F472540

General Info

Members Datasets Scaffolds Average Seq Length
650 297 646 206

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0230488|Ga0453684_0230488_1200_1964
Length 254
Sequence MTIIKPKRCSKRGRVHWMRPHSLTRGGVGVSLRQKEVCKDDERGKMKDIVLIDAGTGNLRSVQKALENVGASVERTDDPQKVLAAKKVVLPGVGAFGDFMDGMKAKGLDDAVKQVVSRGVPMLGICVGMQALFEIGEEMGEHEGLGLLRGTVVKFADTLSVKIPHTGWNQVQVTRRGLRQKEAALFDQIQDGAYVYFNHSYYCQAGDPSDVIAEVDYGIRYACAVRRENVFGVQFHPEKSQAVGLRILKNFVEA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2643221556 Massilia sp. Root1485 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
195 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
202 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
260 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
261 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0.31
Rhizoplane 1.08
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8347333 2162886011 Unclassified 1213
2 JGI24745J21846_1017595 3300002073 Bacteria 832
3 rootL2_10013282 3300003322 Bacteria 16779
4 JGI25404J52841_10000484 3300003659 Bacteria 5735
5 Ga0065165_1010199 3300005262 Bacteria 4096
6 Ga0065704_10028029 3300005289 Bacteria 1345
7 Ga0065704_10295538 3300005289 Unclassified 895
8 Ga0065712_10088085 3300005290 Bacteria 2539
9 Ga0065715_10007118 3300005293 Bacteria 3336
10 Ga0065707_10002920 3300005295 Bacteria 10925
11 Ga0065707_10084472 3300005295 Bacteria 7165
12 Ga0065707_10153845 3300005295 Unclassified 1629
13 Ga0065707_10343331 3300005295 Bacteria 916
14 Ga0070658_10016196 3300005327 Bacteria 5964
15 Ga0070676_10006282 3300005328 Bacteria 6346
16 Ga0070676_10063748 3300005328 Bacteria 2196
17 Ga0070683_100221656 3300005329 Bacteria 1798
18 Ga0070683_100768096 3300005329 Bacteria 923
19 Ga0070690_100002748 3300005330 Bacteria 9497
20 Ga0070690_100170034 3300005330 Bacteria 1499
21 Ga0070670_100244692 3300005331 Bacteria 1562
22 Ga0070670_100553201 3300005331 Bacteria 1027
23 Ga0070677_10001462 3300005333 Bacteria 7469
24 Ga0070677_10047607 3300005333 Bacteria 1719
25 Ga0070677_10057988 3300005333 Bacteria 1589
26 Ga0068869_100042368 3300005334 Bacteria 3263
27 Ga0068869_100066274 3300005334 Bacteria 2660
28 Ga0068869_100170023 3300005334 Bacteria 1702
29 Ga0068869_100186069 3300005334 Bacteria 1630
30 Ga0070666_10015997 3300005335 Bacteria 4793
31 Ga0070666_10024914 3300005335 Bacteria 3899
32 Ga0070680_100587069 3300005336 Bacteria 956
33 Ga0068868_100062155 3300005338 Bacteria 2959
34 Ga0068868_100402318 3300005338 Bacteria 1182
35 Ga0070660_100270924 3300005339 Bacteria 1388
36 Ga0070689_100065829 3300005340 Bacteria 2823
37 Ga0070689_100130185 3300005340 Bacteria 2017
38 Ga0070691_10063165 3300005341 Bacteria 1785
39 Ga0070687_100001643 3300005343 Bacteria 7985
40 Ga0070661_100586168 3300005344 Unclassified 900
41 Ga0070668_100026632 3300005347 Bacteria 4388
42 Ga0070669_100008311 3300005353 Bacteria 7412
43 Ga0070669_100144637 3300005353 Bacteria 1836
44 Ga0070675_100004051 3300005354 Bacteria 11124
45 Ga0070675_100010384 3300005354 Bacteria 7273
46 Ga0070675_100042811 3300005354 Bacteria 3700
47 Ga0070674_100000382 3300005356 Bacteria 22209
48 Ga0070674_100172151 3300005356 Bacteria 1652
49 Ga0070674_100524855 3300005356 Bacteria 990
50 Ga0070674_100875057 3300005356 Bacteria 781
51 Ga0070673_100008003 3300005364 Bacteria 7002
52 Ga0070673_100046554 3300005364 Bacteria 3370
53 Ga0070673_100097452 3300005364 Bacteria 2415
54 Ga0070673_100263468 3300005364 Bacteria 1506
55 Ga0070688_100006025 3300005365 Bacteria 6433
56 Ga0070688_100097721 3300005365 Bacteria 1931
57 Ga0070688_100363995 3300005365 Bacteria 1062
58 Ga0070659_100045339 3300005366 Bacteria 3444
59 Ga0070659_100076117 3300005366 Bacteria 2676
60 Ga0070659_100126655 3300005366 Bacteria 2072
61 Ga0070659_100482557 3300005366 Bacteria 1055
62 Ga0070667_100054359 3300005367 Bacteria 3380
63 Ga0070667_100363178 3300005367 Unclassified 1313
64 Ga0070709_10563698 3300005434 Bacteria 873
65 Ga0070714_100010038 3300005435 Bacteria 7470
66 Ga0070714_100021490 3300005435 Bacteria 5280
67 Ga0070714_100069618 3300005435 Bacteria 3040
68 Ga0070714_100083015 3300005435 Bacteria 2793
69 Ga0070713_100086314 3300005436 Bacteria 2691
70 Ga0070710_10120622 3300005437 Bacteria 1587
71 Ga0070710_10614665 3300005437 Bacteria 758
72 Ga0070705_100000746 3300005440 Bacteria 18450
73 Ga0070705_100027012 3300005440 Bacteria 3129
74 Ga0070700_100149346 3300005441 Bacteria 1597
75 Ga0070700_100214599 3300005441 Bacteria 1360
76 Ga0070694_100000370 3300005444 Bacteria 24146
77 Ga0070694_100007196 3300005444 Bacteria 6775
78 Ga0070694_100434530 3300005444 Unclassified 1033
79 Ga0070708_100862973 3300005445 Unclassified 850
80 Ga0070663_100272236 3300005455 Bacteria 1347
81 Ga0070678_100007020 3300005456 Bacteria 6656
82 Ga0070678_100048413 3300005456 Bacteria 3061
83 Ga0070678_100511463 3300005456 Bacteria 1061
84 Ga0070662_100031985 3300005457 Bacteria 3696
85 Ga0070662_100055147 3300005457 Bacteria 2883
86 Ga0070662_100551165 3300005457 Bacteria 966
87 Ga0070681_10134031 3300005458 Bacteria 2408
88 Ga0068867_100026117 3300005459 Bacteria 4192
89 Ga0070685_10014872 3300005466 Bacteria 4128
90 Ga0070706_100444829 3300005467 Bacteria 1206
91 Ga0070707_100388659 3300005468 Bacteria 1355
92 Ga0070707_100753836 3300005468 Bacteria 937
93 Ga0070698_100002906 3300005471 Bacteria 18858
94 Ga0070698_100043358 3300005471 Bacteria 4612
95 Ga0070698_100062542 3300005471 Bacteria 3755
96 Ga0070698_100064147 3300005471 Bacteria 3702
97 Ga0070698_100316745 3300005471 Bacteria 1490
98 Ga0070699_100010615 3300005518 Bacteria 7973
99 Ga0070699_100025646 3300005518 Bacteria 5081
100 Ga0070699_100027001 3300005518 Bacteria 4952
101 Ga0070699_100195114 3300005518 Bacteria 1799
102 Ga0070699_100200506 3300005518 Bacteria 1774
103 Ga0070699_100361912 3300005518 Bacteria 1308
104 Ga0070699_100443775 3300005518 Bacteria 1176
105 Ga0070699_100743837 3300005518 Bacteria 897
106 Ga0070679_100532034 3300005530 Bacteria 1119
107 Ga0070697_100156129 3300005536 Bacteria 1926
108 Ga0070672_100008378 3300005543 Bacteria 7067
109 Ga0070672_100145010 3300005543 Bacteria 1961
110 Ga0070672_100379393 3300005543 Bacteria 1209
111 Ga0070686_100009633 3300005544 Bacteria 5430
112 Ga0070695_100000707 3300005545 Bacteria 17815
113 Ga0070696_100000965 3300005546 Bacteria 18625
114 Ga0070696_100058484 3300005546 Bacteria 2692
115 Ga0070693_100052188 3300005547 Bacteria 2344
116 Ga0070665_100024814 3300005548 Bacteria 6040
117 Ga0070704_100003273 3300005549 Bacteria 9255
118 Ga0070704_100171290 3300005549 Bacteria 1727
119 Ga0070704_100276743 3300005549 Bacteria 1389
120 Ga0070704_100277490 3300005549 Bacteria 1387
121 Ga0070664_100001259 3300005564 Bacteria 20292
122 Ga0070664_100002281 3300005564 Bacteria 15422
123 Ga0070664_100117700 3300005564 Bacteria 2324
124 Ga0070664_100621224 3300005564 Bacteria 1003
125 Ga0068857_100120196 3300005577 Bacteria 2365
126 Ga0068857_100362462 3300005577 Bacteria 1344
127 Ga0070702_100010489 3300005615 Bacteria 4564
128 Ga0070702_100114043 3300005615 Bacteria 1681
129 Ga0068852_100363944 3300005616 Bacteria 1415
130 Ga0068859_100037935 3300005617 Bacteria 4835
131 Ga0068859_100126054 3300005617 Bacteria 2629
132 Ga0068859_100419971 3300005617 Bacteria 1434
133 Ga0068859_100848281 3300005617 Bacteria 1000
134 Ga0068864_100028638 3300005618 Bacteria 4710
135 Ga0068864_100045866 3300005618 Bacteria 3750
136 Ga0068864_100229397 3300005618 Bacteria 1717
137 Ga0068864_100372277 3300005618 Bacteria 1352
138 Ga0068864_101382912 3300005618 Bacteria 705
139 Ga0068866_10593310 3300005718 Bacteria 747
140 Ga0068861_100024564 3300005719 Bacteria 4359
141 Ga0068870_10001437 3300005840 Bacteria 9631
142 Ga0068870_10233041 3300005840 Bacteria 1133
143 Ga0068863_100022046 3300005841 Bacteria 6081
144 Ga0068863_100351447 3300005841 Bacteria 1435
145 Ga0068858_100222421 3300005842 Bacteria 1788
146 Ga0068860_100030930 3300005843 Bacteria 5147
147 Ga0068862_100001194 3300005844 Bacteria 24496
148 Ga0068862_100060116 3300005844 Bacteria 3263
149 Ga0081455_10548479 3300005937 Bacteria 765
150 Ga0081540_1000343 3300005983 Bacteria 47660
151 Ga0070717_10007369 3300006028 Bacteria 8170
152 Ga0070717_10010026 3300006028 Bacteria 7131
153 Ga0075366_10039914 3300006195 Unclassified 2775
154 Ga0097621_100090626 3300006237 Bacteria 2559
155 Ga0068871_100013047 3300006358 Bacteria 6159
156 Ga0068871_100096532 3300006358 Bacteria 2470
157 Ga0068871_100501909 3300006358 Bacteria 1093
158 Ga0075428_100000957 3300006844 Bacteria 30618
159 Ga0075428_100027050 3300006844 Bacteria 6351
160 Ga0075428_100047493 3300006844 Bacteria 4715
161 Ga0075428_100281666 3300006844 Bacteria 1789
162 Ga0075428_100608648 3300006844 Bacteria 1167
163 Ga0075430_100000407 3300006846 Bacteria 31945
164 Ga0075430_100079986 3300006846 Bacteria 2738
165 Ga0075430_100268739 3300006846 Bacteria 1412
166 Ga0075430_100348066 3300006846 Bacteria 1224
167 Ga0075431_100014511 3300006847 Bacteria 7971
168 Ga0075431_100017673 3300006847 Bacteria 7250
169 Ga0075431_100137881 3300006847 Bacteria 2515
170 Ga0075433_10001626 3300006852 Bacteria 16666
171 Ga0075433_10008473 3300006852 Bacteria 8207
172 Ga0075433_10122556 3300006852 Bacteria 2309
173 Ga0075433_10169508 3300006852 Bacteria 1943
174 Ga0075434_100011034 3300006871 Bacteria 8502
175 Ga0075434_100060774 3300006871 Bacteria 3759
176 Ga0075434_100074269 3300006871 Bacteria 3394
177 Ga0075434_100080961 3300006871 Bacteria 3244
178 Ga0075429_100008849 3300006880 Bacteria 8750
179 Ga0075429_100045620 3300006880 Bacteria 3813
180 Ga0075429_100051941 3300006880 Bacteria 3566
181 Ga0075429_100186245 3300006880 Bacteria 1819
182 Ga0075429_100646611 3300006880 Unclassified 926
183 Ga0068865_100019564 3300006881 Bacteria 4382
184 Ga0068865_100044873 3300006881 Bacteria 3028
185 Ga0068865_100308639 3300006881 Bacteria 1269
186 Ga0097620_100037937 3300006931 Bacteria 4835
187 Ga0097620_100126058 3300006931 Bacteria 2629
188 Ga0097620_100419969 3300006931 Bacteria 1434
189 Ga0097620_100848259 3300006931 Bacteria 1000
190 Ga0099826_10000048 3300006948 Bacteria 74895
191 Ga0075435_100512230 3300007076 Bacteria 1038
192 Ga0111539_10000937 3300009094 Bacteria 38215
193 Ga0111539_10000967 3300009094 Bacteria 37722
194 Ga0111539_10019325 3300009094 Bacteria 8412
195 Ga0111539_10057520 3300009094 Bacteria 4618
196 Ga0111539_10129980 3300009094 Unclassified 2949
197 Ga0111539_10862984 3300009094 Bacteria 1053
198 Ga0105245_10002584 3300009098 Bacteria 16303
199 Ga0105245_10496610 3300009098 Bacteria 1236
200 Ga0114129_10013246 3300009147 Bacteria 11746
201 Ga0114129_10017625 3300009147 Bacteria 10167
202 Ga0114129_10020095 3300009147 Bacteria 9506
203 Ga0114129_10026025 3300009147 Bacteria 8285
204 Ga0114129_10028768 3300009147 Bacteria 7873
205 Ga0114129_10034743 3300009147 Bacteria 7122
206 Ga0114129_10053445 3300009147 Bacteria 5664
207 Ga0114129_10164109 3300009147 Bacteria 3032
208 Ga0114129_10247158 3300009147 Bacteria 2396
209 Ga0114129_10302722 3300009147 Bacteria 2130
210 Ga0114129_10657669 3300009147 Bacteria 1352
211 Ga0114129_10792452 3300009147 Bacteria 1210
212 Ga0114129_11210104 3300009147 Bacteria 940
213 Ga0105243_10094326 3300009148 Bacteria 2471
214 Ga0105243_10143083 3300009148 Bacteria 2043
215 Ga0105243_10547539 3300009148 Bacteria 1105
216 Ga0105243_10584187 3300009148 Bacteria 1073
217 Ga0105241_10218667 3300009174 Bacteria 1600
218 Ga0105241_10455451 3300009174 Bacteria 1132
219 Ga0105242_10173243 3300009176 Bacteria 1898
220 Ga0105242_10351275 3300009176 Bacteria 1362
221 Ga0105242_10388503 3300009176 Unclassified 1299
222 Ga0105248_10038535 3300009177 Bacteria 5349
223 Ga0105248_10051528 3300009177 Bacteria 4619
224 Ga0105248_10357202 3300009177 Bacteria 1645
225 Ga0105238_10039789 3300009551 Bacteria 4767
226 Ga0105238_10094723 3300009551 Bacteria 2974
227 Ga0105249_10025302 3300009553 Bacteria 5342
228 Ga0105249_11132369 3300009553 Unclassified 853
229 Ga0105249_11137840 3300009553 Bacteria 851
230 Ga0105239_10020840 3300010375 Bacteria 7232
231 Ga0105246_10012177 3300011119 Bacteria 5359
232 Ga0105246_10130692 3300011119 Bacteria 1875
233 Ga0157373_10019614 3300013100 Bacteria 4918
234 Ga0157370_10791486 3300013104 Unclassified 863
235 Ga0157378_10006769 3300013297 Bacteria 10014
236 Ga0157378_10010539 3300013297 Bacteria 8077
237 Ga0163162_10021845 3300013306 Bacteria 6304
238 Ga0163162_10056855 3300013306 Bacteria 3940
239 Ga0163162_10113990 3300013306 Bacteria 2802
240 Ga0157372_10346283 3300013307 Bacteria 1731
241 Ga0157375_10057570 3300013308 Bacteria 3843
242 Ga0157375_10119828 3300013308 Bacteria 2739
243 Ga0157375_10483841 3300013308 Bacteria 1403
244 Ga0157375_11395635 3300013308 Bacteria 825
245 Ga0163163_10043571 3300014325 Bacteria 4400
246 Ga0163163_10112756 3300014325 Bacteria 2749
247 Ga0157380_10007797 3300014326 Bacteria 7618
248 Ga0157380_10010846 3300014326 Bacteria 6570
249 Ga0157380_10258555 3300014326 Bacteria 1580
250 Ga0157380_10509897 3300014326 Unclassified 1170
251 Ga0157377_10010852 3300014745 Bacteria 4524
252 Ga0157377_10017096 3300014745 Bacteria 3746
253 Ga0157377_10101868 3300014745 Bacteria 1712
254 Ga0157377_10157863 3300014745 Bacteria 1408
255 Ga0157379_10053964 3300014968 Bacteria 3591
256 Ga0157376_10096440 3300014969 Bacteria 2574
257 Ga0157376_10724084 3300014969 Bacteria 1002
258 Ga0213875_10010188 3300021388 Bacteria 4721
259 Ga0213875_10081824 3300021388 Bacteria 1507
260 Ga0213875_10089555 3300021388 Bacteria 1435
261 Ga0207697_10000701 3300025315 Bacteria 19066
262 Ga0207682_10000378 3300025893 Bacteria 20628
263 Ga0207682_10006209 3300025893 Bacteria 4828
264 Ga0207682_10108087 3300025893 Bacteria 1222
265 Ga0207692_10354613 3300025898 Bacteria 905
266 Ga0207688_10000628 3300025901 Bacteria 17382
267 Ga0207688_10064495 3300025901 Bacteria 2069
268 Ga0207688_10092509 3300025901 Bacteria 1738
269 Ga0207680_10117032 3300025903 Bacteria 1738
270 Ga0207645_10001911 3300025907 Bacteria 16819
271 Ga0207645_10110203 3300025907 Bacteria 1781
272 Ga0207643_10000925 3300025908 Bacteria 17575
273 Ga0207643_10010788 3300025908 Bacteria 4927
274 Ga0207707_10553279 3300025912 Unclassified 977
275 Ga0207695_10371589 3300025913 Bacteria 1316
276 Ga0207660_10083025 3300025917 Bacteria 2358
277 Ga0207662_10058324 3300025918 Bacteria 2311
278 Ga0207657_10583565 3300025919 Bacteria 873
279 Ga0207649_10060738 3300025920 Bacteria 2376
280 Ga0207649_10558307 3300025920 Unclassified 877
281 Ga0207646_10201736 3300025922 Bacteria 1797
282 Ga0207646_10267344 3300025922 Bacteria 1546
283 Ga0207646_10275793 3300025922 Bacteria 1520
284 Ga0207681_10125365 3300025923 Bacteria 1890
285 Ga0207681_10496619 3300025923 Bacteria 998
286 Ga0207694_10061145 3300025924 Bacteria 2931
287 Ga0207694_10200947 3300025924 Bacteria 1621
288 Ga0207650_10006335 3300025925 Bacteria 8065
289 Ga0207659_10004292 3300025926 Bacteria 8618
290 Ga0207659_10012850 3300025926 Bacteria 5346
291 Ga0207659_10024302 3300025926 Bacteria 4058
292 Ga0207659_10034223 3300025926 Bacteria 3501
293 Ga0207687_10043361 3300025927 Bacteria 3099
294 Ga0207687_10133765 3300025927 Bacteria 1873
295 Ga0207700_10698984 3300025928 Bacteria 905
296 Ga0207664_10018238 3300025929 Bacteria 5160
297 Ga0207664_10038395 3300025929 Bacteria 3713
298 Ga0207664_10532492 3300025929 Bacteria 1053
299 Ga0207690_10174801 3300025932 Bacteria 1612
300 Ga0207690_10178091 3300025932 Bacteria 1598
301 Ga0207706_10041238 3300025933 Bacteria 4092
302 Ga0207706_10042421 3300025933 Bacteria 4032
303 Ga0207706_10298736 3300025933 Bacteria 1403
304 Ga0207706_10837028 3300025933 Unclassified 780
305 Ga0207686_10086326 3300025934 Bacteria 2061
306 Ga0207686_10412108 3300025934 Bacteria 1032
307 Ga0207709_10329660 3300025935 Bacteria 1145
308 Ga0207670_10071424 3300025936 Bacteria 2401
309 Ga0207670_10102224 3300025936 Bacteria 2049
310 Ga0207670_10454502 3300025936 Bacteria 1033
311 Ga0207669_10000517 3300025937 Bacteria 16886
312 Ga0207704_10067906 3300025938 Bacteria 2245
313 Ga0207704_10171661 3300025938 Bacteria 1556
314 Ga0207691_10005381 3300025940 Bacteria 12358
315 Ga0207691_10023122 3300025940 Bacteria 5853
316 Ga0207691_10025557 3300025940 Bacteria 5542
317 Ga0207691_10485310 3300025940 Bacteria 1050
318 Ga0207691_10953006 3300025940 Unclassified 717
319 Ga0207689_10001594 3300025942 Bacteria 21468
320 Ga0207689_10014043 3300025942 Bacteria 6816
321 Ga0207689_10066220 3300025942 Bacteria 2971
322 Ga0207689_10073568 3300025942 Bacteria 2807
323 Ga0207661_10639358 3300025944 Bacteria 978
324 Ga0207679_10030495 3300025945 Bacteria 3766
325 Ga0207679_10030688 3300025945 Bacteria 3755
326 Ga0207679_10593989 3300025945 Bacteria 997
327 Ga0207667_10083019 3300025949 Bacteria 3318
328 Ga0207651_10038468 3300025960 Bacteria 3145
329 Ga0207651_10287766 3300025960 Bacteria 1361
330 Ga0207712_10020945 3300025961 Bacteria 4289
331 Ga0207668_10026763 3300025972 Bacteria 3750
332 Ga0207668_10289143 3300025972 Bacteria 1348
333 Ga0207668_10573722 3300025972 Bacteria 980
334 Ga0207658_10068874 3300025986 Bacteria 2672
335 Ga0207677_10368247 3300026023 Bacteria 1209
336 Ga0207703_10415509 3300026035 Unclassified 1251
337 Ga0207703_11126334 3300026035 Bacteria 754
338 Ga0207708_10008381 3300026075 Bacteria 7651
339 Ga0207708_10022355 3300026075 Bacteria 4776
340 Ga0207708_10198880 3300026075 Bacteria 1598
341 Ga0207708_10331459 3300026075 Bacteria 1244
342 Ga0207702_10066986 3300026078 Bacteria 3080
343 Ga0207641_10007161 3300026088 Bacteria 9311
344 Ga0207648_10005974 3300026089 Bacteria 12169
345 Ga0207648_10066022 3300026089 Bacteria 3155
346 Ga0207648_10110545 3300026089 Bacteria 2412
347 Ga0207648_10120681 3300026089 Bacteria 2305
348 Ga0207676_10024241 3300026095 Bacteria 4487
349 Ga0207676_10456637 3300026095 Bacteria 1205
350 Ga0207674_10091188 3300026116 Bacteria 3038
351 Ga0207674_10158407 3300026116 Bacteria 2219
352 Ga0207675_100012877 3300026118 Bacteria 7814
353 Ga0207675_100049984 3300026118 Bacteria 3902
354 Ga0207675_100207046 3300026118 Bacteria 1885
355 Ga0207675_100263578 3300026118 Bacteria 1671
356 Ga0207683_10018406 3300026121 Bacteria 5961
357 Ga0207683_10521239 3300026121 Bacteria 1098
358 Ga0207683_10744142 3300026121 Unclassified 909
359 Ga0207698_10185000 3300026142 Bacteria 1849
360 Ga0207698_10433619 3300026142 Bacteria 1264
361 Ga0209282_1000066 3300027666 Bacteria 87072
362 Ga0207428_10001370 3300027907 Bacteria 25833
363 Ga0207428_10001377 3300027907 Bacteria 25761
364 Ga0207428_10003546 3300027907 Bacteria 15078
365 Ga0207428_10304272 3300027907 Bacteria 1179
366 Ga0268265_10023143 3300028380 Bacteria 4376
367 Ga0268265_10299680 3300028380 Bacteria 1447
368 Ga0268265_10833005 3300028380 Bacteria 901
369 Ga0268264_10009037 3300028381 Bacteria 8267
370 Ga0268264_10950229 3300028381 Bacteria 865
371 Ga0316182_1155512 3300030745 Bacteria 2754
372 Ga0316182_1171651 3300030745 Bacteria 2684
373 Ga0307513_10010905 3300031456 Bacteria 11350
374 Ga0307408_100052597 3300031548 Bacteria 2938
375 Ga0307408_100054766 3300031548 Bacteria 2885
376 Ga0307408_100111987 3300031548 Bacteria 2098
377 Ga0307408_100115010 3300031548 Bacteria 2074
378 Ga0307408_100197185 3300031548 Bacteria 1627
379 Ga0316575_10047892 3300031665 Bacteria 1699
380 Ga0316575_10080144 3300031665 Bacteria 1317
381 Ga0316579_10039683 3300031691 Bacteria 2182
382 Ga0265314_10001478 3300031711 Bacteria 26143
383 Ga0316576_10119634 3300031727 Bacteria 1977
384 Ga0316578_10009462 3300031728 Bacteria 5016
385 Ga0316578_10478552 3300031728 Bacteria 735
386 Ga0316577_10006149 3300031733 Bacteria 6327
387 Ga0316577_10014824 3300031733 Bacteria 4285
388 Ga0316577_10055102 3300031733 Bacteria 2219
389 Ga0316577_10092918 3300031733 Bacteria 1689
390 Ga0316577_10115741 3300031733 Bacteria 1505
391 Ga0316577_10381695 3300031733 Bacteria 800
392 Ga0307413_10383889 3300031824 Bacteria 1095
393 Ga0307413_10620748 3300031824 Bacteria 887
394 Ga0307410_10007671 3300031852 Bacteria 5922
395 Ga0307410_10041277 3300031852 Bacteria 3042
396 Ga0307410_10115491 3300031852 Bacteria 1949
397 Ga0307410_10525049 3300031852 Bacteria 977
398 Ga0307406_10108406 3300031901 Bacteria 1907
399 Ga0307406_10142006 3300031901 Bacteria 1701
400 Ga0307407_10043843 3300031903 Bacteria 2517
401 Ga0307412_10096525 3300031911 Bacteria 2081
402 Ga0307412_10098464 3300031911 Unclassified 2063
403 Ga0307409_100016937 3300031995 Bacteria 4841
404 Ga0307416_100029545 3300032002 Bacteria 4097
405 Ga0307416_100117086 3300032002 Bacteria 2364
406 Ga0307416_100752467 3300032002 Bacteria 1067
407 Ga0307414_10397949 3300032004 Bacteria 1195
408 Ga0307411_10027803 3300032005 Bacteria 3429
409 Ga0307411_10041838 3300032005 Bacteria 2919
410 Ga0307411_10043240 3300032005 Bacteria 2881
411 Ga0307415_100023986 3300032126 Bacteria 3800
412 Ga0307415_101005694 3300032126 Bacteria 775
413 Ga0316585_10057566 3300032137 Bacteria 1252
414 Ga0316585_10080425 3300032137 Bacteria 1061
415 Ga0373940_0005259 3300035088 Bacteria 2792
416 Ga0373944_0126183 3300035089 Bacteria 886
417 Ga0373945_0067394 3300035116 Bacteria 1348
418 Ga0373946_0311730 3300035171 Bacteria 780
419 Ga0373942_0044532 3300035207 Bacteria 1223
420 Ga0373931_0024741 3300035691 Bacteria 3045
421 Ga0373927_0000877 3300035695 Bacteria 22917
422 Ga0373927_0516174 3300035695 Archaea 790
423 Ga0316582_0020285 3300036647 Bacteria 3905
424 Ga0316582_0053666 3300036647 Bacteria 2564
425 Ga0316582_0060279 3300036647 Bacteria 2432
426 Ga0316584_0001965 3300036712 Bacteria 12831
427 Ga0316584_0011979 3300036712 Bacteria 6109
428 Ga0316584_0650675 3300036712 Bacteria 726
429 Ga0373925_0000619 3300037068 Bacteria 33906
430 Ga0373925_0267422 3300037068 Bacteria 1375
431 Ga0395900_0109043 3300037418 Bacteria 2844
432 Ga0395900_0386577 3300037418 Bacteria 1366
433 Ga0395905_0001509 3300037471 Bacteria 27821
434 Ga0316581_0002269 3300037588 Bacteria 4556
435 Ga0316581_0015740 3300037588 Bacteria 2165
436 Ga0436364_0183835 3300037853 Bacteria 1037
437 Ga0436364_0334136 3300037853 Bacteria 2801
438 Ga0436364_1193035 3300037853 Bacteria 6898
439 Ga0400490_56435 3300038726 Bacteria 4635
440 Ga0400489_73490 3300039093 Bacteria 42457
441 Ga0400489_76266 3300039093 Bacteria 1161
442 Ga0436365_0055431 3300039437 Bacteria 809
443 Ga0436365_0461265 3300039437 Bacteria 3511
444 Ga0436363_0394035 3300039450 Unclassified 1460
445 Ga0439450_020510 3300042008 Bacteria 1411
446 Ga0439462_0069144 3300042015 Unclassified 958
447 Ga0439435_0032586 3300042436 Bacteria 1422
448 Ga0451577_0005780 3300042876 Bacteria 12536
449 Ga0466969_0296577 3300044656 Unclassified 732
450 Ga0466972_0068060 3300044658 Bacteria 1701
451 Ga0453683_0000751 3300044673 Bacteria 32744
452 Ga0453683_0000845 3300044673 Bacteria 29598
453 Ga0453683_0019144 3300044673 Bacteria 4385
454 Ga0453683_0019430 3300044673 Bacteria 4351
455 Ga0466965_0106623 3300044683 Bacteria 1437
456 Ga0466966_0073122 3300044684 Bacteria 2145
457 Ga0466966_0101704 3300044684 Bacteria 1777
458 Ga0453684_0000044 3300044712 Bacteria 585643
459 Ga0453684_0006346 3300044712 Bacteria 22552
460 Ga0453684_0023147 3300044712 Bacteria 9170
461 Ga0453684_0027034 3300044712 Bacteria 8252
462 Ga0453684_0035665 3300044712 Bacteria 6871
463 Ga0453684_0042935 3300044712 Bacteria 6086
464 Ga0453684_0044547 3300044712 Bacteria 5934
465 Ga0453684_0054823 3300044712 Bacteria 5188
466 Ga0453684_0058878 3300044712 Bacteria 4958
467 Ga0453684_0105276 3300044712 Bacteria 3441
468 Ga0453684_0106869 3300044712 Bacteria 3409
469 Ga0453684_0162323 3300044712 Unclassified 2642
470 Ga0453684_0173439 3300044712 Bacteria 2539
471 Ga0453684_0230488 3300044712 Bacteria 2138
472 Ga0453684_0323615 3300044712 Bacteria 1745
473 Ga0453684_0331656 3300044712 Unclassified 1720
474 Ga0453684_0381510 3300044712 Unclassified 1582
475 Ga0453684_0656887 3300044712 Bacteria 1144
476 Ga0453684_0685478 3300044712 Bacteria 1115
477 Ga0453684_0760972 3300044712 Bacteria 1048
478 Ga0453684_1007825 3300044712 Unclassified 885
479 Ga0453684_1067445 3300044712 Unclassified 855
480 Ga0466970_0022802 3300044765 Bacteria 3267
481 Ga0466959_0003996 3300045049 Bacteria 9801
482 Ga0466959_0025843 3300045049 Bacteria 4354
483 Ga0466959_0351463 3300045049 Bacteria 1005
484 Ga0451576_0009324 3300045051 Bacteria 11396
485 Ga0451576_0024922 3300045051 Bacteria 6455
486 Ga0451576_0048913 3300045051 Bacteria 4438
487 Ga0451576_0076393 3300045051 Unclassified 3485
488 Ga0451576_0171716 3300045051 Bacteria 2263
489 Ga0451576_0212808 3300045051 Bacteria 2018
490 Ga0451576_0415085 3300045051 Bacteria 1412
491 Ga0451576_0483280 3300045051 Bacteria 1301
492 Ga0451576_0501266 3300045051 Bacteria 1275
493 Ga0451576_0649266 3300045051 Unclassified 1109
494 Ga0466958_0008664 3300045836 Bacteria 5648
495 Ga0466958_0036525 3300045836 Bacteria 2941
496 Ga0466967_0044879 3300045976 Bacteria 3837
497 Ga0466967_0403018 3300045976 Bacteria 1331
498 Ga0495603_0059674 3300046455 Bacteria 2255
499 Ga0495603_0117581 3300046455 Bacteria 1550
500 Ga0495603_0164153 3300046455 Bacteria 1288
501 Ga0495629_0002871 3300046459 Bacteria 13168
502 Ga0495580_0000641 3300046472 Bacteria 29670
503 Ga0495580_0013676 3300046472 Bacteria 6184
504 Ga0495582_0092109 3300046473 Bacteria 1691
505 Ga0495605_0000498 3300046474 Bacteria 33768
506 Ga0495605_0033767 3300046474 Bacteria 2595
507 Ga0495639_0152379 3300046475 Bacteria 1116
508 Ga0495639_0240730 3300046475 Bacteria 893
509 Ga0495662_0148668 3300046476 Bacteria 1154
510 Ga0495584_0000037 3300046491 Bacteria 93892
511 Ga0495584_0025348 3300046491 Bacteria 3006
512 Ga0495584_0073883 3300046491 Bacteria 1713
513 Ga0495594_0004891 3300046499 Bacteria 6897
514 Ga0495594_0089263 3300046499 Bacteria 1726
515 Ga0495596_0091050 3300046500 Bacteria 1184
516 Ga0495607_0000961 3300046501 Bacteria 26647
517 Ga0495607_0043698 3300046501 Bacteria 2647
518 Ga0495606_0031701 3300046507 Bacteria 3671
519 Ga0495606_0124092 3300046507 Bacteria 1542
520 Ga0495616_0095550 3300046513 Bacteria 1400
521 Ga0495643_0004358 3300046522 Bacteria 9925
522 Ga0495643_0005453 3300046522 Bacteria 8602
523 Ga0495643_0058556 3300046522 Bacteria 2050
524 Ga0495644_0262574 3300046523 Bacteria 672
525 Ga0495648_0003051 3300046524 Bacteria 14986
526 Ga0495648_0050064 3300046524 Bacteria 2556
527 Ga0495642_0013883 3300046528 Bacteria 3119
528 Ga0495642_0070881 3300046528 Bacteria 1457
529 Ga0495654_0008763 3300046530 Bacteria 5567
530 Ga0495598_0028879 3300046537 Bacteria 1541
531 Ga0495598_0077173 3300046537 Bacteria 1061
532 Ga0495598_0188512 3300046537 Bacteria 739
533 Ga0495609_0006777 3300046538 Bacteria 5799
534 Ga0495609_0043757 3300046538 Bacteria 2010
535 Ga0495621_0005334 3300046539 Bacteria 3685
536 Ga0495621_0020422 3300046539 Bacteria 2174
537 Ga0495645_0343761 3300046543 Bacteria 963
538 Ga0495668_0007671 3300046616 Bacteria 6865
539 Ga0495659_0036011 3300046664 Bacteria 1746
540 Ga0495661_0001505 3300046665 Bacteria 19415
541 Ga0495661_0005604 3300046665 Bacteria 8905
542 Ga0495661_0008756 3300046665 Bacteria 6983
543 Ga0495588_0030217 3300046674 Bacteria 2722
544 Ga0495658_0036949 3300046683 Bacteria 2698
545 Ga0495669_0002671 3300046684 Bacteria 7300
546 Ga0495669_0091290 3300046684 Bacteria 1406
547 Ga0495669_0111569 3300046684 Bacteria 1277
548 Ga0495670_0210218 3300046691 Bacteria 1032
549 Ga0495649_0001229 3300046694 Bacteria 19728
550 Ga0495649_0027410 3300046694 Bacteria 3162
551 Ga0495649_0354164 3300046694 Bacteria 741
552 Ga0495589_0001577 3300046794 Bacteria 13107
553 Ga0495589_0002196 3300046794 Bacteria 10981
554 Ga0495589_0105626 3300046794 Bacteria 1361
555 Ga0495660_0000033 3300046810 Bacteria 212425
556 Ga0495660_0014126 3300046810 Bacteria 4624
557 Ga0495581_0500994 3300047315 Unclassified 706
558 Ga0495604_0111911 3300047317 Bacteria 1990
559 Ga0495674_0492619 3300047319 Bacteria 981
560 Ga0495672_0001901 3300047320 Bacteria 19859
561 Ga0495672_0002129 3300047320 Bacteria 18558
562 Ga0495672_0073834 3300047320 Bacteria 1922
563 Ga0495676_0017131 3300047321 Bacteria 6412
564 Ga0495683_0004048 3300047323 Bacteria 8411
565 Ga0495683_0006783 3300047323 Bacteria 6225
566 Ga0495687_000344 3300047443 Bacteria 59580
567 Ga0495677_0002111 3300047445 Bacteria 7883
568 Ga0495677_0032453 3300047445 Bacteria 1902
569 Ga0495685_031336 3300047447 Bacteria 1828
570 Ga0495626_0000160 3300048091 Bacteria 83120
571 Ga0496101_0363508 3300048904 Bacteria 1138
572 Ga0496108_0264391 3300048911 Bacteria 1497
573 Ga0496109_0350357 3300048912 Bacteria 1395
574 Ga0496109_0615328 3300048912 Bacteria 1023
575 Ga0496110_0339636 3300048913 Bacteria 1368
576 Ga0496110_0549034 3300048913 Bacteria 1050
577 Ga0496111_0259682 3300048914 Bacteria 1289
578 Ga0496116_0001420 3300048919 Bacteria 26933
579 Ga0496122_0045465 3300048925 Bacteria 3412
580 Ga0496122_0082972 3300048925 Bacteria 2224
581 Ga0496123_0002004 3300048926 Bacteria 26310
582 Ga0496123_0003975 3300048926 Bacteria 16012
583 Ga0496124_0104882 3300048927 Bacteria 2285
584 Ga0496124_0315035 3300048927 Bacteria 1123
585 Ga0496125_0000807 3300048928 Bacteria 50911
586 Ga0496126_0002667 3300048929 Bacteria 23631
587 Ga0501036_0123288 3300049572 Bacteria 2189
588 Ga0501036_0594649 3300049572 Bacteria 918
589 Ga0501046_0360902 3300049580 Unclassified 1054
590 Ga0501048_0119875 3300049582 Bacteria 1859
591 Ga0501071_0269908 3300049587 Unclassified 1286
592 Ga0501072_0987788 3300049588 Unclassified 656
593 Ga0501074_0369458 3300049590 Unclassified 1018
594 Ga0501075_0066467 3300049591 Bacteria 2721
595 Ga0501075_0105020 3300049591 Unclassified 2147
596 Ga0501075_0392314 3300049591 Bacteria 1058
597 Ga0501076_0319150 3300049592 Unclassified 1274
598 Ga0501045_0101486 3300049824 Unclassified 2130
599 nmdc:mga0k408_14188_c2 3300050493 Unclassified 3886
600 nmdc:mga05p37_119351_c1 3300050507 Bacteria 3240
601 nmdc:mga05p37_241_c1 3300050507 Bacteria 55841
602 nmdc:mga05p37_273235_c1 3300050507 Bacteria 2018
603 nmdc:mga05p37_7132_c1 3300050507 Bacteria 13178
604 nmdc:mga05p37_724645_c1 3300050507 Bacteria 1101
605 nmdc:mga05p37_99269_c1 3300050507 Bacteria 3586
606 nmdc:mga09592_10011_c1 3300050508 Bacteria 7710
607 nmdc:mga09592_10619_c1 3300050508 Bacteria 7499
608 nmdc:mga09592_168895_c1 3300050508 Bacteria 1891
609 nmdc:mga09592_27132_c1 3300050508 Bacteria 4751
610 nmdc:mga09592_45514_c1 3300050508 Bacteria 3696
611 nmdc:mga09592_50982_c1 3300050508 Bacteria 3491
612 nmdc:mga09592_615488_c1 3300050508 Bacteria 929
613 nmdc:mga09592_69779_c1 3300050508 Bacteria 2981
614 nmdc:mga0qj67_31529_c1 3300050509 Bacteria 4129
615 nmdc:mga0qj67_60595_c1 3300050509 Bacteria 3004
616 nmdc:mga0qj67_898_c1 3300050509 Bacteria 20435
617 nmdc:mga06r32_123159_c1 3300050510 Bacteria 2559
618 nmdc:mga06r32_336659_c1 3300050510 Bacteria 1494
619 nmdc:mga06r32_4916_c1 3300050510 Bacteria 12037
620 nmdc:mga06r32_705086_c1 3300050510 Bacteria 975
621 nmdc:mga06r32_7152_c1 3300050510 Bacteria 10057
622 nmdc:mga08y16_142240_c1 3300050511 Bacteria 2494
623 nmdc:mga08y16_196413_c1 3300050511 Bacteria 2091
624 nmdc:mga08y16_2371_c1 3300050511 Bacteria 14345
625 nmdc:mga08y16_333519_c1 3300050511 Bacteria 1560
626 nmdc:mga08y16_52853_c1 3300050511 Bacteria 4249
627 nmdc:mga08y16_743_c1 3300050511 Bacteria 31040
628 nmdc:mga0n895_105523_c1 3300050512 Bacteria 2830
629 nmdc:mga0n895_31629_c1 3300050512 Bacteria 5069
630 nmdc:mga0n895_363130_c1 3300050512 Bacteria 1466
631 nmdc:mga0n895_77249_c1 3300050512 Bacteria 3312
632 nmdc:mga0n895_83538_c1 3300050512 Bacteria 3186
633 nmdc:mga0n895_90797_c1 3300050512 Bacteria 3057
634 nmdc:mga0rr50_608263_c1 3300050513 Unclassified 932
635 nmdc:mga0a205_139050_c1 3300050515 Bacteria 2329
636 nmdc:mga0a205_233846_c1 3300050515 Bacteria 1720
637 nmdc:mga0a205_2928_c1 3300050515 Bacteria 15120
638 nmdc:mga0a205_5356_c1 3300050515 Bacteria 11561
639 nmdc:mga0a205_61143_c1 3300050515 Bacteria 3638
640 nmdc:mga0a205_72610_c1 3300050515 Bacteria 3325
641 Ga0495601_0459638 3300053077 Bacteria 823
642 Ga0501084_0296031 3300054114 Bacteria 1367
643 Ga0590077_008463 3300059426 Bacteria 2107
644 Ga0501082_0039026 3300060353 Bacteria 4096
645 Ga0466962_0018348 3300061719 Bacteria 3366
646 Ga0530510_0659933 3300061734 Bacteria 796

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042015 Ga0439462_0069144 Ga0439462_0069144_365_931 186
2 3300044684 Ga0466966_0101704 Ga0466966_0101704_17_586 186
3 3300046500 Ga0495596_0091050 Ga0495596_0091050_601_1170 186
4 3300048926 Ga0496123_0003975 Ga0496123_0003975_1909_2478 186
5 3300005840 Ga0068870_10233041 Ga0068870_102330412 187
6 3300035116 Ga0373945_0067394 Ga0373945_0067394_172_783 192
7 3300035695 Ga0373927_0516174 Ga0373927_0516174_136_747 192
8 3300037068 Ga0373925_0267422 Ga0373925_0267422_669_1280 192
9 3300046475 Ga0495639_0240730 Ga0495639_0240730_199_810 192
10 3300046499 Ga0495594_0004891 Ga0495594_0004891_5330_5974 192
11 3300046539 Ga0495621_0005334 Ga0495621_0005334_849_1493 192
12 3300046674 Ga0495588_0030217 Ga0495588_0030217_837_1481 192
13 3300005356 Ga0070674_100172151 Ga0070674_1001721512 193
14 3300006881 Ga0068865_100044873 Ga0068865_1000448733 193
15 3300013308 Ga0157375_11395635 Ga0157375_113956351 193
16 3300025938 Ga0207704_10171661 Ga0207704_101716612 193
17 3300025972 Ga0207668_10289143 Ga0207668_102891432 193
18 3300045051 Ga0451576_0415085 Ga0451576_0415085_544_1140 193
19 3300046455 Ga0495603_0059674 Ga0495603_0059674_263_886 193
20 3300046794 Ga0495589_0105626 Ga0495589_0105626_309_902 193
21 3300048904 Ga0496101_0363508 Ga0496101_0363508_301_897 193
22 3300005329 Ga0070683_100221656 Ga0070683_1002216563 194
23 3300005330 Ga0070690_100170034 Ga0070690_1001700342 194
24 3300005334 Ga0068869_100066274 Ga0068869_1000662743 194
25 3300005334 Ga0068869_100186069 Ga0068869_1001860692 194
26 3300005338 Ga0068868_100402318 Ga0068868_1004023181 194
27 3300005339 Ga0070660_100270924 Ga0070660_1002709242 194
28 3300005366 Ga0070659_100126655 Ga0070659_1001266552 194
29 3300005440 Ga0070705_100027012 Ga0070705_1000270122 194
30 3300005444 Ga0070694_100007196 Ga0070694_1000071961 194
31 3300005445 Ga0070708_100862973 Ga0070708_1008629731 194
32 3300005456 Ga0070678_100048413 Ga0070678_1000484134 194
33 3300005458 Ga0070681_10134031 Ga0070681_101340311 194
34 3300005468 Ga0070707_100753836 Ga0070707_1007538362 194
35 3300005471 Ga0070698_100062542 Ga0070698_1000625424 194
36 3300005518 Ga0070699_100010615 Ga0070699_1000106156 194
37 3300005546 Ga0070696_100058484 Ga0070696_1000584842 194
38 3300005547 Ga0070693_100052188 Ga0070693_1000521884 194
39 3300005549 Ga0070704_100003273 Ga0070704_1000032734 194
40 3300005564 Ga0070664_100117700 Ga0070664_1001177002 194
41 3300005577 Ga0068857_100120196 Ga0068857_1001201964 194
42 3300005618 Ga0068864_100372277 Ga0068864_1003722772 194
43 3300005841 Ga0068863_100351447 Ga0068863_1003514471 194
44 3300005843 Ga0068860_100030930 Ga0068860_1000309306 194
45 3300006358 Ga0068871_100096532 Ga0068871_1000965322 194
46 3300006871 Ga0075434_100080961 Ga0075434_1000809612 194
47 3300009098 Ga0105245_10002584 Ga0105245_1000258415 194
48 3300009098 Ga0105245_10496610 Ga0105245_104966102 194
49 3300009147 Ga0114129_10164109 Ga0114129_101641093 194
50 3300009148 Ga0105243_10094326 Ga0105243_100943263 194
51 3300009174 Ga0105241_10218667 Ga0105241_102186672 194
52 3300009174 Ga0105241_10455451 Ga0105241_104554512 194
53 3300009176 Ga0105242_10173243 Ga0105242_101732432 194
54 3300009176 Ga0105242_10351275 Ga0105242_103512752 194
55 3300009176 Ga0105242_10388503 Ga0105242_103885031 194
56 3300009177 Ga0105248_10051528 Ga0105248_100515282 194
57 3300009551 Ga0105238_10039789 Ga0105238_100397893 194
58 3300009551 Ga0105238_10094723 Ga0105238_100947234 194
59 3300009553 Ga0105249_11137840 Ga0105249_111378402 194
60 3300010375 Ga0105239_10020840 Ga0105239_100208406 194
61 3300013297 Ga0157378_10006769 Ga0157378_100067694 194
62 3300013306 Ga0163162_10113990 Ga0163162_101139904 194
63 3300013307 Ga0157372_10346283 Ga0157372_103462832 194
64 3300014325 Ga0163163_10112756 Ga0163163_101127562 194
65 3300014969 Ga0157376_10724084 Ga0157376_107240842 194
66 3300025912 Ga0207707_10553279 Ga0207707_105532791 194
67 3300025913 Ga0207695_10371589 Ga0207695_103715892 194
68 3300025922 Ga0207646_10275793 Ga0207646_102757932 194
69 3300025924 Ga0207694_10061145 Ga0207694_100611454 194
70 3300025924 Ga0207694_10200947 Ga0207694_102009472 194
71 3300025927 Ga0207687_10043361 Ga0207687_100433612 194
72 3300025934 Ga0207686_10086326 Ga0207686_100863263 194
73 3300025938 Ga0207704_10067906 Ga0207704_100679063 194
74 3300025942 Ga0207689_10014043 Ga0207689_100140434 194
75 3300025945 Ga0207679_10030495 Ga0207679_100304955 194
76 3300025949 Ga0207667_10083019 Ga0207667_100830194 194
77 3300026078 Ga0207702_10066986 Ga0207702_100669862 194
78 3300026116 Ga0207674_10158407 Ga0207674_101584072 194
79 3300026142 Ga0207698_10185000 Ga0207698_101850002 194
80 3300028381 Ga0268264_10009037 Ga0268264_100090376 194
81 3300028381 Ga0268264_10950229 Ga0268264_109502292 194
82 3300035089 Ga0373944_0126183 Ga0373944_0126183_279_872 194
83 3300046455 Ga0495603_0117581 Ga0495603_0117581_281_874 194
84 3300046475 Ga0495639_0152379 Ga0495639_0152379_63_656 194
85 3300046476 Ga0495662_0148668 Ga0495662_0148668_60_653 194
86 3300046684 Ga0495669_0091290 Ga0495669_0091290_454_1047 194
87 3300050512 nmdc:mga0n895_77249_c1 nmdc:mga0n895_77249_c1_939_1568 194
88 3300050515 nmdc:mga0a205_61143_c1 nmdc:mga0a205_61143_c1_1291_1920 194
89 3300005341 Ga0070691_10063165 Ga0070691_100631652 195
90 3300005364 Ga0070673_100097452 Ga0070673_1000974522 195
91 3300005440 Ga0070705_100000746 Ga0070705_10000074610 195
92 3300005441 Ga0070700_100149346 Ga0070700_1001493462 195
93 3300005444 Ga0070694_100000370 Ga0070694_10000037012 195
94 3300005545 Ga0070695_100000707 Ga0070695_1000007074 195
95 3300005546 Ga0070696_100000965 Ga0070696_10000096517 195
96 3300005615 Ga0070702_100010489 Ga0070702_1000104891 195
97 3300006847 Ga0075431_100017673 Ga0075431_1000176736 195
98 3300009094 Ga0111539_10000967 Ga0111539_1000096730 195
99 3300009147 Ga0114129_10657669 Ga0114129_106576692 195
100 3300009148 Ga0105243_10584187 Ga0105243_105841872 195
101 3300021388 Ga0213875_10010188 Ga0213875_100101883 195
102 3300025933 Ga0207706_10298736 Ga0207706_102987361 195
103 3300025935 Ga0207709_10329660 Ga0207709_103296602 195
104 3300026121 Ga0207683_10744142 Ga0207683_107441422 195
105 3300027907 Ga0207428_10003546 Ga0207428_100035465 195
106 3300037853 Ga0436364_1193035 Ga0436364_1193035_4907_5506 195
107 3300039437 Ga0436365_0461265 Ga0436365_0461265_2368_2967 195
108 3300039450 Ga0436363_0394035 Ga0436363_0394035_741_1370 195
109 3300046455 Ga0495603_0164153 Ga0495603_0164153_99_707 195
110 3300046472 Ga0495580_0013676 Ga0495580_0013676_5035_5634 195
111 3300046537 Ga0495598_0188512 Ga0495598_0188512_51_665 195
112 3300046539 Ga0495621_0020422 Ga0495621_0020422_1215_1829 195
113 3300046684 Ga0495669_0111569 Ga0495669_0111569_119_784 195
114 3300047447 Ga0495685_031336 Ga0495685_031336_358_1023 195
115 3300050507 nmdc:mga05p37_273235_c1 nmdc:mga05p37_273235_c1_673_1314 195
116 3300050508 nmdc:mga09592_10619_c1 nmdc:mga09592_10619_c1_6813_7427 195
117 3300050509 nmdc:mga0qj67_60595_c1 nmdc:mga0qj67_60595_c1_1661_2275 195
118 3300050510 nmdc:mga06r32_7152_c1 nmdc:mga06r32_7152_c1_3340_3954 195
119 3300050511 nmdc:mga08y16_2371_c1 nmdc:mga08y16_2371_c1_3006_3647 195
120 3300002073 JGI24745J21846_1017595 JGI24745J21846_10175952 196
121 3300005290 Ga0065712_10088085 Ga0065712_100880853 196
122 3300005293 Ga0065715_10007118 Ga0065715_100071182 196
123 3300005295 Ga0065707_10084472 Ga0065707_100844723 196
124 3300005328 Ga0070676_10063748 Ga0070676_100637481 196
125 3300005330 Ga0070690_100002748 Ga0070690_1000027485 196
126 3300005331 Ga0070670_100244692 Ga0070670_1002446922 196
127 3300005331 Ga0070670_100553201 Ga0070670_1005532011 196
128 3300005333 Ga0070677_10001462 Ga0070677_100014625 196
129 3300005333 Ga0070677_10047607 Ga0070677_100476072 196
130 3300005333 Ga0070677_10057988 Ga0070677_100579882 196
131 3300005334 Ga0068869_100042368 Ga0068869_1000423684 196
132 3300005334 Ga0068869_100170023 Ga0068869_1001700233 196
133 3300005335 Ga0070666_10015997 Ga0070666_100159973 196
134 3300005335 Ga0070666_10024914 Ga0070666_100249143 196
135 3300005338 Ga0068868_100062155 Ga0068868_1000621552 196
136 3300005340 Ga0070689_100065829 Ga0070689_1000658293 196
137 3300005340 Ga0070689_100130185 Ga0070689_1001301853 196
138 3300005353 Ga0070669_100144637 Ga0070669_1001446372 196
139 3300005354 Ga0070675_100004051 Ga0070675_1000040516 196
140 3300005354 Ga0070675_100010384 Ga0070675_1000103847 196
141 3300005354 Ga0070675_100042811 Ga0070675_1000428114 196
142 3300005356 Ga0070674_100000382 Ga0070674_1000003825 196
143 3300005356 Ga0070674_100524855 Ga0070674_1005248552 196
144 3300005356 Ga0070674_100875057 Ga0070674_1008750571 196
145 3300005364 Ga0070673_100008003 Ga0070673_1000080033 196
146 3300005364 Ga0070673_100046554 Ga0070673_1000465544 196
147 3300005364 Ga0070673_100263468 Ga0070673_1002634682 196
148 3300005365 Ga0070688_100006025 Ga0070688_1000060257 196
149 3300005365 Ga0070688_100097721 Ga0070688_1000977212 196
150 3300005365 Ga0070688_100363995 Ga0070688_1003639951 196
151 3300005366 Ga0070659_100045339 Ga0070659_1000453392 196
152 3300005366 Ga0070659_100482557 Ga0070659_1004825572 196
153 3300005367 Ga0070667_100054359 Ga0070667_1000543594 196
154 3300005367 Ga0070667_100363178 Ga0070667_1003631782 196
155 3300005441 Ga0070700_100214599 Ga0070700_1002145992 196
156 3300005455 Ga0070663_100272236 Ga0070663_1002722362 196
157 3300005456 Ga0070678_100511463 Ga0070678_1005114632 196
158 3300005457 Ga0070662_100031985 Ga0070662_1000319852 196
159 3300005457 Ga0070662_100055147 Ga0070662_1000551473 196
160 3300005457 Ga0070662_100551165 Ga0070662_1005511652 196
161 3300005459 Ga0068867_100026117 Ga0068867_1000261174 196
162 3300005466 Ga0070685_10014872 Ga0070685_100148722 196
163 3300005468 Ga0070707_100388659 Ga0070707_1003886592 196
164 3300005471 Ga0070698_100002906 Ga0070698_1000029064 196
165 3300005518 Ga0070699_100027001 Ga0070699_1000270015 196
166 3300005530 Ga0070679_100532034 Ga0070679_1005320342 196
167 3300005536 Ga0070697_100156129 Ga0070697_1001561292 196
168 3300005543 Ga0070672_100008378 Ga0070672_1000083782 196
169 3300005543 Ga0070672_100145010 Ga0070672_1001450102 196
170 3300005543 Ga0070672_100379393 Ga0070672_1003793932 196
171 3300005548 Ga0070665_100024814 Ga0070665_1000248146 196
172 3300005549 Ga0070704_100171290 Ga0070704_1001712903 196
173 3300005549 Ga0070704_100276743 Ga0070704_1002767432 196
174 3300005549 Ga0070704_100277490 Ga0070704_1002774902 196
175 3300005564 Ga0070664_100001259 Ga0070664_10000125910 196
176 3300005564 Ga0070664_100002281 Ga0070664_10000228112 196
177 3300005564 Ga0070664_100621224 Ga0070664_1006212242 196
178 3300005577 Ga0068857_100362462 Ga0068857_1003624622 196
179 3300005615 Ga0070702_100114043 Ga0070702_1001140432 196
180 3300005616 Ga0068852_100363944 Ga0068852_1003639442 196
181 3300005617 Ga0068859_100037935 Ga0068859_1000379354 196
182 3300005617 Ga0068859_100126054 Ga0068859_1001260544 196
183 3300005617 Ga0068859_100419971 Ga0068859_1004199712 196
184 3300005617 Ga0068859_100848281 Ga0068859_1008482811 196
185 3300005618 Ga0068864_100028638 Ga0068864_1000286385 196
186 3300005618 Ga0068864_100045866 Ga0068864_1000458664 196
187 3300005718 Ga0068866_10593310 Ga0068866_105933101 196
188 3300005719 Ga0068861_100024564 Ga0068861_1000245642 196
189 3300005840 Ga0068870_10001437 Ga0068870_100014379 196
190 3300005841 Ga0068863_100022046 Ga0068863_1000220465 196
191 3300005844 Ga0068862_100001194 Ga0068862_10000119413 196
192 3300006237 Ga0097621_100090626 Ga0097621_1000906262 196
193 3300006358 Ga0068871_100013047 Ga0068871_1000130476 196
194 3300006358 Ga0068871_100501909 Ga0068871_1005019092 196
195 3300006844 Ga0075428_100000957 Ga0075428_1000009578 196
196 3300006844 Ga0075428_100281666 Ga0075428_1002816662 196
197 3300006846 Ga0075430_100000407 Ga0075430_1000004073 196
198 3300006846 Ga0075430_100079986 Ga0075430_1000799862 196
199 3300006846 Ga0075430_100268739 Ga0075430_1002687391 196
200 3300006847 Ga0075431_100014511 Ga0075431_1000145114 196
201 3300006852 Ga0075433_10001626 Ga0075433_100016264 196
202 3300006852 Ga0075433_10169508 Ga0075433_101695082 196
203 3300006871 Ga0075434_100011034 Ga0075434_1000110345 196
204 3300006871 Ga0075434_100060774 Ga0075434_1000607742 196
205 3300006871 Ga0075434_100074269 Ga0075434_1000742692 196
206 3300006880 Ga0075429_100008849 Ga0075429_1000088498 196
207 3300006880 Ga0075429_100045620 Ga0075429_1000456202 196
208 3300006880 Ga0075429_100646611 Ga0075429_1006466112 196
209 3300006881 Ga0068865_100019564 Ga0068865_1000195645 196
210 3300006881 Ga0068865_100308639 Ga0068865_1003086392 196
211 3300006931 Ga0097620_100037937 Ga0097620_1000379374 196
212 3300006931 Ga0097620_100126058 Ga0097620_1001260584 196
213 3300006931 Ga0097620_100419969 Ga0097620_1004199692 196
214 3300006931 Ga0097620_100848259 Ga0097620_1008482591 196
215 3300007076 Ga0075435_100512230 Ga0075435_1005122301 196
216 3300009094 Ga0111539_10000937 Ga0111539_1000093730 196
217 3300009094 Ga0111539_10019325 Ga0111539_100193252 196
218 3300009094 Ga0111539_10057520 Ga0111539_100575204 196
219 3300009094 Ga0111539_10862984 Ga0111539_108629842 196
220 3300009147 Ga0114129_10017625 Ga0114129_1001762510 196
221 3300009147 Ga0114129_10034743 Ga0114129_100347437 196
222 3300009147 Ga0114129_11210104 Ga0114129_112101042 196
223 3300009177 Ga0105248_10038535 Ga0105248_100385354 196
224 3300009177 Ga0105248_10357202 Ga0105248_103572022 196
225 3300009553 Ga0105249_10025302 Ga0105249_100253024 196
226 3300009553 Ga0105249_11132369 Ga0105249_111323692 196
227 3300011119 Ga0105246_10130692 Ga0105246_101306922 196
228 3300013306 Ga0163162_10021845 Ga0163162_100218452 196
229 3300013306 Ga0163162_10056855 Ga0163162_100568553 196
230 3300013308 Ga0157375_10057570 Ga0157375_100575704 196
231 3300013308 Ga0157375_10119828 Ga0157375_101198282 196
232 3300013308 Ga0157375_10483841 Ga0157375_104838412 196
233 3300014325 Ga0163163_10043571 Ga0163163_100435714 196
234 3300014326 Ga0157380_10007797 Ga0157380_100077973 196
235 3300014326 Ga0157380_10010846 Ga0157380_100108463 196
236 3300014326 Ga0157380_10258555 Ga0157380_102585553 196
237 3300014326 Ga0157380_10509897 Ga0157380_105098972 196
238 3300014745 Ga0157377_10010852 Ga0157377_100108525 196
239 3300014745 Ga0157377_10017096 Ga0157377_100170963 196
240 3300014745 Ga0157377_10101868 Ga0157377_101018682 196
241 3300014745 Ga0157377_10157863 Ga0157377_101578632 196
242 3300014968 Ga0157379_10053964 Ga0157379_100539643 196
243 3300014969 Ga0157376_10096440 Ga0157376_100964402 196
244 3300021388 Ga0213875_10089555 Ga0213875_100895552 196
245 3300025315 Ga0207697_10000701 Ga0207697_100007013 196
246 3300025893 Ga0207682_10000378 Ga0207682_1000037816 196
247 3300025893 Ga0207682_10006209 Ga0207682_100062092 196
248 3300025893 Ga0207682_10108087 Ga0207682_101080872 196
249 3300025901 Ga0207688_10000628 Ga0207688_100006283 196
250 3300025901 Ga0207688_10064495 Ga0207688_100644953 196
251 3300025901 Ga0207688_10092509 Ga0207688_100925092 196
252 3300025903 Ga0207680_10117032 Ga0207680_101170322 196
253 3300025907 Ga0207645_10001911 Ga0207645_1000191110 196
254 3300025907 Ga0207645_10110203 Ga0207645_101102032 196
255 3300025908 Ga0207643_10000925 Ga0207643_1000092515 196
256 3300025908 Ga0207643_10010788 Ga0207643_100107885 196
257 3300025917 Ga0207660_10083025 Ga0207660_100830253 196
258 3300025918 Ga0207662_10058324 Ga0207662_100583242 196
259 3300025919 Ga0207657_10583565 Ga0207657_105835652 196
260 3300025920 Ga0207649_10060738 Ga0207649_100607383 196
261 3300025922 Ga0207646_10267344 Ga0207646_102673442 196
262 3300025923 Ga0207681_10125365 Ga0207681_101253653 196
263 3300025923 Ga0207681_10496619 Ga0207681_104966192 196
264 3300025925 Ga0207650_10006335 Ga0207650_100063355 196
265 3300025926 Ga0207659_10004292 Ga0207659_100042924 196
266 3300025926 Ga0207659_10012850 Ga0207659_100128503 196
267 3300025926 Ga0207659_10024302 Ga0207659_100243023 196
268 3300025926 Ga0207659_10034223 Ga0207659_100342233 196
269 3300025927 Ga0207687_10133765 Ga0207687_101337652 196
270 3300025932 Ga0207690_10178091 Ga0207690_101780912 196
271 3300025933 Ga0207706_10041238 Ga0207706_100412382 196
272 3300025933 Ga0207706_10042421 Ga0207706_100424215 196
273 3300025933 Ga0207706_10837028 Ga0207706_108370282 196
274 3300025934 Ga0207686_10412108 Ga0207686_104121083 196
275 3300025936 Ga0207670_10071424 Ga0207670_100714243 196
276 3300025936 Ga0207670_10454502 Ga0207670_104545022 196
277 3300025937 Ga0207669_10000517 Ga0207669_1000051711 196
278 3300025940 Ga0207691_10005381 Ga0207691_1000538112 196
279 3300025940 Ga0207691_10023122 Ga0207691_100231224 196
280 3300025940 Ga0207691_10025557 Ga0207691_100255573 196
281 3300025940 Ga0207691_10485310 Ga0207691_104853102 196
282 3300025940 Ga0207691_10953006 Ga0207691_109530061 196
283 3300025942 Ga0207689_10001594 Ga0207689_100015943 196
284 3300025942 Ga0207689_10066220 Ga0207689_100662202 196
285 3300025942 Ga0207689_10073568 Ga0207689_100735682 196
286 3300025945 Ga0207679_10030688 Ga0207679_100306884 196
287 3300025945 Ga0207679_10593989 Ga0207679_105939891 196
288 3300025960 Ga0207651_10038468 Ga0207651_100384684 196
289 3300025960 Ga0207651_10287766 Ga0207651_102877662 196
290 3300025961 Ga0207712_10020945 Ga0207712_100209454 196
291 3300025972 Ga0207668_10026763 Ga0207668_100267634 196
292 3300025972 Ga0207668_10573722 Ga0207668_105737222 196
293 3300025986 Ga0207658_10068874 Ga0207658_100688742 196
294 3300026023 Ga0207677_10368247 Ga0207677_103682472 196
295 3300026035 Ga0207703_11126334 Ga0207703_111263341 196
296 3300026075 Ga0207708_10008381 Ga0207708_100083813 196
297 3300026075 Ga0207708_10198880 Ga0207708_101988802 196
298 3300026075 Ga0207708_10331459 Ga0207708_103314592 196
299 3300026088 Ga0207641_10007161 Ga0207641_100071615 196
300 3300026089 Ga0207648_10005974 Ga0207648_100059749 196
301 3300026089 Ga0207648_10066022 Ga0207648_100660222 196
302 3300026089 Ga0207648_10110545 Ga0207648_101105453 196
303 3300026089 Ga0207648_10120681 Ga0207648_101206813 196
304 3300026095 Ga0207676_10024241 Ga0207676_100242414 196
305 3300026095 Ga0207676_10456637 Ga0207676_104566372 196
306 3300026116 Ga0207674_10091188 Ga0207674_100911884 196
307 3300026118 Ga0207675_100012877 Ga0207675_1000128772 196
308 3300026118 Ga0207675_100049984 Ga0207675_1000499842 196
309 3300026118 Ga0207675_100207046 Ga0207675_1002070461 196
310 3300026118 Ga0207675_100263578 Ga0207675_1002635783 196
311 3300026121 Ga0207683_10018406 Ga0207683_100184065 196
312 3300026121 Ga0207683_10521239 Ga0207683_105212392 196
313 3300026142 Ga0207698_10433619 Ga0207698_104336192 196
314 3300027907 Ga0207428_10001370 Ga0207428_1000137010 196
315 3300027907 Ga0207428_10001377 Ga0207428_1000137713 196
316 3300027907 Ga0207428_10304272 Ga0207428_103042722 196
317 3300028380 Ga0268265_10023143 Ga0268265_100231433 196
318 3300028380 Ga0268265_10299680 Ga0268265_102996802 196
319 3300028380 Ga0268265_10833005 Ga0268265_108330052 196
320 3300031548 Ga0307408_100054766 Ga0307408_1000547662 196
321 3300031824 Ga0307413_10620748 Ga0307413_106207482 196
322 3300031852 Ga0307410_10007671 Ga0307410_100076714 196
323 3300031901 Ga0307406_10142006 Ga0307406_101420062 196
324 3300031903 Ga0307407_10043843 Ga0307407_100438433 196
325 3300031995 Ga0307409_100016937 Ga0307409_1000169373 196
326 3300032002 Ga0307416_100029545 Ga0307416_1000295453 196
327 3300032002 Ga0307416_100752467 Ga0307416_1007524672 196
328 3300032004 Ga0307414_10397949 Ga0307414_103979492 196
329 3300032005 Ga0307411_10041838 Ga0307411_100418382 196
330 3300032005 Ga0307411_10043240 Ga0307411_100432402 196
331 3300032126 Ga0307415_100023986 Ga0307415_1000239864 196
332 3300035088 Ga0373940_0005259 Ga0373940_0005259_2026_2631 196
333 3300037853 Ga0436364_0334136 Ga0436364_0334136_1685_2287 196
334 3300039437 Ga0436365_0055431 Ga0436365_0055431_15_617 196
335 3300042008 Ga0439450_020510 Ga0439450_020510_616_1221 196
336 3300042436 Ga0439435_0032586 Ga0439435_0032586_658_1278 196
337 3300045051 Ga0451576_0024922 Ga0451576_0024922_5179_5862 196
338 3300045051 Ga0451576_0048913 Ga0451576_0048913_3822_4427 196
339 3300045051 Ga0451576_0212808 Ga0451576_0212808_1013_1696 196
340 3300046459 Ga0495629_0002871 Ga0495629_0002871_3867_4478 196
341 3300046473 Ga0495582_0092109 Ga0495582_0092109_914_1561 196
342 3300046491 Ga0495584_0073883 Ga0495584_0073883_298_981 196
343 3300046499 Ga0495594_0089263 Ga0495594_0089263_183_794 196
344 3300046523 Ga0495644_0262574 Ga0495644_0262574_53_658 196
345 3300046528 Ga0495642_0070881 Ga0495642_0070881_241_924 196
346 3300046537 Ga0495598_0028879 Ga0495598_0028879_406_1038 196
347 3300046538 Ga0495609_0043757 Ga0495609_0043757_114_797 196
348 3300046664 Ga0495659_0036011 Ga0495659_0036011_1028_1711 196
349 3300046683 Ga0495658_0036949 Ga0495658_0036949_357_1004 196
350 3300046691 Ga0495670_0210218 Ga0495670_0210218_337_942 196
351 3300047315 Ga0495581_0500994 Ga0495581_0500994_26_637 196
352 3300047321 Ga0495676_0017131 Ga0495676_0017131_4329_4940 196
353 3300047445 Ga0495677_0032453 Ga0495677_0032453_793_1476 196
354 3300048912 Ga0496109_0350357 Ga0496109_0350357_325_930 196
355 3300048912 Ga0496109_0615328 Ga0496109_0615328_156_776 196
356 3300048913 Ga0496110_0339636 Ga0496110_0339636_123_743 196
357 3300048913 Ga0496110_0549034 Ga0496110_0549034_134_739 196
358 3300048914 Ga0496111_0259682 Ga0496111_0259682_348_968 196
359 3300049572 Ga0501036_0123288 Ga0501036_0123288_1427_2032 196
360 3300049582 Ga0501048_0119875 Ga0501048_0119875_413_1018 196
361 3300049591 Ga0501075_0066467 Ga0501075_0066467_340_960 196
362 3300049591 Ga0501075_0392314 Ga0501075_0392314_193_798 196
363 3300050507 nmdc:mga05p37_119351_c1 nmdc:mga05p37_119351_c1_1037_1642 196
364 3300050508 nmdc:mga09592_10011_c1 nmdc:mga09592_10011_c1_1275_1880 196
365 3300050508 nmdc:mga09592_168895_c1 nmdc:mga09592_168895_c1_373_978 196
366 3300050508 nmdc:mga09592_27132_c1 nmdc:mga09592_27132_c1_2321_2932 196
367 3300050508 nmdc:mga09592_45514_c1 nmdc:mga09592_45514_c1_978_1610 196
368 3300050508 nmdc:mga09592_50982_c1 nmdc:mga09592_50982_c1_1263_1868 196
369 3300050509 nmdc:mga0qj67_31529_c1 nmdc:mga0qj67_31529_c1_2996_3607 196
370 3300050509 nmdc:mga0qj67_898_c1 nmdc:mga0qj67_898_c1_8610_9215 196
371 3300050510 nmdc:mga06r32_336659_c1 nmdc:mga06r32_336659_c1_264_869 196
372 3300050510 nmdc:mga06r32_4916_c1 nmdc:mga06r32_4916_c1_9596_10201 196
373 3300050510 nmdc:mga06r32_705086_c1 nmdc:mga06r32_705086_c1_22_642 196
374 3300050511 nmdc:mga08y16_142240_c1 nmdc:mga08y16_142240_c1_1829_2449 196
375 3300050511 nmdc:mga08y16_196413_c1 nmdc:mga08y16_196413_c1_539_1144 196
376 3300050511 nmdc:mga08y16_52853_c1 nmdc:mga08y16_52853_c1_1501_2106 196
377 3300050511 nmdc:mga08y16_743_c1 nmdc:mga08y16_743_c1_23808_24428 196
378 3300050512 nmdc:mga0n895_31629_c1 nmdc:mga0n895_31629_c1_3133_3753 196
379 3300050512 nmdc:mga0n895_83538_c1 nmdc:mga0n895_83538_c1_2410_3084 196
380 3300050512 nmdc:mga0n895_90797_c1 nmdc:mga0n895_90797_c1_2354_2959 196
381 3300050513 nmdc:mga0rr50_608263_c1 nmdc:mga0rr50_608263_c1_186_860 196
382 3300050515 nmdc:mga0a205_233846_c1 nmdc:mga0a205_233846_c1_366_1040 196
383 3300050515 nmdc:mga0a205_2928_c1 nmdc:mga0a205_2928_c1_7784_8389 196
384 3300050515 nmdc:mga0a205_5356_c1 nmdc:mga0a205_5356_c1_3064_3684 196
385 3300054114 Ga0501084_0296031 Ga0501084_0296031_712_1332 196
386 iso_pu_bacteria 2643221556 2643801999 196
387 iso_pu_bacteria 2643221684 2644473848 196
388 iso_pu_bacteria 8047673197 8047679543 196
389 3300005518 Ga0070699_100743837 Ga0070699_1007438371 197
390 3300006844 Ga0075428_100608648 Ga0075428_1006086482 197
391 3300009147 Ga0114129_10792452 Ga0114129_107924522 197
392 3300021388 Ga0213875_10081824 Ga0213875_100818242 197
393 3300037853 Ga0436364_0183835 Ga0436364_0183835_56_694 197
394 3300005328 Ga0070676_10006282 Ga0070676_100062825 198
395 3300005343 Ga0070687_100001643 Ga0070687_1000016438 198
396 3300005347 Ga0070668_100026632 Ga0070668_1000266322 198
397 3300005353 Ga0070669_100008311 Ga0070669_1000083114 198
398 3300005456 Ga0070678_100007020 Ga0070678_1000070204 198
399 3300005518 Ga0070699_100361912 Ga0070699_1003619122 198
400 3300005544 Ga0070686_100009633 Ga0070686_1000096333 198
401 3300006852 Ga0075433_10122556 Ga0075433_101225562 198
402 3300050515 nmdc:mga0a205_139050_c1 nmdc:mga0a205_139050_c1_1094_1708 198
403 3300005618 Ga0068864_101382912 Ga0068864_1013829121 199
404 3300031665 Ga0316575_10047892 Ga0316575_100478923 199
405 3300031691 Ga0316579_10039683 Ga0316579_100396832 199
406 3300031727 Ga0316576_10119634 Ga0316576_101196343 199
407 3300031728 Ga0316578_10009462 Ga0316578_100094623 199
408 3300031733 Ga0316577_10006149 Ga0316577_100061494 199
409 3300031733 Ga0316577_10014824 Ga0316577_100148241 199
410 3300031733 Ga0316577_10055102 Ga0316577_100551022 199
411 3300031733 Ga0316577_10092918 Ga0316577_100929182 199
412 3300031733 Ga0316577_10115741 Ga0316577_101157411 199
413 3300031733 Ga0316577_10381695 Ga0316577_103816951 199
414 3300032137 Ga0316585_10057566 Ga0316585_100575662 199
415 3300032137 Ga0316585_10080425 Ga0316585_100804252 199
416 3300036647 Ga0316582_0020285 Ga0316582_0020285_2766_3383 199
417 3300036647 Ga0316582_0060279 Ga0316582_0060279_610_1227 199
418 3300036712 Ga0316584_0001965 Ga0316584_0001965_10900_11517 199
419 3300036712 Ga0316584_0011979 Ga0316584_0011979_4448_5065 199
420 3300036712 Ga0316584_0650675 Ga0316584_0650675_65_682 199
421 3300037418 Ga0395900_0109043 Ga0395900_0109043_76_690 199
422 3300037471 Ga0395905_0001509 Ga0395905_0001509_2032_2646 199
423 3300037588 Ga0316581_0002269 Ga0316581_0002269_546_1163 199
424 3300037588 Ga0316581_0015740 Ga0316581_0015740_1219_1836 199
425 3300039093 Ga0400489_73490 Ga0400489_73490_13055_13669 199
426 3300039093 Ga0400489_76266 Ga0400489_76266_502_1119 199
427 3300003322 rootL2_10013282 rootL2_100132829 200
428 3300005327 Ga0070658_10016196 Ga0070658_100161966 200
429 3300005336 Ga0070680_100587069 Ga0070680_1005870692 200
430 3300005344 Ga0070661_100586168 Ga0070661_1005861681 200
431 3300005366 Ga0070659_100076117 Ga0070659_1000761172 200
432 3300013100 Ga0157373_10019614 Ga0157373_100196145 200
433 3300013104 Ga0157370_10791486 Ga0157370_107914861 200
434 3300013297 Ga0157378_10010539 Ga0157378_100105392 200
435 3300025920 Ga0207649_10558307 Ga0207649_105583072 200
436 3300025932 Ga0207690_10174801 Ga0207690_101748012 200
437 3300030745 Ga0316182_1155512 Ga0316182_11555122 200
438 3300030745 Ga0316182_1171651 Ga0316182_11716512 200
439 3300037418 Ga0395900_0386577 Ga0395900_0386577_722_1333 200
440 3300044658 Ga0466972_0068060 Ga0466972_0068060_629_1240 200
441 3300044683 Ga0466965_0106623 Ga0466965_0106623_286_897 200
442 3300044712 Ga0453684_0162323 Ga0453684_0162323_1965_2576 200
443 3300045049 Ga0466959_0351463 Ga0466959_0351463_302_913 200
444 3300045976 Ga0466967_0403018 Ga0466967_0403018_348_959 200
445 3300046474 Ga0495605_0000498 Ga0495605_0000498_7969_8580 200
446 3300046474 Ga0495605_0033767 Ga0495605_0033767_845_1456 200
447 3300046491 Ga0495584_0025348 Ga0495584_0025348_1240_1851 200
448 3300046501 Ga0495607_0000961 Ga0495607_0000961_7961_8572 200
449 3300046501 Ga0495607_0043698 Ga0495607_0043698_201_812 200
450 3300046507 Ga0495606_0124092 Ga0495606_0124092_378_989 200
451 3300046522 Ga0495643_0004358 Ga0495643_0004358_802_1413 200
452 3300046522 Ga0495643_0005453 Ga0495643_0005453_291_902 200
453 3300046524 Ga0495648_0003051 Ga0495648_0003051_4890_5501 200
454 3300046524 Ga0495648_0050064 Ga0495648_0050064_487_1098 200
455 3300046528 Ga0495642_0013883 Ga0495642_0013883_1962_2573 200
456 3300046530 Ga0495654_0008763 Ga0495654_0008763_1766_2377 200
457 3300046537 Ga0495598_0077173 Ga0495598_0077173_115_729 200
458 3300046538 Ga0495609_0006777 Ga0495609_0006777_4626_5237 200
459 3300046616 Ga0495668_0007671 Ga0495668_0007671_1464_2075 200
460 3300046665 Ga0495661_0001505 Ga0495661_0001505_18353_18964 200
461 3300046665 Ga0495661_0005604 Ga0495661_0005604_7975_8586 200
462 3300046665 Ga0495661_0008756 Ga0495661_0008756_4134_4745 200
463 3300046694 Ga0495649_0001229 Ga0495649_0001229_12971_13585 200
464 3300046694 Ga0495649_0354164 Ga0495649_0354164_54_665 200
465 3300046794 Ga0495589_0001577 Ga0495589_0001577_5108_5719 200
466 3300046794 Ga0495589_0002196 Ga0495589_0002196_7972_8583 200
467 3300046810 Ga0495660_0000033 Ga0495660_0000033_138975_139586 200
468 3300046810 Ga0495660_0014126 Ga0495660_0014126_783_1394 200
469 3300047320 Ga0495672_0001901 Ga0495672_0001901_12719_13330 200
470 3300047320 Ga0495672_0002129 Ga0495672_0002129_12693_13304 200
471 3300047323 Ga0495683_0004048 Ga0495683_0004048_1468_2079 200
472 3300047323 Ga0495683_0006783 Ga0495683_0006783_2208_2822 200
473 3300047443 Ga0495687_000344 Ga0495687_000344_39274_39885 200
474 3300047445 Ga0495677_0002111 Ga0495677_0002111_7194_7805 200
475 3300048091 Ga0495626_0000160 Ga0495626_0000160_9828_10439 200
476 3300048927 Ga0496124_0315035 Ga0496124_0315035_414_1025 200
477 3300049572 Ga0501036_0594649 Ga0501036_0594649_175_786 200
478 3300005262 Ga0065165_1010199 Ga0065165_10101993 201
479 3300005329 Ga0070683_100768096 Ga0070683_1007680962 201
480 3300005435 Ga0070714_100021490 Ga0070714_1000214905 201
481 3300006948 Ga0099826_10000048 Ga0099826_100000489 201
482 3300009147 Ga0114129_10302722 Ga0114129_103027223 201
483 3300025944 Ga0207661_10639358 Ga0207661_106393582 201
484 3300027666 Ga0209282_1000066 Ga0209282_100006672 201
485 3300031548 Ga0307408_100111987 Ga0307408_1001119872 201
486 3300031665 Ga0316575_10080144 Ga0316575_100801442 201
487 3300031728 Ga0316578_10478552 Ga0316578_104785521 201
488 3300031901 Ga0307406_10108406 Ga0307406_101084062 201
489 3300031911 Ga0307412_10098464 Ga0307412_100984643 201
490 3300044684 Ga0466966_0073122 Ga0466966_0073122_570_1199 201
491 3300044712 Ga0453684_0760972 Ga0453684_0760972_352_969 201
492 3300045049 Ga0466959_0025843 Ga0466959_0025843_2649_3278 201
493 3300045051 Ga0451576_0483280 Ga0451576_0483280_242_856 201
494 3300045836 Ga0466958_0008664 Ga0466958_0008664_2553_3182 201
495 3300045836 Ga0466958_0036525 Ga0466958_0036525_621_1259 201
496 3300046472 Ga0495580_0000641 Ga0495580_0000641_14133_14765 201
497 3300046491 Ga0495584_0000037 Ga0495584_0000037_12401_13015 201
498 3300046507 Ga0495606_0031701 Ga0495606_0031701_1875_2489 201
499 3300046513 Ga0495616_0095550 Ga0495616_0095550_511_1125 201
500 3300046522 Ga0495643_0058556 Ga0495643_0058556_736_1350 201
501 3300046684 Ga0495669_0002671 Ga0495669_0002671_1893_2522 201
502 3300046694 Ga0495649_0027410 Ga0495649_0027410_2201_2815 201
503 3300048919 Ga0496116_0001420 Ga0496116_0001420_9877_10494 201
504 3300048925 Ga0496122_0045465 Ga0496122_0045465_2388_3005 201
505 3300048925 Ga0496122_0082972 Ga0496122_0082972_196_810 201
506 3300048926 Ga0496123_0002004 Ga0496123_0002004_10986_11600 201
507 3300048928 Ga0496125_0000807 Ga0496125_0000807_24122_24736 201
508 3300048929 Ga0496126_0002667 Ga0496126_0002667_20244_20861 201
509 3300050507 nmdc:mga05p37_99269_c1 nmdc:mga05p37_99269_c1_943_1560 201
510 3300050512 nmdc:mga0n895_105523_c1 nmdc:mga0n895_105523_c1_15_647 201
511 iso_pu_bacteria 2643221736 2644745847 201
512 3300003659 JGI25404J52841_10000484 JGI25404J52841_100004844 202
513 3300005289 Ga0065704_10028029 Ga0065704_100280292 202
514 3300005295 Ga0065707_10343331 Ga0065707_103433312 202
515 3300005937 Ga0081455_10548479 Ga0081455_105484791 202
516 3300005983 Ga0081540_1000343 Ga0081540_100034328 202
517 3300006195 Ga0075366_10039914 Ga0075366_100399143 202
518 3300006844 Ga0075428_100047493 Ga0075428_1000474933 202
519 3300009094 Ga0111539_10129980 Ga0111539_101299802 202
520 3300009147 Ga0114129_10020095 Ga0114129_100200957 202
521 3300009147 Ga0114129_10247158 Ga0114129_102471582 202
522 3300031456 Ga0307513_10010905 Ga0307513_100109054 202
523 3300031548 Ga0307408_100052597 Ga0307408_1000525973 202
524 3300031548 Ga0307408_100115010 Ga0307408_1001150102 202
525 3300031711 Ga0265314_10001478 Ga0265314_100014788 202
526 3300031824 Ga0307413_10383889 Ga0307413_103838892 202
527 3300031852 Ga0307410_10041277 Ga0307410_100412772 202
528 3300031852 Ga0307410_10115491 Ga0307410_101154912 202
529 3300031852 Ga0307410_10525049 Ga0307410_105250492 202
530 3300032002 Ga0307416_100117086 Ga0307416_1001170862 202
531 3300032005 Ga0307411_10027803 Ga0307411_100278032 202
532 3300044656 Ga0466969_0296577 Ga0466969_0296577_47_682 202
533 3300049580 Ga0501046_0360902 Ga0501046_0360902_142_774 202
534 3300049587 Ga0501071_0269908 Ga0501071_0269908_600_1232 202
535 3300049588 Ga0501072_0987788 Ga0501072_0987788_14_646 202
536 3300049590 Ga0501074_0369458 Ga0501074_0369458_185_817 202
537 3300049591 Ga0501075_0105020 Ga0501075_0105020_713_1345 202
538 3300049592 Ga0501076_0319150 Ga0501076_0319150_601_1233 202
539 3300049824 Ga0501045_0101486 Ga0501045_0101486_1362_1994 202
540 3300050493 nmdc:mga0k408_14188_c2 nmdc:mga0k408_14188_c2_759_1382 202
541 3300050507 nmdc:mga05p37_241_c1 nmdc:mga05p37_241_c1_28801_29418 202
542 3300050511 nmdc:mga08y16_333519_c1 nmdc:mga08y16_333519_c1_880_1500 202
543 3300059426 Ga0590077_008463 Ga0590077_008463_869_1501 202
544 3300061734 Ga0530510_0659933 Ga0530510_0659933_58_738 202
545 3300005434 Ga0070709_10563698 Ga0070709_105636981 203
546 3300005435 Ga0070714_100010038 Ga0070714_1000100386 203
547 3300005435 Ga0070714_100069618 Ga0070714_1000696182 203
548 3300005435 Ga0070714_100083015 Ga0070714_1000830153 203
549 3300005436 Ga0070713_100086314 Ga0070713_1000863142 203
550 3300005437 Ga0070710_10120622 Ga0070710_101206222 203
551 3300005437 Ga0070710_10614665 Ga0070710_106146651 203
552 3300005842 Ga0068858_100222421 Ga0068858_1002224213 203
553 3300006028 Ga0070717_10007369 Ga0070717_100073694 203
554 3300006028 Ga0070717_10010026 Ga0070717_100100266 203
555 3300006852 Ga0075433_10008473 Ga0075433_100084734 203
556 3300025898 Ga0207692_10354613 Ga0207692_103546132 203
557 3300025928 Ga0207700_10698984 Ga0207700_106989842 203
558 3300025929 Ga0207664_10018238 Ga0207664_100182385 203
559 3300025929 Ga0207664_10038395 Ga0207664_100383953 203
560 3300025929 Ga0207664_10532492 Ga0207664_105324922 203
561 3300026035 Ga0207703_10415509 Ga0207703_104155092 203
562 3300038726 Ga0400490_56435 Ga0400490_56435_3137_3766 203
563 3300042876 Ga0451577_0005780 Ga0451577_0005780_9441_10052 203
564 3300044673 Ga0453683_0000845 Ga0453683_0000845_17945_18601 203
565 3300044673 Ga0453683_0019430 Ga0453683_0019430_1660_2280 203
566 3300044712 Ga0453684_0023147 Ga0453684_0023147_3080_3697 203
567 3300044712 Ga0453684_0027034 Ga0453684_0027034_2782_3393 203
568 3300044712 Ga0453684_0035665 Ga0453684_0035665_6091_6711 203
569 3300044712 Ga0453684_0054823 Ga0453684_0054823_1449_2072 203
570 3300044712 Ga0453684_0230488 Ga0453684_0230488_1200_1964 203
571 3300044712 Ga0453684_0331656 Ga0453684_0331656_106_723 203
572 3300044712 Ga0453684_0381510 Ga0453684_0381510_780_1397 203
573 3300044712 Ga0453684_0656887 Ga0453684_0656887_132_749 203
574 3300044712 Ga0453684_1007825 Ga0453684_1007825_159_776 203
575 3300044765 Ga0466970_0022802 Ga0466970_0022802_1452_2123 203
576 3300045049 Ga0466959_0003996 Ga0466959_0003996_8553_9218 203
577 3300045051 Ga0451576_0501266 Ga0451576_0501266_346_966 203
578 3300045976 Ga0466967_0044879 Ga0466967_0044879_2821_3468 203
579 3300046543 Ga0495645_0343761 Ga0495645_0343761_43_699 203
580 3300047317 Ga0495604_0111911 Ga0495604_0111911_420_1076 203
581 3300047319 Ga0495674_0492619 Ga0495674_0492619_293_949 203
582 3300047320 Ga0495672_0073834 Ga0495672_0073834_289_963 203
583 3300048911 Ga0496108_0264391 Ga0496108_0264391_310_981 203
584 3300048927 Ga0496124_0104882 Ga0496124_0104882_94_765 203
585 3300050512 nmdc:mga0n895_363130_c1 nmdc:mga0n895_363130_c1_399_1010 203
586 3300050515 nmdc:mga0a205_72610_c1 nmdc:mga0a205_72610_c1_2074_2685 203
587 3300053077 Ga0495601_0459638 Ga0495601_0459638_53_709 203
588 3300060353 Ga0501082_0039026 Ga0501082_0039026_1403_2050 203
589 3300061719 Ga0466962_0018348 Ga0466962_0018348_2233_2898 203
590 2162886011 MRS1b_contig_8347333 MRS1b_0372.00002400 204
591 3300005289 Ga0065704_10295538 Ga0065704_102955382 204
592 3300005295 Ga0065707_10002920 Ga0065707_100029208 204
593 3300005295 Ga0065707_10153845 Ga0065707_101538452 204
594 3300005444 Ga0070694_100434530 Ga0070694_1004345301 204
595 3300005467 Ga0070706_100444829 Ga0070706_1004448292 204
596 3300005471 Ga0070698_100043358 Ga0070698_1000433585 204
597 3300005471 Ga0070698_100064147 Ga0070698_1000641474 204
598 3300005471 Ga0070698_100316745 Ga0070698_1003167452 204
599 3300005518 Ga0070699_100025646 Ga0070699_1000256466 204
600 3300005518 Ga0070699_100195114 Ga0070699_1001951143 204
601 3300005518 Ga0070699_100200506 Ga0070699_1002005062 204
602 3300005518 Ga0070699_100443775 Ga0070699_1004437752 204
603 3300005618 Ga0068864_100229397 Ga0068864_1002293972 204
604 3300005844 Ga0068862_100060116 Ga0068862_1000601162 204
605 3300006844 Ga0075428_100027050 Ga0075428_1000270506 204
606 3300006846 Ga0075430_100348066 Ga0075430_1003480662 204
607 3300006847 Ga0075431_100137881 Ga0075431_1001378813 204
608 3300006880 Ga0075429_100051941 Ga0075429_1000519413 204
609 3300006880 Ga0075429_100186245 Ga0075429_1001862451 204
610 3300009147 Ga0114129_10013246 Ga0114129_100132469 204
611 3300009147 Ga0114129_10026025 Ga0114129_100260258 204
612 3300009147 Ga0114129_10028768 Ga0114129_100287687 204
613 3300009147 Ga0114129_10053445 Ga0114129_100534452 204
614 3300009148 Ga0105243_10143083 Ga0105243_101430832 204
615 3300009148 Ga0105243_10547539 Ga0105243_105475392 204
616 3300011119 Ga0105246_10012177 Ga0105246_100121773 204
617 3300025922 Ga0207646_10201736 Ga0207646_102017362 204
618 3300025936 Ga0207670_10102224 Ga0207670_101022243 204
619 3300026075 Ga0207708_10022355 Ga0207708_100223554 204
620 3300031548 Ga0307408_100197185 Ga0307408_1001971853 204
621 3300031911 Ga0307412_10096525 Ga0307412_100965253 204
622 3300032126 Ga0307415_101005694 Ga0307415_1010056942 204
623 3300035171 Ga0373946_0311730 Ga0373946_0311730_115_744 204
624 3300035207 Ga0373942_0044532 Ga0373942_0044532_159_788 204
625 3300035691 Ga0373931_0024741 Ga0373931_0024741_433_1062 204
626 3300035695 Ga0373927_0000877 Ga0373927_0000877_15379_16008 204
627 3300036647 Ga0316582_0053666 Ga0316582_0053666_434_1051 204
628 3300037068 Ga0373925_0000619 Ga0373925_0000619_15023_15652 204
629 3300044673 Ga0453683_0000751 Ga0453683_0000751_9297_9911 204
630 3300044673 Ga0453683_0019144 Ga0453683_0019144_3375_3989 204
631 3300044712 Ga0453684_0000044 Ga0453684_0000044_337619_338239 204
632 3300044712 Ga0453684_0006346 Ga0453684_0006346_12622_13236 204
633 3300044712 Ga0453684_0042935 Ga0453684_0042935_5418_6032 204
634 3300044712 Ga0453684_0044547 Ga0453684_0044547_1784_2401 204
635 3300044712 Ga0453684_0058878 Ga0453684_0058878_822_1442 204
636 3300044712 Ga0453684_0105276 Ga0453684_0105276_1065_1679 204
637 3300044712 Ga0453684_0106869 Ga0453684_0106869_1629_2243 204
638 3300044712 Ga0453684_0173439 Ga0453684_0173439_1885_2499 204
639 3300044712 Ga0453684_0323615 Ga0453684_0323615_966_1580 204
640 3300044712 Ga0453684_0685478 Ga0453684_0685478_95_709 204
641 3300044712 Ga0453684_1067445 Ga0453684_1067445_174_788 204
642 3300045051 Ga0451576_0009324 Ga0451576_0009324_9529_10143 204
643 3300045051 Ga0451576_0076393 Ga0451576_0076393_2160_2774 204
644 3300045051 Ga0451576_0171716 Ga0451576_0171716_916_1599 204
645 3300045051 Ga0451576_0649266 Ga0451576_0649266_391_1005 204
646 3300050507 nmdc:mga05p37_7132_c1 nmdc:mga05p37_7132_c1_10421_11035 204
647 3300050507 nmdc:mga05p37_724645_c1 nmdc:mga05p37_724645_c1_393_1007 204
648 3300050508 nmdc:mga09592_615488_c1 nmdc:mga09592_615488_c1_247_861 204
649 3300050508 nmdc:mga09592_69779_c1 nmdc:mga09592_69779_c1_1352_1966 204
650 3300050510 nmdc:mga06r32_123159_c1 nmdc:mga06r32_123159_c1_961_1575 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

50

254

0.83

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

56

237

0.8

PF07722

Peptidase_C26

Peptidase C26

110

238

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9584 1 203
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9538 2 202
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9445 2 202
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9396 3 204
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9353 1 203
ID Description Score Start End Superfamily
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9809 4 202 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.966 4 202 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9528 2 202 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9476 4 202 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9455 2 202 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A350WUG4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9994 45 202 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829
AF-A0A845CHY9-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9919 44 203 GO:0000105
GO:0000107
GO:0006541
GO:0016787
GO:0016829
AF-A0A7C0XJH6-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9916 29 202 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0016829
AF-A0A7C3N428-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9907 3 202 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A3D0UN48-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9892 4 202 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829

Feature Viewer

pLDDT pTM Quality
94.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map