 |
| 328 | 3300032004 | Ga0307414_10397949 | Ga0307414_103979492 | 196 |
| 329 | 3300032005 | Ga0307411_10041838 | Ga0307411_100418382 | 196 |
| 330 | 3300032005 | Ga0307411_10043240 | Ga0307411_100432402 | 196 |
| 331 | 3300032126 | Ga0307415_100023986 | Ga0307415_1000239864 | 196 |
| 332 | 3300035088 | Ga0373940_0005259 | Ga0373940_0005259_2026_2631 | 196 |
| 333 | 3300037853 | Ga0436364_0334136 | Ga0436364_0334136_1685_2287 | 196 |
| 334 | 3300039437 | Ga0436365_0055431 | Ga0436365_0055431_15_617 | 196 |
| 335 | 3300042008 | Ga0439450_020510 | Ga0439450_020510_616_1221 | 196 |
| 336 | 3300042436 | Ga0439435_0032586 | Ga0439435_0032586_658_1278 | 196 |
| 337 | 3300045051 | Ga0451576_0024922 | Ga0451576_0024922_5179_5862 | 196 |
| 338 | 3300045051 | Ga0451576_0048913 | Ga0451576_0048913_3822_4427 | 196 |
| 339 | 3300045051 | Ga0451576_0212808 | Ga0451576_0212808_1013_1696 | 196 |
| 340 | 3300046459 | Ga0495629_0002871 | Ga0495629_0002871_3867_4478 | 196 |
| 341 | 3300046473 | Ga0495582_0092109 | Ga0495582_0092109_914_1561 | 196 |
| 342 | 3300046491 | Ga0495584_0073883 | Ga0495584_0073883_298_981 | 196 |
| 343 | 3300046499 | Ga0495594_0089263 | Ga0495594_0089263_183_794 | 196 |
| 344 | 3300046523 | Ga0495644_0262574 | Ga0495644_0262574_53_658 | 196 |
| 345 | 3300046528 | Ga0495642_0070881 | Ga0495642_0070881_241_924 | 196 |
| 346 | 3300046537 | Ga0495598_0028879 | Ga0495598_0028879_406_1038 | 196 |
| 347 | 3300046538 | Ga0495609_0043757 | Ga0495609_0043757_114_797 | 196 |
| 348 | 3300046664 | Ga0495659_0036011 | Ga0495659_0036011_1028_1711 | 196 |
| 349 | 3300046683 | Ga0495658_0036949 | Ga0495658_0036949_357_1004 | 196 |
| 350 | 3300046691 | Ga0495670_0210218 | Ga0495670_0210218_337_942 | 196 |
| 351 | 3300047315 | Ga0495581_0500994 | Ga0495581_0500994_26_637 | 196 |
| 352 | 3300047321 | Ga0495676_0017131 | Ga0495676_0017131_4329_4940 | 196 |
| 353 | 3300047445 | Ga0495677_0032453 | Ga0495677_0032453_793_1476 | 196 |
| 354 | 3300048912 | Ga0496109_0350357 | Ga0496109_0350357_325_930 | 196 |
| 355 | 3300048912 | Ga0496109_0615328 | Ga0496109_0615328_156_776 | 196 |
| 356 | 3300048913 | Ga0496110_0339636 | Ga0496110_0339636_123_743 | 196 |
| 357 | 3300048913 | Ga0496110_0549034 | Ga0496110_0549034_134_739 | 196 |
| 358 | 3300048914 | Ga0496111_0259682 | Ga0496111_0259682_348_968 | 196 |
| 359 | 3300049572 | Ga0501036_0123288 | Ga0501036_0123288_1427_2032 | 196 |
| 360 | 3300049582 | Ga0501048_0119875 | Ga0501048_0119875_413_1018 | 196 |
| 361 | 3300049591 | Ga0501075_0066467 | Ga0501075_0066467_340_960 | 196 |
| 362 | 3300049591 | Ga0501075_0392314 | Ga0501075_0392314_193_798 | 196 |
| 363 | 3300050507 | nmdc:mga05p37_119351_c1 | nmdc:mga05p37_119351_c1_1037_1642 | 196 |
| 364 | 3300050508 | nmdc:mga09592_10011_c1 | nmdc:mga09592_10011_c1_1275_1880 | 196 |
| 365 | 3300050508 | nmdc:mga09592_168895_c1 | nmdc:mga09592_168895_c1_373_978 | 196 |
| 366 | 3300050508 | nmdc:mga09592_27132_c1 | nmdc:mga09592_27132_c1_2321_2932 | 196 |
| 367 | 3300050508 | nmdc:mga09592_45514_c1 | nmdc:mga09592_45514_c1_978_1610 | 196 |
| 368 | 3300050508 | nmdc:mga09592_50982_c1 | nmdc:mga09592_50982_c1_1263_1868 | 196 |
| 369 | 3300050509 | nmdc:mga0qj67_31529_c1 | nmdc:mga0qj67_31529_c1_2996_3607 | 196 |
| 370 | 3300050509 | nmdc:mga0qj67_898_c1 | nmdc:mga0qj67_898_c1_8610_9215 | 196 |
| 371 | 3300050510 | nmdc:mga06r32_336659_c1 | nmdc:mga06r32_336659_c1_264_869 | 196 |
| 372 | 3300050510 | nmdc:mga06r32_4916_c1 | nmdc:mga06r32_4916_c1_9596_10201 | 196 |
| 373 | 3300050510 | nmdc:mga06r32_705086_c1 | nmdc:mga06r32_705086_c1_22_642 | 196 |
| 374 | 3300050511 | nmdc:mga08y16_142240_c1 | nmdc:mga08y16_142240_c1_1829_2449 | 196 |
| 375 | 3300050511 | nmdc:mga08y16_196413_c1 | nmdc:mga08y16_196413_c1_539_1144 | 196 |
| 376 | 3300050511 | nmdc:mga08y16_52853_c1 | nmdc:mga08y16_52853_c1_1501_2106 | 196 |
| 377 | 3300050511 | nmdc:mga08y16_743_c1 | nmdc:mga08y16_743_c1_23808_24428 | 196 |
| 378 | 3300050512 | nmdc:mga0n895_31629_c1 | nmdc:mga0n895_31629_c1_3133_3753 | 196 |
| 379 | 3300050512 | nmdc:mga0n895_83538_c1 | nmdc:mga0n895_83538_c1_2410_3084 | 196 |
| 380 | 3300050512 | nmdc:mga0n895_90797_c1 | nmdc:mga0n895_90797_c1_2354_2959 | 196 |
| 381 | 3300050513 | nmdc:mga0rr50_608263_c1 | nmdc:mga0rr50_608263_c1_186_860 | 196 |
| 382 | 3300050515 | nmdc:mga0a205_233846_c1 | nmdc:mga0a205_233846_c1_366_1040 | 196 |
| 383 | 3300050515 | nmdc:mga0a205_2928_c1 | nmdc:mga0a205_2928_c1_7784_8389 | 196 |
| 384 | 3300050515 | nmdc:mga0a205_5356_c1 | nmdc:mga0a205_5356_c1_3064_3684 | 196 |
| 385 | 3300054114 | Ga0501084_0296031 | Ga0501084_0296031_712_1332 | 196 |
| 386 | iso_pu_bacteria | 2643221556 | 2643801999 | 196 |
| 387 | iso_pu_bacteria | 2643221684 | 2644473848 | 196 |
| 388 | iso_pu_bacteria | 8047673197 | 8047679543 | 196 |
| 389 | 3300005518 | Ga0070699_100743837 | Ga0070699_1007438371 | 197 |
| 390 | 3300006844 | Ga0075428_100608648 | Ga0075428_1006086482 | 197 |
| 391 | 3300009147 | Ga0114129_10792452 | Ga0114129_107924522 | 197 |
| 392 | 3300021388 | Ga0213875_10081824 | Ga0213875_100818242 | 197 |
| 393 | 3300037853 | Ga0436364_0183835 | Ga0436364_0183835_56_694 | 197 |
| 394 | 3300005328 | Ga0070676_10006282 | Ga0070676_100062825 | 198 |
| 395 | 3300005343 | Ga0070687_100001643 | Ga0070687_1000016438 | 198 |
| 396 | 3300005347 | Ga0070668_100026632 | Ga0070668_1000266322 | 198 |
| 397 | 3300005353 | Ga0070669_100008311 | Ga0070669_1000083114 | 198 |
| 398 | 3300005456 | Ga0070678_100007020 | Ga0070678_1000070204 | 198 |
| 399 | 3300005518 | Ga0070699_100361912 | Ga0070699_1003619122 | 198 |
| 400 | 3300005544 | Ga0070686_100009633 | Ga0070686_1000096333 | 198 |
| 401 | 3300006852 | Ga0075433_10122556 | Ga0075433_101225562 | 198 |
| 402 | 3300050515 | nmdc:mga0a205_139050_c1 | nmdc:mga0a205_139050_c1_1094_1708 | 198 |
| 403 | 3300005618 | Ga0068864_101382912 | Ga0068864_1013829121 | 199 |
| 404 | 3300031665 | Ga0316575_10047892 | Ga0316575_100478923 | 199 |
| 405 | 3300031691 | Ga0316579_10039683 | Ga0316579_100396832 | 199 |
| 406 | 3300031727 | Ga0316576_10119634 | Ga0316576_101196343 | 199 |
| 407 | 3300031728 | Ga0316578_10009462 | Ga0316578_100094623 | 199 |
| 408 | 3300031733 | Ga0316577_10006149 | Ga0316577_100061494 | 199 |
| 409 | 3300031733 | Ga0316577_10014824 | Ga0316577_100148241 | 199 |
| 410 | 3300031733 | Ga0316577_10055102 | Ga0316577_100551022 | 199 |
| 411 | 3300031733 | Ga0316577_10092918 | Ga0316577_100929182 | 199 |
| 412 | 3300031733 | Ga0316577_10115741 | Ga0316577_101157411 | 199 |
| 413 | 3300031733 | Ga0316577_10381695 | Ga0316577_103816951 | 199 |
| 414 | 3300032137 | Ga0316585_10057566 | Ga0316585_100575662 | 199 |
| 415 | 3300032137 | Ga0316585_10080425 | Ga0316585_100804252 | 199 |
| 416 | 3300036647 | Ga0316582_0020285 | Ga0316582_0020285_2766_3383 | 199 |
| 417 | 3300036647 | Ga0316582_0060279 | Ga0316582_0060279_610_1227 | 199 |
| 418 | 3300036712 | Ga0316584_0001965 | Ga0316584_0001965_10900_11517 | 199 |
| 419 | 3300036712 | Ga0316584_0011979 | Ga0316584_0011979_4448_5065 | 199 |
| 420 | 3300036712 | Ga0316584_0650675 | Ga0316584_0650675_65_682 | 199 |
| 421 | 3300037418 | Ga0395900_0109043 | Ga0395900_0109043_76_690 | 199 |
| 422 | 3300037471 | Ga0395905_0001509 | Ga0395905_0001509_2032_2646 | 199 |
| 423 | 3300037588 | Ga0316581_0002269 | Ga0316581_0002269_546_1163 | 199 |
| 424 | 3300037588 | Ga0316581_0015740 | Ga0316581_0015740_1219_1836 | 199 |
| 425 | 3300039093 | Ga0400489_73490 | Ga0400489_73490_13055_13669 | 199 |
| 426 | 3300039093 | Ga0400489_76266 | Ga0400489_76266_502_1119 | 199 |
| 427 | 3300003322 | rootL2_10013282 | rootL2_100132829 | 200 |
| 428 | 3300005327 | Ga0070658_10016196 | Ga0070658_100161966 | 200 |
| 429 | 3300005336 | Ga0070680_100587069 | Ga0070680_1005870692 | 200 |
| 430 | 3300005344 | Ga0070661_100586168 | Ga0070661_1005861681 | 200 |
| 431 | 3300005366 | Ga0070659_100076117 | Ga0070659_1000761172 | 200 |
| 432 | 3300013100 | Ga0157373_10019614 | Ga0157373_100196145 | 200 |
| 433 | 3300013104 | Ga0157370_10791486 | Ga0157370_107914861 | 200 |
| 434 | 3300013297 | Ga0157378_10010539 | Ga0157378_100105392 | 200 |
| 435 | 3300025920 | Ga0207649_10558307 | Ga0207649_105583072 | 200 |
| 436 | 3300025932 | Ga0207690_10174801 | Ga0207690_101748012 | 200 |
| 437 | 3300030745 | Ga0316182_1155512 | Ga0316182_11555122 | 200 |
| 438 | 3300030745 | Ga0316182_1171651 | Ga0316182_11716512 | 200 |
| 439 | 3300037418 | Ga0395900_0386577 | Ga0395900_0386577_722_1333 | 200 |
| 440 | 3300044658 | Ga0466972_0068060 | Ga0466972_0068060_629_1240 | 200 |
| 441 | 3300044683 | Ga0466965_0106623 | Ga0466965_0106623_286_897 | 200 |
| 442 | 3300044712 | Ga0453684_0162323 | Ga0453684_0162323_1965_2576 | 200 |
| 443 | 3300045049 | Ga0466959_0351463 | Ga0466959_0351463_302_913 | 200 |
| 444 | 3300045976 | Ga0466967_0403018 | Ga0466967_0403018_348_959 | 200 |
| 445 | 3300046474 | Ga0495605_0000498 | Ga0495605_0000498_7969_8580 | 200 |
| 446 | 3300046474 | Ga0495605_0033767 | Ga0495605_0033767_845_1456 | 200 |
| 447 | 3300046491 | Ga0495584_0025348 | Ga0495584_0025348_1240_1851 | 200 |
| 448 | 3300046501 | Ga0495607_0000961 | Ga0495607_0000961_7961_8572 | 200 |
| 449 | 3300046501 | Ga0495607_0043698 | Ga0495607_0043698_201_812 | 200 |
| 450 | 3300046507 | Ga0495606_0124092 | Ga0495606_0124092_378_989 | 200 |
| 451 | 3300046522 | Ga0495643_0004358 | Ga0495643_0004358_802_1413 | 200 |
| 452 | 3300046522 | Ga0495643_0005453 | Ga0495643_0005453_291_902 | 200 |
| 453 | 3300046524 | Ga0495648_0003051 | Ga0495648_0003051_4890_5501 | 200 |
| 454 | 3300046524 | Ga0495648_0050064 | Ga0495648_0050064_487_1098 | 200 |
| 455 | 3300046528 | Ga0495642_0013883 | Ga0495642_0013883_1962_2573 | 200 |
| 456 | 3300046530 | Ga0495654_0008763 | Ga0495654_0008763_1766_2377 | 200 |
| 457 | 3300046537 | Ga0495598_0077173 | Ga0495598_0077173_115_729 | 200 |
| 458 | 3300046538 | Ga0495609_0006777 | Ga0495609_0006777_4626_5237 | 200 |
| 459 | 3300046616 | Ga0495668_0007671 | Ga0495668_0007671_1464_2075 | 200 |
| 460 | 3300046665 | Ga0495661_0001505 | Ga0495661_0001505_18353_18964 | 200 |
| 461 | 3300046665 | Ga0495661_0005604 | Ga0495661_0005604_7975_8586 | 200 |
| 462 | 3300046665 | Ga0495661_0008756 | Ga0495661_0008756_4134_4745 | 200 |
| 463 | 3300046694 | Ga0495649_0001229 | Ga0495649_0001229_12971_13585 | 200 |
| 464 | 3300046694 | Ga0495649_0354164 | Ga0495649_0354164_54_665 | 200 |
| 465 | 3300046794 | Ga0495589_0001577 | Ga0495589_0001577_5108_5719 | 200 |
| 466 | 3300046794 | Ga0495589_0002196 | Ga0495589_0002196_7972_8583 | 200 |
| 467 | 3300046810 | Ga0495660_0000033 | Ga0495660_0000033_138975_139586 | 200 |
| 468 | 3300046810 | Ga0495660_0014126 | Ga0495660_0014126_783_1394 | 200 |
| 469 | 3300047320 | Ga0495672_0001901 | Ga0495672_0001901_12719_13330 | 200 |
| 470 | 3300047320 | Ga0495672_0002129 | Ga0495672_0002129_12693_13304 | 200 |
| 471 | 3300047323 | Ga0495683_0004048 | Ga0495683_0004048_1468_2079 | 200 |
| 472 | 3300047323 | Ga0495683_0006783 | Ga0495683_0006783_2208_2822 | 200 |
| 473 | 3300047443 | Ga0495687_000344 | Ga0495687_000344_39274_39885 | 200 |
| 474 | 3300047445 | Ga0495677_0002111 | Ga0495677_0002111_7194_7805 | 200 |
| 475 | 3300048091 | Ga0495626_0000160 | Ga0495626_0000160_9828_10439 | 200 |
| 476 | 3300048927 | Ga0496124_0315035 | Ga0496124_0315035_414_1025 | 200 |
| 477 | 3300049572 | Ga0501036_0594649 | Ga0501036_0594649_175_786 | 200 |
| 478 | 3300005262 | Ga0065165_1010199 | Ga0065165_10101993 | 201 |
| 479 | 3300005329 | Ga0070683_100768096 | Ga0070683_1007680962 | 201 |
| 480 | 3300005435 | Ga0070714_100021490 | Ga0070714_1000214905 | 201 |
| 481 | 3300006948 | Ga0099826_10000048 | Ga0099826_100000489 | 201 |
| 482 | 3300009147 | Ga0114129_10302722 | Ga0114129_103027223 | 201 |
| 483 | 3300025944 | Ga0207661_10639358 | Ga0207661_106393582 | 201 |
| 484 | 3300027666 | Ga0209282_1000066 | Ga0209282_100006672 | 201 |
| 485 | 3300031548 | Ga0307408_100111987 | Ga0307408_1001119872 | 201 |
| 486 | 3300031665 | Ga0316575_10080144 | Ga0316575_100801442 | 201 |
| 487 | 3300031728 | Ga0316578_10478552 | Ga0316578_104785521 | 201 |
| 488 | 3300031901 | Ga0307406_10108406 | Ga0307406_101084062 | 201 |
| 489 | 3300031911 | Ga0307412_10098464 | Ga0307412_100984643 | 201 |
| 490 | 3300044684 | Ga0466966_0073122 | Ga0466966_0073122_570_1199 | 201 |
| 491 | 3300044712 | Ga0453684_0760972 | Ga0453684_0760972_352_969 | 201 |
| 492 | 3300045049 | Ga0466959_0025843 | Ga0466959_0025843_2649_3278 | 201 |
| 493 | 3300045051 | Ga0451576_0483280 | Ga0451576_0483280_242_856 | 201 |
| 494 | 3300045836 | Ga0466958_0008664 | Ga0466958_0008664_2553_3182 | 201 |
| 495 | 3300045836 | Ga0466958_0036525 | Ga0466958_0036525_621_1259 | 201 |
| 496 | 3300046472 | Ga0495580_0000641 | Ga0495580_0000641_14133_14765 | 201 |
| 497 | 3300046491 | Ga0495584_0000037 | Ga0495584_0000037_12401_13015 | 201 |
| 498 | 3300046507 | Ga0495606_0031701 | Ga0495606_0031701_1875_2489 | 201 |
| 499 | 3300046513 | Ga0495616_0095550 | Ga0495616_0095550_511_1125 | 201 |
| 500 | 3300046522 | Ga0495643_0058556 | Ga0495643_0058556_736_1350 | 201 |
| 501 | 3300046684 | Ga0495669_0002671 | Ga0495669_0002671_1893_2522 | 201 |
| 502 | 3300046694 | Ga0495649_0027410 | Ga0495649_0027410_2201_2815 | 201 |
| 503 | 3300048919 | Ga0496116_0001420 | Ga0496116_0001420_9877_10494 | 201 |
| 504 | 3300048925 | Ga0496122_0045465 | Ga0496122_0045465_2388_3005 | 201 |
| 505 | 3300048925 | Ga0496122_0082972 | Ga0496122_0082972_196_810 | 201 |
| 506 | 3300048926 | Ga0496123_0002004 | Ga0496123_0002004_10986_11600 | 201 |
| 507 | 3300048928 | Ga0496125_0000807 | Ga0496125_0000807_24122_24736 | 201 |
| 508 | 3300048929 | Ga0496126_0002667 | Ga0496126_0002667_20244_20861 | 201 |
| 509 | 3300050507 | nmdc:mga05p37_99269_c1 | nmdc:mga05p37_99269_c1_943_1560 | 201 |
| 510 | 3300050512 | nmdc:mga0n895_105523_c1 | nmdc:mga0n895_105523_c1_15_647 | 201 |
| 511 | iso_pu_bacteria | 2643221736 | 2644745847 | 201 |
| 512 | 3300003659 | JGI25404J52841_10000484 | JGI25404J52841_100004844 | 202 |
| 513 | 3300005289 | Ga0065704_10028029 | Ga0065704_100280292 | 202 |
| 514 | 3300005295 | Ga0065707_10343331 | Ga0065707_103433312 | 202 |
| 515 | 3300005937 | Ga0081455_10548479 | Ga0081455_105484791 | 202 |
| 516 | 3300005983 | Ga0081540_1000343 | Ga0081540_100034328 | 202 |
| 517 | 3300006195 | Ga0075366_10039914 | Ga0075366_100399143 | 202 |
| 518 | 3300006844 | Ga0075428_100047493 | Ga0075428_1000474933 | 202 |
| 519 | 3300009094 | Ga0111539_10129980 | Ga0111539_101299802 | 202 |
| 520 | 3300009147 | Ga0114129_10020095 | Ga0114129_100200957 | 202 |
| 521 | 3300009147 | Ga0114129_10247158 | Ga0114129_102471582 | 202 |
| 522 | 3300031456 | Ga0307513_10010905 | Ga0307513_100109054 | 202 |
| 523 | 3300031548 | Ga0307408_100052597 | Ga0307408_1000525973 | 202 |
| 524 | 3300031548 | Ga0307408_100115010 | Ga0307408_1001150102 | 202 |
| 525 | 3300031711 | Ga0265314_10001478 | Ga0265314_100014788 | 202 |
| 526 | 3300031824 | Ga0307413_10383889 | Ga0307413_103838892 | 202 |
| 527 | 3300031852 | Ga0307410_10041277 | Ga0307410_100412772 | 202 |
| 528 | 3300031852 | Ga0307410_10115491 | Ga0307410_101154912 | 202 |
| 529 | 3300031852 | Ga0307410_10525049 | Ga0307410_105250492 | 202 |
| 530 | 3300032002 | Ga0307416_100117086 | Ga0307416_1001170862 | 202 |
| 531 | 3300032005 | Ga0307411_10027803 | Ga0307411_100278032 | 202 |
| 532 | 3300044656 | Ga0466969_0296577 | Ga0466969_0296577_47_682 | 202 |
| 533 | 3300049580 | Ga0501046_0360902 | Ga0501046_0360902_142_774 | 202 |
| 534 | 3300049587 | Ga0501071_0269908 | Ga0501071_0269908_600_1232 | 202 |
| 535 | 3300049588 | Ga0501072_0987788 | Ga0501072_0987788_14_646 | 202 |
| 536 | 3300049590 | Ga0501074_0369458 | Ga0501074_0369458_185_817 | 202 |
| 537 | 3300049591 | Ga0501075_0105020 | Ga0501075_0105020_713_1345 | 202 |
| 538 | 3300049592 | Ga0501076_0319150 | Ga0501076_0319150_601_1233 | 202 |
| 539 | 3300049824 | Ga0501045_0101486 | Ga0501045_0101486_1362_1994 | 202 |
| 540 | 3300050493 | nmdc:mga0k408_14188_c2 | nmdc:mga0k408_14188_c2_759_1382 | 202 |
| 541 | 3300050507 | nmdc:mga05p37_241_c1 | nmdc:mga05p37_241_c1_28801_29418 | 202 |
| 542 | 3300050511 | nmdc:mga08y16_333519_c1 | nmdc:mga08y16_333519_c1_880_1500 | 202 |
| 543 | 3300059426 | Ga0590077_008463 | Ga0590077_008463_869_1501 | 202 |
| 544 | 3300061734 | Ga0530510_0659933 | Ga0530510_0659933_58_738 | 202 |
| 545 | 3300005434 | Ga0070709_10563698 | Ga0070709_105636981 | 203 |
| 546 | 3300005435 | Ga0070714_100010038 | Ga0070714_1000100386 | 203 |
| 547 | 3300005435 | Ga0070714_100069618 | Ga0070714_1000696182 | 203 |
| 548 | 3300005435 | Ga0070714_100083015 | Ga0070714_1000830153 | 203 |
| 549 | 3300005436 | Ga0070713_100086314 | Ga0070713_1000863142 | 203 |
| 550 | 3300005437 | Ga0070710_10120622 | Ga0070710_101206222 | 203 |
| 551 | 3300005437 | Ga0070710_10614665 | Ga0070710_106146651 | 203 |
| 552 | 3300005842 | Ga0068858_100222421 | Ga0068858_1002224213 | 203 |
| 553 | 3300006028 | Ga0070717_10007369 | Ga0070717_100073694 | 203 |
| 554 | 3300006028 | Ga0070717_10010026 | Ga0070717_100100266 | 203 |
| 555 | 3300006852 | Ga0075433_10008473 | Ga0075433_100084734 | 203 |
| 556 | 3300025898 | Ga0207692_10354613 | Ga0207692_103546132 | 203 |
| 557 | 3300025928 | Ga0207700_10698984 | Ga0207700_106989842 | 203 |
| 558 | 3300025929 | Ga0207664_10018238 | Ga0207664_100182385 | 203 |
| 559 | 3300025929 | Ga0207664_10038395 | Ga0207664_100383953 | 203 |
| 560 | 3300025929 | Ga0207664_10532492 | Ga0207664_105324922 | 203 |
| 561 | 3300026035 | Ga0207703_10415509 | Ga0207703_104155092 | 203 |
| 562 | 3300038726 | Ga0400490_56435 | Ga0400490_56435_3137_3766 | 203 |
| 563 | 3300042876 | Ga0451577_0005780 | Ga0451577_0005780_9441_10052 | 203 |
| 564 | 3300044673 | Ga0453683_0000845 | Ga0453683_0000845_17945_18601 | 203 |
| 565 | 3300044673 | Ga0453683_0019430 | Ga0453683_0019430_1660_2280 | 203 |
| 566 | 3300044712 | Ga0453684_0023147 | Ga0453684_0023147_3080_3697 | 203 |
| 567 | 3300044712 | Ga0453684_0027034 | Ga0453684_0027034_2782_3393 | 203 |
| 568 | 3300044712 | Ga0453684_0035665 | Ga0453684_0035665_6091_6711 | 203 |
| 569 | 3300044712 | Ga0453684_0054823 | Ga0453684_0054823_1449_2072 | 203 |
| 570 | 3300044712 | Ga0453684_0230488 | Ga0453684_0230488_1200_1964 | 203 |
| 571 | 3300044712 | Ga0453684_0331656 | Ga0453684_0331656_106_723 | 203 |
| 572 | 3300044712 | Ga0453684_0381510 | Ga0453684_0381510_780_1397 | 203 |
| 573 | 3300044712 | Ga0453684_0656887 | Ga0453684_0656887_132_749 | 203 |
| 574 | 3300044712 | Ga0453684_1007825 | Ga0453684_1007825_159_776 | 203 |
| 575 | 3300044765 | Ga0466970_0022802 | Ga0466970_0022802_1452_2123 | 203 |
| 576 | 3300045049 | Ga0466959_0003996 | Ga0466959_0003996_8553_9218 | 203 |
| 577 | 3300045051 | Ga0451576_0501266 | Ga0451576_0501266_346_966 | 203 |
| 578 | 3300045976 | Ga0466967_0044879 | Ga0466967_0044879_2821_3468 | 203 |
| 579 | 3300046543 | Ga0495645_0343761 | Ga0495645_0343761_43_699 | 203 |
| 580 | 3300047317 | Ga0495604_0111911 | Ga0495604_0111911_420_1076 | 203 |
| 581 | 3300047319 | Ga0495674_0492619 | Ga0495674_0492619_293_949 | 203 |
| 582 | 3300047320 | Ga0495672_0073834 | Ga0495672_0073834_289_963 | 203 |
| 583 | 3300048911 | Ga0496108_0264391 | Ga0496108_0264391_310_981 | 203 |
| 584 | 3300048927 | Ga0496124_0104882 | Ga0496124_0104882_94_765 | 203 |
| 585 | 3300050512 | nmdc:mga0n895_363130_c1 | nmdc:mga0n895_363130_c1_399_1010 | 203 |
| 586 | 3300050515 | nmdc:mga0a205_72610_c1 | nmdc:mga0a205_72610_c1_2074_2685 | 203 |
| 587 | 3300053077 | Ga0495601_0459638 | Ga0495601_0459638_53_709 | 203 |
| 588 | 3300060353 | Ga0501082_0039026 | Ga0501082_0039026_1403_2050 | 203 |
| 589 | 3300061719 | Ga0466962_0018348 | Ga0466962_0018348_2233_2898 | 203 |
| 590 | 2162886011 | MRS1b_contig_8347333 | MRS1b_0372.00002400 | 204 |
| 591 | 3300005289 | Ga0065704_10295538 | Ga0065704_102955382 | 204 |
| 592 | 3300005295 | Ga0065707_10002920 | Ga0065707_100029208 | 204 |
| 593 | 3300005295 | Ga0065707_10153845 | Ga0065707_101538452 | 204 |
| 594 | 3300005444 | Ga0070694_100434530 | Ga0070694_1004345301 | 204 |
| 595 | 3300005467 | Ga0070706_100444829 | Ga0070706_1004448292 | 204 |
| 596 | 3300005471 | Ga0070698_100043358 | Ga0070698_1000433585 | 204 |
| 597 | 3300005471 | Ga0070698_100064147 | Ga0070698_1000641474 | 204 |
| 598 | 3300005471 | Ga0070698_100316745 | Ga0070698_1003167452 | 204 |
| 599 | 3300005518 | Ga0070699_100025646 | Ga0070699_1000256466 | 204 |
| 600 | 3300005518 | Ga0070699_100195114 | Ga0070699_1001951143 | 204 |
| 601 | 3300005518 | Ga0070699_100200506 | Ga0070699_1002005062 | 204 |
| 602 | 3300005518 | Ga0070699_100443775 | Ga0070699_1004437752 | 204 |
| 603 | 3300005618 | Ga0068864_100229397 | Ga0068864_1002293972 | 204 |
| 604 | 3300005844 | Ga0068862_100060116 | Ga0068862_1000601162 | 204 |
| 605 | 3300006844 | Ga0075428_100027050 | Ga0075428_1000270506 | 204 |
| 606 | 3300006846 | Ga0075430_100348066 | Ga0075430_1003480662 | 204 |
| 607 | 3300006847 | Ga0075431_100137881 | Ga0075431_1001378813 | 204 |
| 608 | 3300006880 | Ga0075429_100051941 | Ga0075429_1000519413 | 204 |
| 609 | 3300006880 | Ga0075429_100186245 | Ga0075429_1001862451 | 204 |
| 610 | 3300009147 | Ga0114129_10013246 | Ga0114129_100132469 | 204 |
| 611 | 3300009147 | Ga0114129_10026025 | Ga0114129_100260258 | 204 |
| 612 | 3300009147 | Ga0114129_10028768 | Ga0114129_100287687 | 204 |
| 613 | 3300009147 | Ga0114129_10053445 | Ga0114129_100534452 | 204 |
| 614 | 3300009148 | Ga0105243_10143083 | Ga0105243_101430832 | 204 |
| 615 | 3300009148 | Ga0105243_10547539 | Ga0105243_105475392 | 204 |
| 616 | 3300011119 | Ga0105246_10012177 | Ga0105246_100121773 | 204 |
| 617 | 3300025922 | Ga0207646_10201736 | Ga0207646_102017362 | 204 |
| 618 | 3300025936 | Ga0207670_10102224 | Ga0207670_101022243 | 204 |
| 619 | 3300026075 | Ga0207708_10022355 | Ga0207708_100223554 | 204 |
| 620 | 3300031548 | Ga0307408_100197185 | Ga0307408_1001971853 | 204 |
| 621 | 3300031911 | Ga0307412_10096525 | Ga0307412_100965253 | 204 |
| 622 | 3300032126 | Ga0307415_101005694 | Ga0307415_1010056942 | 204 |
| 623 | 3300035171 | Ga0373946_0311730 | Ga0373946_0311730_115_744 | 204 |
| 624 | 3300035207 | Ga0373942_0044532 | Ga0373942_0044532_159_788 | 204 |
| 625 | 3300035691 | Ga0373931_0024741 | Ga0373931_0024741_433_1062 | 204 |
| 626 | 3300035695 | Ga0373927_0000877 | Ga0373927_0000877_15379_16008 | 204 |
| 627 | 3300036647 | Ga0316582_0053666 | Ga0316582_0053666_434_1051 | 204 |
| 628 | 3300037068 | Ga0373925_0000619 | Ga0373925_0000619_15023_15652 | 204 |
| 629 | 3300044673 | Ga0453683_0000751 | Ga0453683_0000751_9297_9911 | 204 |
| 630 | 3300044673 | Ga0453683_0019144 | Ga0453683_0019144_3375_3989 | 204 |
| 631 | 3300044712 | Ga0453684_0000044 | Ga0453684_0000044_337619_338239 | 204 |
| 632 | 3300044712 | Ga0453684_0006346 | Ga0453684_0006346_12622_13236 | 204 |
| 633 | 3300044712 | Ga0453684_0042935 | Ga0453684_0042935_5418_6032 | 204 |
| 634 | 3300044712 | Ga0453684_0044547 | Ga0453684_0044547_1784_2401 | 204 |
| 635 | 3300044712 | Ga0453684_0058878 | Ga0453684_0058878_822_1442 | 204 |
| 636 | 3300044712 | Ga0453684_0105276 | Ga0453684_0105276_1065_1679 | 204 |
| 637 | 3300044712 | Ga0453684_0106869 | Ga0453684_0106869_1629_2243 | 204 |
| 638 | 3300044712 | Ga0453684_0173439 | Ga0453684_0173439_1885_2499 | 204 |
| 639 | 3300044712 | Ga0453684_0323615 | Ga0453684_0323615_966_1580 | 204 |
| 640 | 3300044712 | Ga0453684_0685478 | Ga0453684_0685478_95_709 | 204 |
| 641 | 3300044712 | Ga0453684_1067445 | Ga0453684_1067445_174_788 | 204 |
| 642 | 3300045051 | Ga0451576_0009324 | Ga0451576_0009324_9529_10143 | 204 |
| 643 | 3300045051 | Ga0451576_0076393 | Ga0451576_0076393_2160_2774 | 204 |
| 644 | 3300045051 | Ga0451576_0171716 | Ga0451576_0171716_916_1599 | 204 |
| 645 | 3300045051 | Ga0451576_0649266 | Ga0451576_0649266_391_1005 | 204 |
| 646 | 3300050507 | nmdc:mga05p37_7132_c1 | nmdc:mga05p37_7132_c1_10421_11035 | 204 |
| 647 | 3300050507 | nmdc:mga05p37_724645_c1 | nmdc:mga05p37_724645_c1_393_1007 | 204 |
| 648 | 3300050508 | nmdc:mga09592_615488_c1 | nmdc:mga09592_615488_c1_247_861 | 204 |
| 649 | 3300050508 | nmdc:mga09592_69779_c1 | nmdc:mga09592_69779_c1_1352_1966 | 204 |
| 650 | 3300050510 | nmdc:mga06r32_123159_c1 | nmdc:mga06r32_123159_c1_961_1575 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9584 | 1 | 203 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9538 | 2 | 202 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9445 | 2 | 202 |
| 1ka9-assembly1.cif.gz_H | imidazole glycerol phosphate synthase | 0.9396 | 3 | 204 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9353 | 1 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9809 | 4 | 202 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.966 | 4 | 202 | 3.40.50.880 |
| 4gudA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9528 | 2 | 202 | 3.40.50.880 |
| af_Q2FUU1_1_190_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9476 | 4 | 202 | 3.40.50.880 |
| af_P9WMM1_1_205_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9455 | 2 | 202 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350WUG4-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9994 | 45 | 202 |
GO:0000105
GO:0000107 GO:0004359 GO:0006541 GO:0016829 |
| AF-A0A845CHY9-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9919 | 44 | 203 |
GO:0000105
GO:0000107 GO:0006541 GO:0016787 GO:0016829 |
| AF-A0A7C0XJH6-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH | 0.9916 | 29 | 202 |
GO:0000105
GO:0000107 GO:0004359 GO:0006541 GO:0016829 |
| AF-A0A7C3N428-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9907 | 3 | 202 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A3D0UN48-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9892 | 4 | 202 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar