F472571

General Info

Members Datasets Scaffolds Average Seq Length
651 340 1302 346

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10000548|Ga0065714_100005482
Length 391
Sequence MIVPTLCVGMQPGTLGVPKADAERPLMHSHAERGNDYQENNMRIGLVGYGHGGRFFHAPLISSLPAATFVGVVTRSPERRQLLAAEHPGVPAFDSIGQLVEAGIDVLVVSTPLKGRPALVLDGIEHGVAVVSDKPFAADAQQAQTLITMAERQGVQLSVYQNRRWDSDFLTVRKLIESGALGQVTRFESRIERYSPQAVNNGSGGGFLRDLGSHLVDQALLLFGPVTRVYAELDYLEKGQAFDNGFFMSLTHASGVTSHLGGSCLQNTPGPRFRVTGSQGCYSVDGLDGQEASALAGLSPKSEGERWGVEEHRRWGWFEQGEVRERVPSERGCWNQFYLQLQTALQSGGPLPVDARDALATTRVLDAARLSAERHQVVELSPFKSHGIKSE

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
53 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
118 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
119 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
123 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
124 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
125 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
126 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
127 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
128 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
139 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2511231004 Pseudomonas sp. GM102 Isolate Nodule
238 2511231007 Pseudomonas sp. GM18 Isolate Nodule
239 2511231010 Pseudomonas sp. GM25 Isolate Nodule
240 2511231014 Pseudomonas sp. GM48 Isolate Nodule
241 2511231016 Pseudomonas sp. GM50 Isolate Nodule
242 2511231019 Pseudomonas sp. GM67 Isolate Nodule
243 2511231021 Pseudomonas sp. GM78 Isolate Nodule
244 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
245 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
246 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
247 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
248 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
249 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
250 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
251 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
252 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
253 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
254 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
255 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
256 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
257 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
258 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
259 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
260 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
261 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
262 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
263 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
264 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
265 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
266 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
267 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
268 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
269 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
270 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
271 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
272 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
273 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
274 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
275 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
276 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
277 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
278 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
279 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
280 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
281 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
282 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
283 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
284 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
285 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
286 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
287 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
288 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
289 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
290 2773857670 Pseudomonas sp. 478 Isolate Unclassified
291 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
292 2784132072 Pseudomonas sp. 460 Isolate Unclassified
293 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
294 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
295 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
296 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
297 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
298 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
299 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
300 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
301 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
302 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
303 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
304 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
305 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
306 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
307 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
308 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
309 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
310 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
311 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
312 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
313 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
314 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
315 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
316 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
317 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
318 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
319 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
320 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
321 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
322 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
323 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
324 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
325 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
326 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
327 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
328 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
329 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
330 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
331 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
332 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
333 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
334 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
335 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
336 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
337 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
338 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
339 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
340 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.02
Metatranscriptomes 0
Isolates 15.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 1.54
Rhizoplane 8.91
Rhizosphere 73.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10000548 3300005288 Bacteria 4168
2 MRS2a_Contig_11 2124908027 Bacteria 54720
3 SwRhRL2b_contig_1122291 2162886007 Bacteria 5502
4 JGI25162J39368_1000060 3300002737 Bacteria 137745
5 JGI25163J39215_1000792 3300002771 Bacteria 7675
6 JGI25164J39214_1000037 3300002772 Bacteria 137530
7 JGI25165J46597_1000118 3300003214 Bacteria 137530
8 Ga0055538_1000158 3300003751 Bacteria 45679
9 Ga0055539_1000208 3300003752 Bacteria 45679
10 Ga0055533_1000209 3300003756 Bacteria 45679
11 Ga0055532_1000214 3300003758 Bacteria 45671
12 Ga0055525_1000287 3300003759 Bacteria 45679
13 Ga0055536_1000046 3300003781 Bacteria 118284
14 Ga0055530_10000133 3300003791 Bacteria 65211
15 Ga0055530_10000373 3300003791 Bacteria 40491
16 Ga0055540_1000070 3300003792 Bacteria 118483
17 Ga0055540_1000168 3300003792 Bacteria 65211
18 Ga0055541_1000067 3300003841 Bacteria 99013
19 Ga0065714_10014210 3300005288 Bacteria 3017
20 Ga0065714_10064673 3300005288 Bacteria 24513
21 Ga0065714_10138475 3300005288 Bacteria 1190
22 Ga0065704_10002589 3300005289 Bacteria 8396
23 Ga0070670_100101802 3300005331 Bacteria 2473
24 Ga0070677_10002370 3300005333 Bacteria 6019
25 Ga0070666_10056923 3300005335 Bacteria 2641
26 Ga0070668_100232101 3300005347 Bacteria 1526
27 Ga0070669_100043365 3300005353 Bacteria 3276
28 Ga0070675_100009872 3300005354 Bacteria 7441
29 Ga0070667_100011368 3300005367 Bacteria 7360
30 Ga0070678_100230010 3300005456 Bacteria 1545
31 Ga0070662_100094493 3300005457 Bacteria 2251
32 Ga0070698_100184684 3300005471 Bacteria 2023
33 Ga0070664_100002081 3300005564 Bacteria 15990
34 Ga0075364_10120357 3300006051 Bacteria 1757
35 Ga0079104_1000823 3300006946 Bacteria 25811
36 Ga0099826_10006487 3300006948 Bacteria 8530
37 Ga0105251_10003948 3300009011 Bacteria 10517
38 Ga0105251_10027263 3300009011 Bacteria 2899
39 Ga0105251_10064332 3300009011 Bacteria 1720
40 Ga0105244_10002493 3300009036 Bacteria 13859
41 Ga0105244_10004498 3300009036 Bacteria 9575
42 Ga0105244_10010865 3300009036 Bacteria 5496
43 Ga0105244_10088853 3300009036 Bacteria 1521
44 Ga0105250_10001079 3300009092 Bacteria 15444
45 Ga0105250_10020997 3300009092 Bacteria 2637
46 Ga0105245_10029428 3300009098 Bacteria 4852
47 Ga0105245_10129308 3300009098 Bacteria 2367
48 Ga0105243_10000045 3300009148 Bacteria 156620
49 Ga0105242_10058672 3300009176 Bacteria 3156
50 Ga0105246_10006450 3300011119 Bacteria 7168
51 Ga0105246_10042493 3300011119 Bacteria 3079
52 Ga0105246_10160175 3300011119 Bacteria 1713
53 Ga0157373_10000819 3300013100 Bacteria 24092
54 Ga0157371_10012245 3300013102 Bacteria 6567
55 Ga0157370_10166047 3300013104 Bacteria 2053
56 Ga0163162_10233883 3300013306 Bacteria 1968
57 Ga0163162_10348567 3300013306 Bacteria 1613
58 Ga0157375_10356087 3300013308 Bacteria 1630
59 Ga0182008_10024943 3300014497 Bacteria 3041
60 Ga0182008_10035139 3300014497 Bacteria 2512
61 Ga0182006_1004220 3300015261 Bacteria 7123
62 Ga0182006_1008963 3300015261 Bacteria 4512
63 Ga0182006_1040659 3300015261 Bacteria 1829
64 Ga0182007_10000177 3300015262 Bacteria 43427
65 Ga0182007_10021277 3300015262 Bacteria 2306
66 Ga0182005_1003224 3300015265 Bacteria 5579
67 Ga0182005_1008785 3300015265 Bacteria 2966
68 Ga0163161_10075624 3300017792 Bacteria 2472
69 Ga0163161_10279784 3300017792 Bacteria 1308
70 Ga0213874_10054497 3300021377 Bacteria 1236
71 Ga0213876_10014059 3300021384 Bacteria 4245
72 Ga0213875_10095134 3300021388 Bacteria 1389
73 Ga0209435_101168 3300025206 Bacteria 3590
74 Ga0209760_100023 3300025207 Bacteria 159144
75 Ga0209784_100058 3300025224 Bacteria 167327
76 Ga0209566_100045 3300025225 Bacteria 258557
77 Ga0209674_100096 3300025226 Bacteria 167418
78 Ga0209147_100056 3300025229 Bacteria 258557
79 Ga0209563_100064 3300025230 Bacteria 258557
80 Ga0207427_100018 3300025231 Bacteria 530735
81 Ga0209437_100031 3300025233 Bacteria 530871
82 Ga0209258_100446 3300025242 Bacteria 45941
83 Ga0209646_1000147 3300025246 Bacteria 103287
84 Ga0209677_100053 3300025253 Bacteria 167537
85 Ga0209233_1000012 3300025261 Bacteria 1019519
86 Ga0209676_1000055 3300025292 Bacteria 361565
87 Ga0209676_1001524 3300025292 Bacteria 21049
88 Ga0209050_1000043 3300025298 Bacteria 398654
89 Ga0209050_1000231 3300025298 Bacteria 122373
90 Ga0209051_1000030 3300025303 Bacteria 398654
91 Ga0209051_1000165 3300025303 Bacteria 122373
92 Ga0209051_1003240 3300025303 Bacteria 10826
93 Ga0209257_1000767 3300025304 Bacteria 47879
94 Ga0209257_1007776 3300025304 Bacteria 6362
95 Ga0207697_10008336 3300025315 Bacteria 4544
96 Ga0207696_1000041 3300025711 Bacteria 311695
97 Ga0207696_1000628 3300025711 Bacteria 25903
98 Ga0207655_1000085 3300025728 Bacteria 206425
99 Ga0207655_1000141 3300025728 Bacteria 138956
100 Ga0207655_1019266 3300025728 Bacteria 3576
101 Ga0207655_1030383 3300025728 Bacteria 2513
102 Ga0207655_1033394 3300025728 Bacteria 2333
103 Ga0207713_1001279 3300025735 Bacteria 20735
104 Ga0207713_1029754 3300025735 Bacteria 2441
105 Ga0207682_10002517 3300025893 Bacteria 8190
106 Ga0207680_10042627 3300025903 Bacteria 2656
107 Ga0207645_10004346 3300025907 Bacteria 10495
108 Ga0207681_10007454 3300025923 Bacteria 6705
109 Ga0207650_10102897 3300025925 Bacteria 2201
110 Ga0207706_10031488 3300025933 Bacteria 4725
111 Ga0207686_10126289 3300025934 Bacteria 1748
112 Ga0207709_10000011 3300025935 Bacteria 552881
113 Ga0207709_10207178 3300025935 Bacteria 1405
114 Ga0207691_10002435 3300025940 Bacteria 18208
115 Ga0207679_10031184 3300025945 Bacteria 3730
116 Ga0207651_10263124 3300025960 Bacteria 1417
117 Ga0207683_10009799 3300026121 Bacteria 8171
118 Ga0209281_1000009 3300027111 Bacteria 771717
119 Ga0207428_10001057 3300027907 Bacteria 30209
120 Ga0207428_10078079 3300027907 Bacteria 2591
121 Ga0207428_10089847 3300027907 Bacteria 2387
122 Ga0316181_1147544 3300030744 Bacteria 2598
123 Ga0265340_10000078 3300031247 Bacteria 46872
124 Ga0307513_10000671 3300031456 Bacteria 49068
125 Ga0307408_100000480 3300031548 Bacteria 34947
126 Ga0307408_100003833 3300031548 Bacteria 10233
127 Ga0307408_100009042 3300031548 Bacteria 6579
128 Ga0307408_100023893 3300031548 Bacteria 4167
129 Ga0307408_100032366 3300031548 Bacteria 3645
130 Ga0307408_100088722 3300031548 Bacteria 2330
131 Ga0307408_100140620 3300031548 Bacteria 1894
132 Ga0307408_100163890 3300031548 Bacteria 1768
133 Ga0307408_100186627 3300031548 Bacteria 1667
134 Ga0307408_100196543 3300031548 Bacteria 1629
135 Ga0307408_100198859 3300031548 Bacteria 1620
136 Ga0307405_10002090 3300031731 Bacteria 8705
137 Ga0307405_10003259 3300031731 Bacteria 7407
138 Ga0307405_10058184 3300031731 Bacteria 2431
139 Ga0307405_10069907 3300031731 Bacteria 2252
140 Ga0307413_10016367 3300031824 Bacteria 3828
141 Ga0307413_10022403 3300031824 Bacteria 3404
142 Ga0307413_10033700 3300031824 Bacteria 2919
143 Ga0307413_10061829 3300031824 Bacteria 2313
144 Ga0307413_10292412 3300031824 Bacteria 1231
145 Ga0307410_10045466 3300031852 Bacteria 2923
146 Ga0307410_10094229 3300031852 Bacteria 2132
147 Ga0307410_10231487 3300031852 Bacteria 1427
148 Ga0307406_10049754 3300031901 Bacteria 2653
149 Ga0307406_10061025 3300031901 Bacteria 2433
150 Ga0307406_10096580 3300031901 Bacteria 2002
151 Ga0307406_10097583 3300031901 Bacteria 1993
152 Ga0307407_10012207 3300031903 Bacteria 4122
153 Ga0307407_10031947 3300031903 Bacteria 2856
154 Ga0307407_10032742 3300031903 Bacteria 2830
155 Ga0307407_10089561 3300031903 Bacteria 1882
156 Ga0307407_10142664 3300031903 Bacteria 1547
157 Ga0307412_10000254 3300031911 Bacteria 34625
158 Ga0307412_10001950 3300031911 Bacteria 11412
159 Ga0307412_10014413 3300031911 Bacteria 4661
160 Ga0307412_10030830 3300031911 Bacteria 3381
161 Ga0307412_10031452 3300031911 Bacteria 3352
162 Ga0307412_10033748 3300031911 Bacteria 3255
163 Ga0307412_10075179 3300031911 Bacteria 2316
164 Ga0307412_10189035 3300031911 Bacteria 1555
165 Ga0307409_100041255 3300031995 Bacteria 3445
166 Ga0307409_100056642 3300031995 Bacteria 3032
167 Ga0307409_100103847 3300031995 Bacteria 2365
168 Ga0307416_100035724 3300032002 Bacteria 3800
169 Ga0307416_100058272 3300032002 Bacteria 3130
170 Ga0307416_100172350 3300032002 Bacteria 2016
171 Ga0307416_100351194 3300032002 Bacteria 1492
172 Ga0307416_100403265 3300032002 Bacteria 1405
173 Ga0307416_100512785 3300032002 Bacteria 1266
174 Ga0307414_10036060 3300032004 Bacteria 3297
175 Ga0307414_10069042 3300032004 Bacteria 2539
176 Ga0307414_10349286 3300032004 Bacteria 1269
177 Ga0307411_10026491 3300032005 Bacteria 3492
178 Ga0307411_10028873 3300032005 Bacteria 3378
179 Ga0307411_10125050 3300032005 Bacteria 1868
180 Ga0307415_100107380 3300032126 Bacteria 2062
181 Ga0307415_100421685 3300032126 Bacteria 1145
182 Ga0373956_0000852 3300035119 Bacteria 12692
183 Ga0395899_0020869 3300037312 Bacteria 4968
184 Ga0395900_0144017 3300037418 Bacteria 2438
185 Ga0395898_0064475 3300037466 Bacteria 3553
186 Ga0436364_0277731 3300037853 Bacteria 7014
187 Ga0436364_0510689 3300037853 Bacteria 9633
188 Ga0395901_0031846 3300038443 Bacteria 5437
189 Ga0395901_0041041 3300038443 Bacteria 4794
190 Ga0395901_0086408 3300038443 Bacteria 3279
191 Ga0436365_0623832 3300039437 Bacteria 4245
192 Ga0436365_1685261 3300039437 Bacteria 3556
193 Ga0436360_0229073 3300039438 Bacteria 1759
194 Ga0439438_005931 3300041405 Bacteria 4409
195 Ga0439438_010402 3300041405 Bacteria 2942
196 Ga0439438_012718 3300041405 Bacteria 2568
197 Ga0439438_014038 3300041405 Bacteria 2394
198 Ga0439447_008800 3300041407 Bacteria 3103
199 Ga0439447_010615 3300041407 Bacteria 2725
200 Ga0439447_019574 3300041407 Bacteria 1803
201 Ga0439466_0040439 3300041411 Bacteria 1559
202 Ga0439433_0022638 3300041999 Bacteria 1411
203 Ga0439442_000424 3300042002 Bacteria 9735
204 Ga0439445_0042466 3300042004 Bacteria 1211
205 Ga0439432_025694 3300042006 Bacteria 1930
206 Ga0439451_002893 3300042009 Bacteria 3490
207 Ga0439451_005181 3300042009 Bacteria 2651
208 Ga0439451_014668 3300042009 Bacteria 1580
209 Ga0439452_025118 3300042010 Bacteria 1515
210 Ga0439452_025541 3300042010 Bacteria 1498
211 Ga0439456_006139 3300042013 Bacteria 2445
212 Ga0439456_008694 3300042013 Bacteria 2097
213 Ga0439456_009932 3300042013 Bacteria 1964
214 Ga0439463_000317 3300042016 Bacteria 13525
215 Ga0439463_022499 3300042016 Bacteria 1577
216 Ga0450911_002130 3300042115 Bacteria 4043
217 Ga0450919_002357 3300042121 Bacteria 2447
218 Ga0450919_004630 3300042121 Bacteria 1676
219 Ga0450920_000141 3300042122 Bacteria 10055
220 Ga0450902_013843 3300042137 Bacteria 1301
221 Ga0450903_005504 3300042138 Bacteria 2118
222 Ga0450906_003237 3300042145 Bacteria 3514
223 Ga0450907_000010 3300042146 Bacteria 95376
224 Ga0450907_000256 3300042146 Bacteria 18128
225 Ga0450907_002430 3300042146 Bacteria 3553
226 Ga0450907_011097 3300042146 Bacteria 1496
227 Ga0450910_003445 3300042147 Bacteria 2102
228 Ga0439446_0002445 3300042156 Bacteria 4455
229 Ga0450909_001023 3300042185 Bacteria 3844
230 Ga0450909_006155 3300042185 Bacteria 1731
231 Ga0439434_0000301 3300042435 Bacteria 14180
232 Ga0439434_0000947 3300042435 Bacteria 8356
233 Ga0439434_0023749 3300042435 Bacteria 1847
234 Ga0439464_0008430 3300042439 Bacteria 2700
235 Ga0439460_0005166 3300042461 Bacteria 3198
236 Ga0439460_0020839 3300042461 Bacteria 1785
237 Ga0450918_002140 3300042531 Bacteria 3771
238 Ga0450918_003225 3300042531 Bacteria 3042
239 Ga0439440_0005108 3300042993 Bacteria 2593
240 Ga0495617_000054 3300046452 Bacteria 102256
241 Ga0495617_000144 3300046452 Bacteria 46606
242 Ga0495617_008090 3300046452 Bacteria 3634
243 Ga0495617_012000 3300046452 Bacteria 2955
244 Ga0495617_021113 3300046452 Bacteria 2200
245 Ga0495617_054518 3300046452 Bacteria 1327
246 Ga0495627_000195 3300046453 Bacteria 66451
247 Ga0495627_000308 3300046453 Bacteria 48367
248 Ga0495590_0001206 3300046457 Bacteria 11305
249 Ga0495590_0004191 3300046457 Bacteria 5835
250 Ga0495590_0022988 3300046457 Bacteria 2203
251 Ga0495590_0040867 3300046457 Bacteria 1616
252 Ga0495591_000184 3300046458 Bacteria 64774
253 Ga0495591_000315 3300046458 Bacteria 43798
254 Ga0495591_008305 3300046458 Bacteria 4273
255 Ga0495629_0144367 3300046459 Bacteria 1656
256 Ga0495638_0054510 3300046460 Bacteria 2485
257 Ga0495638_0100229 3300046460 Bacteria 1733
258 Ga0495653_0037631 3300046463 Bacteria 3799
259 Ga0495650_0000881 3300046471 Bacteria 35559
260 Ga0495650_0005496 3300046471 Bacteria 8193
261 Ga0495650_0006867 3300046471 Bacteria 7001
262 Ga0495650_0011574 3300046471 Bacteria 4821
263 Ga0495650_0018023 3300046471 Bacteria 3521
264 Ga0495580_0018269 3300046472 Bacteria 5223
265 Ga0495605_0000045 3300046474 Bacteria 176155
266 Ga0495605_0000191 3300046474 Bacteria 76513
267 Ga0495605_0000563 3300046474 Bacteria 30312
268 Ga0495605_0000794 3300046474 Bacteria 22656
269 Ga0495605_0001618 3300046474 Bacteria 14583
270 Ga0495605_0003671 3300046474 Bacteria 9114
271 Ga0495605_0010840 3300046474 Bacteria 5090
272 Ga0495605_0039013 3300046474 Bacteria 2380
273 Ga0495605_0045075 3300046474 Bacteria 2175
274 Ga0495605_0074486 3300046474 Bacteria 1597
275 Ga0495639_0000032 3300046475 Bacteria 64548
276 Ga0495584_0000409 3300046491 Bacteria 29687
277 Ga0495584_0000547 3300046491 Bacteria 25497
278 Ga0495584_0001764 3300046491 Bacteria 12598
279 Ga0495584_0004919 3300046491 Bacteria 7128
280 Ga0495585_0014976 3300046492 Bacteria 4509
281 Ga0495585_0029734 3300046492 Bacteria 3109
282 Ga0495594_0005294 3300046499 Bacteria 6624
283 Ga0495594_0014081 3300046499 Bacteria 4187
284 Ga0495596_0045500 3300046500 Bacteria 1725
285 Ga0495607_0000058 3300046501 Bacteria 109864
286 Ga0495607_0000172 3300046501 Bacteria 68720
287 Ga0495607_0000179 3300046501 Bacteria 67285
288 Ga0495607_0000185 3300046501 Bacteria 66759
289 Ga0495607_0000290 3300046501 Bacteria 53251
290 Ga0495607_0000617 3300046501 Bacteria 34500
291 Ga0495607_0006225 3300046501 Bacteria 8415
292 Ga0495607_0015398 3300046501 Bacteria 4957
293 Ga0495607_0018916 3300046501 Bacteria 4381
294 Ga0495607_0026196 3300046501 Bacteria 3619
295 Ga0495607_0036726 3300046501 Bacteria 2949
296 Ga0495607_0037319 3300046501 Bacteria 2920
297 Ga0495607_0043695 3300046501 Bacteria 2647
298 Ga0495607_0124378 3300046501 Bacteria 1350
299 Ga0495583_0000101 3300046506 Bacteria 144916
300 Ga0495583_0000483 3300046506 Bacteria 58302
301 Ga0495583_0010856 3300046506 Bacteria 5271
302 Ga0495583_0018184 3300046506 Bacteria 3707
303 Ga0495583_0030833 3300046506 Bacteria 2606
304 Ga0495583_0034050 3300046506 Bacteria 2444
305 Ga0495606_0023383 3300046507 Bacteria 4478
306 Ga0495610_0016642 3300046512 Bacteria 4223
307 Ga0495610_0080746 3300046512 Bacteria 1494
308 Ga0495616_0000226 3300046513 Bacteria 46396
309 Ga0495616_0000661 3300046513 Bacteria 25616
310 Ga0495620_0000001 3300046515 Bacteria 386508
311 Ga0495620_0000166 3300046515 Bacteria 52419
312 Ga0495620_0004341 3300046515 Bacteria 8013
313 Ga0495620_0021166 3300046515 Bacteria 3162
314 Ga0495628_0214004 3300046516 Bacteria 1449
315 Ga0495631_0004644 3300046518 Bacteria 7265
316 Ga0495632_0000754 3300046519 Bacteria 29135
317 Ga0495632_0001740 3300046519 Bacteria 17652
318 Ga0495632_0005660 3300046519 Bacteria 8215
319 Ga0495632_0012766 3300046519 Bacteria 4823
320 Ga0495632_0075121 3300046519 Bacteria 1618
321 Ga0495637_0000037 3300046520 Bacteria 120732
322 Ga0495637_0001374 3300046520 Bacteria 14567
323 Ga0495637_0005663 3300046520 Bacteria 6339
324 Ga0495637_0007143 3300046520 Bacteria 5560
325 Ga0495637_0007481 3300046520 Bacteria 5410
326 Ga0495637_0022921 3300046520 Bacteria 2842
327 Ga0495637_0035457 3300046520 Bacteria 2178
328 Ga0495637_0089276 3300046520 Bacteria 1218
329 Ga0495637_0100027 3300046520 Bacteria 1134
330 Ga0495643_0054830 3300046522 Bacteria 2133
331 Ga0495643_0063085 3300046522 Bacteria 1960
332 Ga0495644_0001264 3300046523 Bacteria 10378
333 Ga0495644_0039961 3300046523 Bacteria 1768
334 Ga0495648_0000377 3300046524 Bacteria 48820
335 Ga0495648_0001506 3300046524 Bacteria 22801
336 Ga0495648_0003808 3300046524 Bacteria 13105
337 Ga0495648_0035448 3300046524 Bacteria 3234
338 Ga0495648_0044645 3300046524 Bacteria 2765
339 Ga0495666_0025173 3300046526 Bacteria 2940
340 Ga0495642_0000316 3300046528 Bacteria 26656
341 Ga0495642_0004676 3300046528 Bacteria 5303
342 Ga0495654_0000211 3300046530 Bacteria 55188
343 Ga0495654_0000288 3300046530 Bacteria 45799
344 Ga0495654_0000306 3300046530 Bacteria 43427
345 Ga0495654_0034876 3300046530 Bacteria 2536
346 Ga0495654_0045858 3300046530 Bacteria 2155
347 Ga0495654_0106925 3300046530 Bacteria 1280
348 Ga0495587_0004867 3300046536 Bacteria 8808
349 Ga0495609_0000012 3300046538 Bacteria 333994
350 Ga0495609_0000075 3300046538 Bacteria 121584
351 Ga0495609_0001135 3300046538 Bacteria 18421
352 Ga0495609_0007500 3300046538 Bacteria 5440
353 Ga0495609_0008213 3300046538 Bacteria 5123
354 Ga0495609_0021359 3300046538 Bacteria 2986
355 Ga0495609_0083086 3300046538 Bacteria 1398
356 Ga0495597_0000037 3300046542 Bacteria 113832
357 Ga0495597_0002922 3300046542 Bacteria 10378
358 Ga0495597_0012793 3300046542 Bacteria 4039
359 Ga0495597_0081160 3300046542 Bacteria 1387
360 Ga0495597_0085407 3300046542 Bacteria 1345
361 Ga0495645_0043191 3300046543 Bacteria 3288
362 Ga0495622_0000590 3300046557 Bacteria 21268
363 Ga0495622_0007970 3300046557 Bacteria 4911
364 Ga0495622_0011228 3300046557 Bacteria 4136
365 Ga0495633_0000016 3300046558 Bacteria 250457
366 Ga0495633_0027993 3300046558 Bacteria 2749
367 Ga0495668_0045796 3300046616 Bacteria 2431
368 Ga0495668_0066283 3300046616 Bacteria 1987
369 Ga0495634_0000025 3300046642 Bacteria 115964
370 Ga0495611_0002012 3300046648 Bacteria 9612
371 Ga0495611_0010268 3300046648 Bacteria 3961
372 Ga0495611_0013449 3300046648 Bacteria 3485
373 Ga0495625_0000089 3300046660 Bacteria 147075
374 Ga0495625_0000847 3300046660 Bacteria 41784
375 Ga0495625_0041066 3300046660 Bacteria 3368
376 Ga0495625_0067950 3300046660 Bacteria 2506
377 Ga0495625_0221259 3300046660 Bacteria 1240
378 Ga0495635_0034169 3300046663 Bacteria 3527
379 Ga0495659_0003525 3300046664 Bacteria 4987
380 Ga0495661_0000004 3300046665 Bacteria 555340
381 Ga0495661_0000018 3300046665 Bacteria 200787
382 Ga0495661_0000101 3300046665 Bacteria 104928
383 Ga0495661_0004052 3300046665 Bacteria 10673
384 Ga0495661_0015996 3300046665 Bacteria 4987
385 Ga0495588_0032710 3300046674 Bacteria 2622
386 Ga0495588_0040469 3300046674 Bacteria 2377
387 Ga0495588_0108909 3300046674 Bacteria 1458
388 Ga0495623_0030482 3300046679 Bacteria 3469
389 Ga0495669_0001097 3300046684 Bacteria 11202
390 Ga0495613_0273456 3300046689 Bacteria 1174
391 Ga0495670_0005615 3300046691 Bacteria 6153
392 Ga0495670_0013939 3300046691 Bacteria 3954
393 Ga0495670_0053980 3300046691 Bacteria 2012
394 Ga0495671_0000295 3300046692 Bacteria 41756
395 Ga0495671_0001060 3300046692 Bacteria 19054
396 Ga0495671_0004032 3300046692 Bacteria 8872
397 Ga0495671_0018255 3300046692 Bacteria 3724
398 Ga0495671_0019721 3300046692 Bacteria 3559
399 Ga0495671_0065191 3300046692 Bacteria 1792
400 Ga0495649_0000013 3300046694 Bacteria 316013
401 Ga0495649_0000909 3300046694 Bacteria 23449
402 Ga0495649_0048419 3300046694 Bacteria 2309
403 Ga0495649_0069656 3300046694 Bacteria 1886
404 Ga0495649_0081914 3300046694 Bacteria 1725
405 Ga0495589_0000141 3300046794 Bacteria 66457
406 Ga0495589_0000422 3300046794 Bacteria 31472
407 Ga0495589_0025067 3300046794 Bacteria 3027
408 Ga0495589_0059160 3300046794 Bacteria 1883
409 Ga0495660_0000638 3300046810 Bacteria 27219
410 Ga0495660_0003263 3300046810 Bacteria 10066
411 Ga0495660_0009554 3300046810 Bacteria 5654
412 Ga0495660_0014526 3300046810 Bacteria 4554
413 Ga0495660_0022659 3300046810 Bacteria 3584
414 Ga0495660_0041165 3300046810 Bacteria 2559
415 Ga0495660_0050079 3300046810 Bacteria 2277
416 Ga0495660_0058798 3300046810 Bacteria 2069
417 Ga0495660_0124783 3300046810 Bacteria 1298
418 Ga0495581_0001774 3300047315 Bacteria 12047
419 Ga0495581_0020492 3300047315 Bacteria 3836
420 Ga0495581_0031915 3300047315 Bacteria 3051
421 Ga0495604_0002087 3300047317 Bacteria 16085
422 Ga0495672_0001978 3300047320 Bacteria 19360
423 Ga0495672_0004789 3300047320 Bacteria 10912
424 Ga0495672_0006656 3300047320 Bacteria 8875
425 Ga0495672_0023786 3300047320 Bacteria 3958
426 Ga0495672_0028056 3300047320 Bacteria 3568
427 Ga0495672_0028983 3300047320 Bacteria 3493
428 Ga0495672_0054995 3300047320 Bacteria 2323
429 Ga0495672_0070543 3300047320 Bacteria 1979
430 Ga0495672_0071995 3300047320 Bacteria 1954
431 Ga0495676_0000020 3300047321 Bacteria 166813
432 Ga0495676_0049626 3300047321 Bacteria 3372
433 Ga0495680_0003983 3300047322 Bacteria 14264
434 Ga0495683_0000063 3300047323 Bacteria 113542
435 Ga0495683_0000765 3300047323 Bacteria 23107
436 Ga0495683_0006189 3300047323 Bacteria 6552
437 Ga0495683_0023975 3300047323 Bacteria 3134
438 Ga0495683_0024980 3300047323 Bacteria 3063
439 Ga0495683_0035032 3300047323 Bacteria 2551
440 Ga0495683_0051312 3300047323 Bacteria 2062
441 Ga0495687_000715 3300047443 Bacteria 36786
442 Ga0495687_004143 3300047443 Bacteria 9986
443 Ga0495687_008394 3300047443 Bacteria 5915
444 Ga0495687_012721 3300047443 Bacteria 4435
445 Ga0495687_048786 3300047443 Bacteria 1814
446 Ga0495677_0005322 3300047445 Bacteria 4881
447 Ga0495679_000079 3300047446 Bacteria 90806
448 Ga0495679_000165 3300047446 Bacteria 59805
449 Ga0495679_000711 3300047446 Bacteria 21533
450 Ga0495679_005912 3300047446 Bacteria 5361
451 Ga0495679_014366 3300047446 Bacteria 2937
452 Ga0495685_047414 3300047447 Bacteria 1461
453 Ga0495673_0000190 3300047469 Bacteria 97539
454 Ga0495673_0000421 3300047469 Bacteria 48148
455 Ga0495673_0000833 3300047469 Bacteria 28784
456 Ga0495673_0002046 3300047469 Bacteria 14767
457 Ga0495673_0005618 3300047469 Bacteria 7540
458 Ga0495673_0007797 3300047469 Bacteria 6097
459 Ga0495673_0026305 3300047469 Bacteria 2783
460 Ga0495673_0028696 3300047469 Bacteria 2633
461 Ga0495673_0034809 3300047469 Bacteria 2326
462 Ga0495673_0072115 3300047469 Bacteria 1450
463 Ga0495681_0000027 3300047470 Bacteria 141884
464 Ga0495681_0000237 3300047470 Bacteria 45823
465 Ga0495681_0004824 3300047470 Bacteria 9129
466 Ga0495681_0004871 3300047470 Bacteria 9074
467 Ga0495681_0016054 3300047470 Bacteria 4217
468 Ga0495686_0049913 3300047472 Bacteria 2630
469 Ga0495593_0034064 3300047673 Bacteria 2771
470 Ga0495614_0067331 3300048089 Bacteria 1541
471 Ga0495626_0000041 3300048091 Bacteria 172663
472 Ga0495626_0000352 3300048091 Bacteria 48007
473 Ga0495626_0005473 3300048091 Bacteria 7412
474 Ga0495626_0011493 3300048091 Bacteria 4681
475 Ga0495626_0015886 3300048091 Bacteria 3841
476 Ga0496102_0000038 3300048905 Bacteria 198844
477 Ga0496102_0015377 3300048905 Bacteria 6665
478 Ga0496102_0028870 3300048905 Bacteria 4958
479 Ga0496103_0010330 3300048906 Bacteria 5524
480 Ga0496103_0033182 3300048906 Bacteria 3153
481 Ga0496103_0148053 3300048906 Bacteria 1503
482 Ga0496104_0173998 3300048907 Bacteria 2063
483 Ga0496104_0197962 3300048907 Bacteria 1921
484 Ga0496105_0069085 3300048908 Bacteria 2919
485 Ga0496105_0087722 3300048908 Bacteria 2570
486 Ga0496105_0127667 3300048908 Bacteria 2096
487 Ga0496106_0057923 3300048909 Bacteria 2931
488 Ga0496106_0113790 3300048909 Bacteria 2109
489 Ga0496109_0085516 3300048912 Bacteria 2911
490 Ga0496109_0457397 3300048912 Bacteria 1205
491 Ga0496110_0028956 3300048913 Bacteria 4761
492 Ga0496110_0273962 3300048913 Bacteria 1536
493 Ga0496110_0332514 3300048913 Bacteria 1384
494 Ga0496110_0395721 3300048913 Bacteria 1259
495 Ga0496111_0173469 3300048914 Bacteria 1602
496 Ga0496114_0141449 3300048917 Bacteria 2083
497 Ga0496115_0095672 3300048918 Bacteria 2431
498 Ga0496115_0382929 3300048918 Bacteria 1144
499 Ga0496116_0000984 3300048919 Bacteria 34981
500 Ga0496116_0034820 3300048919 Bacteria 3545
501 Ga0496116_0137549 3300048919 Bacteria 1380
502 Ga0496117_0032512 3300048920 Bacteria 3962
503 Ga0496117_0036374 3300048920 Bacteria 3684
504 Ga0496117_0067105 3300048920 Bacteria 2429
505 Ga0496118_0024337 3300048921 Bacteria 5228
506 Ga0496118_0038172 3300048921 Bacteria 3853
507 Ga0496118_0066079 3300048921 Bacteria 2641
508 Ga0496118_0098853 3300048921 Bacteria 1980
509 Ga0496119_0012321 3300048922 Bacteria 6959
510 Ga0496121_0004753 3300048924 Bacteria 17930
511 Ga0496121_0007545 3300048924 Bacteria 13107
512 Ga0496122_0025572 3300048925 Bacteria 5122
513 Ga0496122_0185679 3300048925 Bacteria 1233
514 Ga0496123_0038678 3300048926 Bacteria 3349
515 Ga0496123_0060944 3300048926 Bacteria 2429
516 Ga0496124_0000280 3300048927 Bacteria 97221
517 Ga0496124_0003909 3300048927 Bacteria 17810
518 Ga0496124_0098283 3300048927 Bacteria 2376
519 Ga0496124_0100235 3300048927 Bacteria 2348
520 Ga0496124_0129309 3300048927 Bacteria 2008
521 Ga0496125_0048546 3300048928 Bacteria 3538
522 Ga0496126_0057901 3300048929 Bacteria 3495
523 Ga0496126_0060509 3300048929 Bacteria 3405
524 Ga0495678_000036 3300049459 Bacteria 198018
525 Ga0495678_000724 3300049459 Bacteria 29966
526 Ga0495678_001110 3300049459 Bacteria 22429
527 Ga0495678_002190 3300049459 Bacteria 13698
528 Ga0495678_007868 3300049459 Bacteria 5475
529 Ga0495678_011307 3300049459 Bacteria 4278
530 Ga0495678_046306 3300049459 Bacteria 1710
531 Ga0495682_0000020 3300049460 Bacteria 210849
532 Ga0495682_0000065 3300049460 Bacteria 98530
533 Ga0495682_0001677 3300049460 Bacteria 11299
534 Ga0495682_0009847 3300049460 Bacteria 3719
535 Ga0495682_0024863 3300049460 Bacteria 2230
536 Ga0495682_0038743 3300049460 Bacteria 1751
537 Ga0501032_0023484 3300049569 Bacteria 4259
538 Ga0501034_0000480 3300049571 Bacteria 65697
539 Ga0501037_0080952 3300049573 Bacteria 2355
540 Ga0501222_006611 3300049662 Bacteria 1556
541 nmdc:mga00v17_65991_c1 3300050491 Bacteria 2234
542 Ga0500618_008253 3300053125 Bacteria 2921
543 Ga0500618_008300 3300053125 Bacteria 2906
544 Ga0500573_0117685 3300053140 Bacteria 1482
545 Ga0500616_0001659 3300053153 Bacteria 20584
546 Ga0500634_0047057 3300053161 Bacteria 2329
547 Ga0530510_0180133 3300061734 Bacteria 1567
548 2511258480 2511231004 Bacteria 6669789
549 2511272544 2511231007 Bacteria 6306603
550 2511290774 2511231010 Bacteria 6373152
551 2511313849 2511231014 Bacteria 6462302
552 2511327777 2511231016 Bacteria 6704427
553 2511343834 2511231019 Bacteria 6520662
554 2511358632 2511231021 Bacteria 7302637
555 2599502203 2599185188 Bacteria 6164180
556 2599616068 2599185212 Bacteria 6765997
557 2599772657 2599185248 Bacteria 6696816
558 2599881043 2599185288 Bacteria 6666191
559 2599885067 2599185289 Bacteria 6778765
560 2599899792 2599185291 Bacteria 6775623
561 2599932737 2599185300 Bacteria 6062622
562 2599945253 2599185302 Bacteria 5954930
563 2599949675 2599185303 Bacteria 6512725
564 2599955395 2599185304 Bacteria 5951361
565 2599960883 2599185305 Bacteria 6748700
566 2599965488 2599185306 Bacteria 6637356
567 2599973749 2599185307 Bacteria 6194719
568 2599976603 2599185308 Bacteria 6621546
569 2599984428 2599185309 Bacteria 5969593
570 2599990401 2599185310 Bacteria 6014457
571 2599992828 2599185311 Bacteria 6354990
572 2600001657 2599185312 Bacteria 5912071
573 2600008911 2599185313 Bacteria 6658188
574 2600010652 2599185314 Bacteria 6621749
575 2600018377 2599185315 Bacteria 6771107
576 2600023307 2599185316 Bacteria 6320029
577 2600028220 2599185317 Bacteria 6435722
578 2600034157 2599185318 Bacteria 6961590
579 2600040330 2599185319 Bacteria 6637840
580 2600049237 2599185320 Bacteria 5963263
581 2600052897 2599185321 Bacteria 6764560
582 2600056978 2599185322 Bacteria 6763055
583 2600066805 2599185323 Bacteria 6688755
584 2600074057 2599185324 Bacteria 6590677
585 2600077536 2599185325 Bacteria 6324919
586 2600357331 2600254930 Bacteria 6431253
587 2601690403 2600255296 Bacteria 5784754
588 2624491490 2623620446 Bacteria 6500345
589 2644190363 2643221633 Bacteria 6733554
590 2644284919 2643221650 Bacteria 7029547
591 2652547172 2651869719 Bacteria 6047974
592 2671094655 2667528170 Bacteria 6786960
593 2671124823 2667528176 Bacteria 6724917
594 2678263883 2675903515 Bacteria 6580491
595 2738690745 2738541271 Bacteria 5657310
596 2738810538 2738541294 Bacteria 6925949
597 2738897898 2738541309 Bacteria 6926455
598 2739257985 2738543015 Bacteria 6750701
599 2739266519 2738543016 Bacteria 5657564
600 2745004336 2744054620 Bacteria 6551379
601 2774123124 2773857670 Bacteria 6407454
602 2775657010 2775506735 Bacteria 4556596
603 2784315470 2784132072 Bacteria 6596533
604 2794594728 2791355520 Bacteria 5948615
605 2808829251 2808606357 Bacteria 4466944
606 2808854894 2808606361 Bacteria 6136259
607 2808898445 2808606371 Bacteria 4251511
608 2808926324 2808606376 Bacteria 6248667
609 2808932737 2808606377 Bacteria 6646337
610 2808934911 2808606378 Bacteria 6177535
611 2808948425 2808606380 Bacteria 6248705
612 2808954873 2808606381 Bacteria 6646461
613 2808963308 2808606383 Bacteria 6138645
614 2808978541 2808606385 Bacteria 6711065
615 2808993932 2808606388 Bacteria 6706662
616 2808998287 2808606389 Bacteria 6138126
617 2812319003 2811994871 Bacteria 4497550
618 2825657330 2825651385 Bacteria 6715909
619 2842858383 2842854478 Bacteria 6143501
620 2852617429 2852612431 Bacteria 6885235
621 2852672452 2852667396 Bacteria 6885555
622 2857744457 2857740372 Bacteria 4782044
623 2860342509 2860339153 Bacteria 6846989
624 2904497668 2904497146 Bacteria 4731781
625 2904780690 2904776348 Bacteria 4658726
626 2910812221 2910809715 Bacteria 4982797
627 2913039291 2913036834 Bacteria 6704877
628 2919038686 2919034639 Bacteria 4763403
629 2919062494 2919059106 Bacteria 4991624
630 2919456639 2919456309 Bacteria 6586567
631 2919485291 2919481497 Bacteria 6907839
632 2919539682 2919538618 Bacteria 4677069
633 2919700951 2919697872 Bacteria 6553725
634 2923586582 2923586266 Bacteria 6565975
635 2929147882 2929144301 Bacteria 6622272
636 2931369746 2931369376 Bacteria 6847892
637 2931402593 2931396565 Bacteria 7251677
638 2933422093 2933418574 Bacteria 4476724
639 2939647410 2939647034 Bacteria 4681660
640 2945933875 2945928738 Bacteria 6053221
641 2945956447 2945956166 Bacteria 5110334
642 2946041218 2946037020 Bacteria 4900426
643 2946060525 2946059875 Bacteria 4386623
644 2953998342 2953998280 Bacteria 4812144
645 2988729464 2988728565 Bacteria 6124362
646 3007869744 3007866637 Bacteria 5899198
647 8019778383 8019775933 Bacteria 6858656
648 8054505803 8054503363 Bacteria 6101651
649 8056145536 8056143049 Bacteria 6307666
650 8056156913 8056155041 Bacteria 6486948
651 8056166484 8056161164 Bacteria 6106669
652 Ga0065714_10000548
653 MRS2a_Contig_11
654 SwRhRL2b_contig_1122291
655 JGI25162J39368_1000060
656 JGI25163J39215_1000792
657 JGI25164J39214_1000037
658 JGI25165J46597_1000118
659 Ga0055538_1000158
660 Ga0055539_1000208
661 Ga0055533_1000209
662 Ga0055532_1000214
663 Ga0055525_1000287
664 Ga0055536_1000046
665 Ga0055530_10000133
666 Ga0055530_10000373
667 Ga0055540_1000070
668 Ga0055540_1000168
669 Ga0055541_1000067
670 Ga0065714_10014210
671 Ga0065714_10064673
672 Ga0065714_10138475
673 Ga0065704_10002589
674 Ga0070670_100101802
675 Ga0070677_10002370
676 Ga0070666_10056923
677 Ga0070668_100232101
678 Ga0070669_100043365
679 Ga0070675_100009872
680 Ga0070667_100011368
681 Ga0070678_100230010
682 Ga0070662_100094493
683 Ga0070698_100184684
684 Ga0070664_100002081
685 Ga0075364_10120357
686 Ga0079104_1000823
687 Ga0099826_10006487
688 Ga0105251_10003948
689 Ga0105251_10027263
690 Ga0105251_10064332
691 Ga0105244_10002493
692 Ga0105244_10004498
693 Ga0105244_10010865
694 Ga0105244_10088853
695 Ga0105250_10001079
696 Ga0105250_10020997
697 Ga0105245_10029428
698 Ga0105245_10129308
699 Ga0105243_10000045
700 Ga0105242_10058672
701 Ga0105246_10006450
702 Ga0105246_10042493
703 Ga0105246_10160175
704 Ga0157373_10000819
705 Ga0157371_10012245
706 Ga0157370_10166047
707 Ga0163162_10233883
708 Ga0163162_10348567
709 Ga0157375_10356087
710 Ga0182008_10024943
711 Ga0182008_10035139
712 Ga0182006_1004220
713 Ga0182006_1008963
714 Ga0182006_1040659
715 Ga0182007_10000177
716 Ga0182007_10021277
717 Ga0182005_1003224
718 Ga0182005_1008785
719 Ga0163161_10075624
720 Ga0163161_10279784
721 Ga0213874_10054497
722 Ga0213876_10014059
723 Ga0213875_10095134
724 Ga0209435_101168
725 Ga0209760_100023
726 Ga0209784_100058
727 Ga0209566_100045
728 Ga0209674_100096
729 Ga0209147_100056
730 Ga0209563_100064
731 Ga0207427_100018
732 Ga0209437_100031
733 Ga0209258_100446
734 Ga0209646_1000147
735 Ga0209677_100053
736 Ga0209233_1000012
737 Ga0209676_1000055
738 Ga0209676_1001524
739 Ga0209050_1000043
740 Ga0209050_1000231
741 Ga0209051_1000030
742 Ga0209051_1000165
743 Ga0209051_1003240
744 Ga0209257_1000767
745 Ga0209257_1007776
746 Ga0207697_10008336
747 Ga0207696_1000041
748 Ga0207696_1000628
749 Ga0207655_1000085
750 Ga0207655_1000141
751 Ga0207655_1019266
752 Ga0207655_1030383
753 Ga0207655_1033394
754 Ga0207713_1001279
755 Ga0207713_1029754
756 Ga0207682_10002517
757 Ga0207680_10042627
758 Ga0207645_10004346
759 Ga0207681_10007454
760 Ga0207650_10102897
761 Ga0207706_10031488
762 Ga0207686_10126289
763 Ga0207709_10000011
764 Ga0207709_10207178
765 Ga0207691_10002435
766 Ga0207679_10031184
767 Ga0207651_10263124
768 Ga0207683_10009799
769 Ga0209281_1000009
770 Ga0207428_10001057
771 Ga0207428_10078079
772 Ga0207428_10089847
773 Ga0316181_1147544
774 Ga0265340_10000078
775 Ga0307513_10000671
776 Ga0307408_100000480
777 Ga0307408_100003833
778 Ga0307408_100009042
779 Ga0307408_100023893
780 Ga0307408_100032366
781 Ga0307408_100088722
782 Ga0307408_100140620
783 Ga0307408_100163890
784 Ga0307408_100186627
785 Ga0307408_100196543
786 Ga0307408_100198859
787 Ga0307405_10002090
788 Ga0307405_10003259
789 Ga0307405_10058184
790 Ga0307405_10069907
791 Ga0307413_10016367
792 Ga0307413_10022403
793 Ga0307413_10033700
794 Ga0307413_10061829
795 Ga0307413_10292412
796 Ga0307410_10045466
797 Ga0307410_10094229
798 Ga0307410_10231487
799 Ga0307406_10049754
800 Ga0307406_10061025
801 Ga0307406_10096580
802 Ga0307406_10097583
803 Ga0307407_10012207
804 Ga0307407_10031947
805 Ga0307407_10032742
806 Ga0307407_10089561
807 Ga0307407_10142664
808 Ga0307412_10000254
809 Ga0307412_10001950
810 Ga0307412_10014413
811 Ga0307412_10030830
812 Ga0307412_10031452
813 Ga0307412_10033748
814 Ga0307412_10075179
815 Ga0307412_10189035
816 Ga0307409_100041255
817 Ga0307409_100056642
818 Ga0307409_100103847
819 Ga0307416_100035724
820 Ga0307416_100058272
821 Ga0307416_100172350
822 Ga0307416_100351194
823 Ga0307416_100403265
824 Ga0307416_100512785
825 Ga0307414_10036060
826 Ga0307414_10069042
827 Ga0307414_10349286
828 Ga0307411_10026491
829 Ga0307411_10028873
830 Ga0307411_10125050
831 Ga0307415_100107380
832 Ga0307415_100421685
833 Ga0373956_0000852
834 Ga0395899_0020869
835 Ga0395900_0144017
836 Ga0395898_0064475
837 Ga0436364_0277731
838 Ga0436364_0510689
839 Ga0395901_0031846
840 Ga0395901_0041041
841 Ga0395901_0086408
842 Ga0436365_0623832
843 Ga0436365_1685261
844 Ga0436360_0229073
845 Ga0439438_005931
846 Ga0439438_010402
847 Ga0439438_012718
848 Ga0439438_014038
849 Ga0439447_008800
850 Ga0439447_010615
851 Ga0439447_019574
852 Ga0439466_0040439
853 Ga0439433_0022638
854 Ga0439442_000424
855 Ga0439445_0042466
856 Ga0439432_025694
857 Ga0439451_002893
858 Ga0439451_005181
859 Ga0439451_014668
860 Ga0439452_025118
861 Ga0439452_025541
862 Ga0439456_006139
863 Ga0439456_008694
864 Ga0439456_009932
865 Ga0439463_000317
866 Ga0439463_022499
867 Ga0450911_002130
868 Ga0450919_002357
869 Ga0450919_004630
870 Ga0450920_000141
871 Ga0450902_013843
872 Ga0450903_005504
873 Ga0450906_003237
874 Ga0450907_000010
875 Ga0450907_000256
876 Ga0450907_002430
877 Ga0450907_011097
878 Ga0450910_003445
879 Ga0439446_0002445
880 Ga0450909_001023
881 Ga0450909_006155
882 Ga0439434_0000301
883 Ga0439434_0000947
884 Ga0439434_0023749
885 Ga0439464_0008430
886 Ga0439460_0005166
887 Ga0439460_0020839
888 Ga0450918_002140
889 Ga0450918_003225
890 Ga0439440_0005108
891 Ga0495617_000054
892 Ga0495617_000144
893 Ga0495617_008090
894 Ga0495617_012000
895 Ga0495617_021113
896 Ga0495617_054518
897 Ga0495627_000195
898 Ga0495627_000308
899 Ga0495590_0001206
900 Ga0495590_0004191
901 Ga0495590_0022988
902 Ga0495590_0040867
903 Ga0495591_000184
904 Ga0495591_000315
905 Ga0495591_008305
906 Ga0495629_0144367
907 Ga0495638_0054510
908 Ga0495638_0100229
909 Ga0495653_0037631
910 Ga0495650_0000881
911 Ga0495650_0005496
912 Ga0495650_0006867
913 Ga0495650_0011574
914 Ga0495650_0018023
915 Ga0495580_0018269
916 Ga0495605_0000045
917 Ga0495605_0000191
918 Ga0495605_0000563
919 Ga0495605_0000794
920 Ga0495605_0001618
921 Ga0495605_0003671
922 Ga0495605_0010840
923 Ga0495605_0039013
924 Ga0495605_0045075
925 Ga0495605_0074486
926 Ga0495639_0000032
927 Ga0495584_0000409
928 Ga0495584_0000547
929 Ga0495584_0001764
930 Ga0495584_0004919
931 Ga0495585_0014976
932 Ga0495585_0029734
933 Ga0495594_0005294
934 Ga0495594_0014081
935 Ga0495596_0045500
936 Ga0495607_0000058
937 Ga0495607_0000172
938 Ga0495607_0000179
939 Ga0495607_0000185
940 Ga0495607_0000290
941 Ga0495607_0000617
942 Ga0495607_0006225
943 Ga0495607_0015398
944 Ga0495607_0018916
945 Ga0495607_0026196
946 Ga0495607_0036726
947 Ga0495607_0037319
948 Ga0495607_0043695
949 Ga0495607_0124378
950 Ga0495583_0000101
951 Ga0495583_0000483
952 Ga0495583_0010856
953 Ga0495583_0018184
954 Ga0495583_0030833
955 Ga0495583_0034050
956 Ga0495606_0023383
957 Ga0495610_0016642
958 Ga0495610_0080746
959 Ga0495616_0000226
960 Ga0495616_0000661
961 Ga0495620_0000001
962 Ga0495620_0000166
963 Ga0495620_0004341
964 Ga0495620_0021166
965 Ga0495628_0214004
966 Ga0495631_0004644
967 Ga0495632_0000754
968 Ga0495632_0001740
969 Ga0495632_0005660
970 Ga0495632_0012766
971 Ga0495632_0075121
972 Ga0495637_0000037
973 Ga0495637_0001374
974 Ga0495637_0005663
975 Ga0495637_0007143
976 Ga0495637_0007481
977 Ga0495637_0022921
978 Ga0495637_0035457
979 Ga0495637_0089276
980 Ga0495637_0100027
981 Ga0495643_0054830
982 Ga0495643_0063085
983 Ga0495644_0001264
984 Ga0495644_0039961
985 Ga0495648_0000377
986 Ga0495648_0001506
987 Ga0495648_0003808
988 Ga0495648_0035448
989 Ga0495648_0044645
990 Ga0495666_0025173
991 Ga0495642_0000316
992 Ga0495642_0004676
993 Ga0495654_0000211
994 Ga0495654_0000288
995 Ga0495654_0000306
996 Ga0495654_0034876
997 Ga0495654_0045858
998 Ga0495654_0106925
999 Ga0495587_0004867
1000 Ga0495609_0000012
1001 Ga0495609_0000075
1002 Ga0495609_0001135
1003 Ga0495609_0007500
1004 Ga0495609_0008213
1005 Ga0495609_0021359
1006 Ga0495609_0083086
1007 Ga0495597_0000037
1008 Ga0495597_0002922
1009 Ga0495597_0012793
1010 Ga0495597_0081160
1011 Ga0495597_0085407
1012 Ga0495645_0043191
1013 Ga0495622_0000590
1014 Ga0495622_0007970
1015 Ga0495622_0011228
1016 Ga0495633_0000016
1017 Ga0495633_0027993
1018 Ga0495668_0045796
1019 Ga0495668_0066283
1020 Ga0495634_0000025
1021 Ga0495611_0002012
1022 Ga0495611_0010268
1023 Ga0495611_0013449
1024 Ga0495625_0000089
1025 Ga0495625_0000847
1026 Ga0495625_0041066
1027 Ga0495625_0067950
1028 Ga0495625_0221259
1029 Ga0495635_0034169
1030 Ga0495659_0003525
1031 Ga0495661_0000004
1032 Ga0495661_0000018
1033 Ga0495661_0000101
1034 Ga0495661_0004052
1035 Ga0495661_0015996
1036 Ga0495588_0032710
1037 Ga0495588_0040469
1038 Ga0495588_0108909
1039 Ga0495623_0030482
1040 Ga0495669_0001097
1041 Ga0495613_0273456
1042 Ga0495670_0005615
1043 Ga0495670_0013939
1044 Ga0495670_0053980
1045 Ga0495671_0000295
1046 Ga0495671_0001060
1047 Ga0495671_0004032
1048 Ga0495671_0018255
1049 Ga0495671_0019721
1050 Ga0495671_0065191
1051 Ga0495649_0000013
1052 Ga0495649_0000909
1053 Ga0495649_0048419
1054 Ga0495649_0069656
1055 Ga0495649_0081914
1056 Ga0495589_0000141
1057 Ga0495589_0000422
1058 Ga0495589_0025067
1059 Ga0495589_0059160
1060 Ga0495660_0000638
1061 Ga0495660_0003263
1062 Ga0495660_0009554
1063 Ga0495660_0014526
1064 Ga0495660_0022659
1065 Ga0495660_0041165
1066 Ga0495660_0050079
1067 Ga0495660_0058798
1068 Ga0495660_0124783
1069 Ga0495581_0001774
1070 Ga0495581_0020492
1071 Ga0495581_0031915
1072 Ga0495604_0002087
1073 Ga0495672_0001978
1074 Ga0495672_0004789
1075 Ga0495672_0006656
1076 Ga0495672_0023786
1077 Ga0495672_0028056
1078 Ga0495672_0028983
1079 Ga0495672_0054995
1080 Ga0495672_0070543
1081 Ga0495672_0071995
1082 Ga0495676_0000020
1083 Ga0495676_0049626
1084 Ga0495680_0003983
1085 Ga0495683_0000063
1086 Ga0495683_0000765
1087 Ga0495683_0006189
1088 Ga0495683_0023975
1089 Ga0495683_0024980
1090 Ga0495683_0035032
1091 Ga0495683_0051312
1092 Ga0495687_000715
1093 Ga0495687_004143
1094 Ga0495687_008394
1095 Ga0495687_012721
1096 Ga0495687_048786
1097 Ga0495677_0005322
1098 Ga0495679_000079
1099 Ga0495679_000165
1100 Ga0495679_000711
1101 Ga0495679_005912
1102 Ga0495679_014366
1103 Ga0495685_047414
1104 Ga0495673_0000190
1105 Ga0495673_0000421
1106 Ga0495673_0000833
1107 Ga0495673_0002046
1108 Ga0495673_0005618
1109 Ga0495673_0007797
1110 Ga0495673_0026305
1111 Ga0495673_0028696
1112 Ga0495673_0034809
1113 Ga0495673_0072115
1114 Ga0495681_0000027
1115 Ga0495681_0000237
1116 Ga0495681_0004824
1117 Ga0495681_0004871
1118 Ga0495681_0016054
1119 Ga0495686_0049913
1120 Ga0495593_0034064
1121 Ga0495614_0067331
1122 Ga0495626_0000041
1123 Ga0495626_0000352
1124 Ga0495626_0005473
1125 Ga0495626_0011493
1126 Ga0495626_0015886
1127 Ga0496102_0000038
1128 Ga0496102_0015377
1129 Ga0496102_0028870
1130 Ga0496103_0010330
1131 Ga0496103_0033182
1132 Ga0496103_0148053
1133 Ga0496104_0173998
1134 Ga0496104_0197962
1135 Ga0496105_0069085
1136 Ga0496105_0087722
1137 Ga0496105_0127667
1138 Ga0496106_0057923
1139 Ga0496106_0113790
1140 Ga0496109_0085516
1141 Ga0496109_0457397
1142 Ga0496110_0028956
1143 Ga0496110_0273962
1144 Ga0496110_0332514
1145 Ga0496110_0395721
1146 Ga0496111_0173469
1147 Ga0496114_0141449
1148 Ga0496115_0095672
1149 Ga0496115_0382929
1150 Ga0496116_0000984
1151 Ga0496116_0034820
1152 Ga0496116_0137549
1153 Ga0496117_0032512
1154 Ga0496117_0036374
1155 Ga0496117_0067105
1156 Ga0496118_0024337
1157 Ga0496118_0038172
1158 Ga0496118_0066079
1159 Ga0496118_0098853
1160 Ga0496119_0012321
1161 Ga0496121_0004753
1162 Ga0496121_0007545
1163 Ga0496122_0025572
1164 Ga0496122_0185679
1165 Ga0496123_0038678
1166 Ga0496123_0060944
1167 Ga0496124_0000280
1168 Ga0496124_0003909
1169 Ga0496124_0098283
1170 Ga0496124_0100235
1171 Ga0496124_0129309
1172 Ga0496125_0048546
1173 Ga0496126_0057901
1174 Ga0496126_0060509
1175 Ga0495678_000036
1176 Ga0495678_000724
1177 Ga0495678_001110
1178 Ga0495678_002190
1179 Ga0495678_007868
1180 Ga0495678_011307
1181 Ga0495678_046306
1182 Ga0495682_0000020
1183 Ga0495682_0000065
1184 Ga0495682_0001677
1185 Ga0495682_0009847
1186 Ga0495682_0024863
1187 Ga0495682_0038743
1188 Ga0501032_0023484
1189 Ga0501034_0000480
1190 Ga0501037_0080952
1191 Ga0501222_006611
1192 nmdc:mga00v17_65991_c1
1193 Ga0500618_008253
1194 Ga0500618_008300
1195 Ga0500573_0117685
1196 Ga0500616_0001659
1197 Ga0500634_0047057
1198 Ga0530510_0180133
1199 2511258480
1200 2511272544
1201 2511290774
1202 2511313849
1203 2511327777
1204 2511343834
1205 2511358632
1206 2599502203
1207 2599616068
1208 2599772657
1209 2599881043
1210 2599885067
1211 2599899792
1212 2599932737
1213 2599945253
1214 2599949675
1215 2599955395
1216 2599960883
1217 2599965488
1218 2599973749
1219 2599976603
1220 2599984428
1221 2599990401
1222 2599992828
1223 2600001657
1224 2600008911
1225 2600010652
1226 2600018377
1227 2600023307
1228 2600028220
1229 2600034157
1230 2600040330
1231 2600049237
1232 2600052897
1233 2600056978
1234 2600066805
1235 2600074057
1236 2600077536
1237 2600357331
1238 2601690403
1239 2624491490
1240 2644190363
1241 2644284919
1242 2652547172
1243 2671094655
1244 2671124823
1245 2678263883
1246 2738690745
1247 2738810538
1248 2738897898
1249 2739257985
1250 2739266519
1251 2745004336
1252 2774123124
1253 2775657010
1254 2784315470
1255 2794594728
1256 2808829251
1257 2808854894
1258 2808898445
1259 2808926324
1260 2808932737
1261 2808934911
1262 2808948425
1263 2808954873
1264 2808963308
1265 2808978541
1266 2808993932
1267 2808998287
1268 2812319003
1269 2825657330
1270 2842858383
1271 2852617429
1272 2852672452
1273 2857744457
1274 2860342509
1275 2904497668
1276 2904780690
1277 2910812221
1278 2913039291
1279 2919038686
1280 2919062494
1281 2919456639
1282 2919485291
1283 2919539682
1284 2919700951
1285 2923586582
1286 2929147882
1287 2931369746
1288 2931402593
1289 2933422093
1290 2939647410
1291 2945933875
1292 2945956447
1293 2946041218
1294 2946060525
1295 2953998342
1296 2988729464
1297 3007869744
1298 8019778383
1299 8054505803
1300 8056145536
1301 8056156913
1302 8056166484

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

42

161

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

169

283

0.96

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

173

380

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gfg-assembly6.cif.gz_L structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9284 15 352
3e82-assembly2.cif.gz_E crystal structure of a putative oxidoreductase from klebsiella pneumoniae 0.9273 14 353
3gfg-assembly3.cif.gz_F structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9266 14 352
3gfg-assembly6.cif.gz_L structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9257 15 352
3gfg-assembly5.cif.gz_I structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form 0.9251 15 352
ID Description Score Start End Superfamily
1xeaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9222 15 132 3.40.50.720
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9136 14 133 3.90.1150.10
af_P75931_1_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9118 15 132 3.40.50.720
3e82E02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9107 139 353 3.30.360.10
af_O42896_134_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9081 143 351 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y8VD34-F1-model_v4 deleted 0.9839 15 125
AF-F3GH84-F1-model_v4 Oxidoreductase 0.9704 200 351
AF-W6VDA6-F1-model_v4 Oxidoreductase domain protein 0.9671 1 362 GO:0000166
GO:0016491
AF-W6VDA6-F1-model_v4 Oxidoreductase domain protein 0.9644 1 362 GO:0000166
GO:0016491
AF-F3GH84-F1-model_v4 Oxidoreductase 0.9581 200 351

Map