F472571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 340 | 1302 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300005288|Ga0065714_10000548|Ga0065714_100005482 |
| Length | 391 |
| Sequence | MIVPTLCVGMQPGTLGVPKADAERPLMHSHAERGNDYQENNMRIGLVGYGHGGRFFHAPLISSLPAATFVGVVTRSPERRQLLAAEHPGVPAFDSIGQLVEAGIDVLVVSTPLKGRPALVLDGIEHGVAVVSDKPFAADAQQAQTLITMAERQGVQLSVYQNRRWDSDFLTVRKLIESGALGQVTRFESRIERYSPQAVNNGSGGGFLRDLGSHLVDQALLLFGPVTRVYAELDYLEKGQAFDNGFFMSLTHASGVTSHLGGSCLQNTPGPRFRVTGSQGCYSVDGLDGQEASALAGLSPKSEGERWGVEEHRRWGWFEQGEVRERVPSERGCWNQFYLQLQTALQSGGPLPVDARDALATTRVLDAARLSAERHQVVELSPFKSHGIKSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 31 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 32 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 45 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 50 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 51 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 52 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 87 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 88 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 95 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 109 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 110 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 111 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 112 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 113 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 114 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 115 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 116 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 117 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 118 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 119 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 120 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 121 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 122 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 123 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 124 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 125 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 126 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 127 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 128 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 129 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 130 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 131 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 132 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 133 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 134 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 135 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 136 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 220 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 221 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 231 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 232 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 234 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 236 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 237 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 238 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 239 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 240 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 241 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 242 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 243 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 244 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 245 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 246 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 247 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 248 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 249 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 250 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 251 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 252 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 253 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 254 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 255 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 256 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 257 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 258 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 259 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 260 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 261 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 262 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 263 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 264 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 265 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 266 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 267 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 268 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 269 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 270 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 271 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 272 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 273 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 274 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 275 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 276 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 277 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 278 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 279 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 280 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 281 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 282 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 283 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 284 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 285 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 286 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 287 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 288 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 289 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 290 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 291 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 292 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 293 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 294 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 295 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 296 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 297 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 298 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 299 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 300 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 301 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 302 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 303 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 304 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 305 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 306 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 307 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 308 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 309 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 310 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 311 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 312 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 313 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 314 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 315 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 316 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 317 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 318 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 319 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 320 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 321 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 322 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 323 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 324 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 325 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 326 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 327 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 328 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 329 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 330 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 331 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 332 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 333 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 334 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 335 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 336 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 337 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 338 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 339 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 340 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.02 |
| Metatranscriptomes | 0 |
| Isolates | 15.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.45 |
| Nodule | 1.54 |
| Rhizoplane | 8.91 |
| Rhizosphere | 73.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10000548 | 3300005288 | Bacteria | 4168 |
| 2 | MRS2a_Contig_11 | 2124908027 | Bacteria | 54720 |
| 3 | SwRhRL2b_contig_1122291 | 2162886007 | Bacteria | 5502 |
| 4 | JGI25162J39368_1000060 | 3300002737 | Bacteria | 137745 |
| 5 | JGI25163J39215_1000792 | 3300002771 | Bacteria | 7675 |
| 6 | JGI25164J39214_1000037 | 3300002772 | Bacteria | 137530 |
| 7 | JGI25165J46597_1000118 | 3300003214 | Bacteria | 137530 |
| 8 | Ga0055538_1000158 | 3300003751 | Bacteria | 45679 |
| 9 | Ga0055539_1000208 | 3300003752 | Bacteria | 45679 |
| 10 | Ga0055533_1000209 | 3300003756 | Bacteria | 45679 |
| 11 | Ga0055532_1000214 | 3300003758 | Bacteria | 45671 |
| 12 | Ga0055525_1000287 | 3300003759 | Bacteria | 45679 |
| 13 | Ga0055536_1000046 | 3300003781 | Bacteria | 118284 |
| 14 | Ga0055530_10000133 | 3300003791 | Bacteria | 65211 |
| 15 | Ga0055530_10000373 | 3300003791 | Bacteria | 40491 |
| 16 | Ga0055540_1000070 | 3300003792 | Bacteria | 118483 |
| 17 | Ga0055540_1000168 | 3300003792 | Bacteria | 65211 |
| 18 | Ga0055541_1000067 | 3300003841 | Bacteria | 99013 |
| 19 | Ga0065714_10014210 | 3300005288 | Bacteria | 3017 |
| 20 | Ga0065714_10064673 | 3300005288 | Bacteria | 24513 |
| 21 | Ga0065714_10138475 | 3300005288 | Bacteria | 1190 |
| 22 | Ga0065704_10002589 | 3300005289 | Bacteria | 8396 |
| 23 | Ga0070670_100101802 | 3300005331 | Bacteria | 2473 |
| 24 | Ga0070677_10002370 | 3300005333 | Bacteria | 6019 |
| 25 | Ga0070666_10056923 | 3300005335 | Bacteria | 2641 |
| 26 | Ga0070668_100232101 | 3300005347 | Bacteria | 1526 |
| 27 | Ga0070669_100043365 | 3300005353 | Bacteria | 3276 |
| 28 | Ga0070675_100009872 | 3300005354 | Bacteria | 7441 |
| 29 | Ga0070667_100011368 | 3300005367 | Bacteria | 7360 |
| 30 | Ga0070678_100230010 | 3300005456 | Bacteria | 1545 |
| 31 | Ga0070662_100094493 | 3300005457 | Bacteria | 2251 |
| 32 | Ga0070698_100184684 | 3300005471 | Bacteria | 2023 |
| 33 | Ga0070664_100002081 | 3300005564 | Bacteria | 15990 |
| 34 | Ga0075364_10120357 | 3300006051 | Bacteria | 1757 |
| 35 | Ga0079104_1000823 | 3300006946 | Bacteria | 25811 |
| 36 | Ga0099826_10006487 | 3300006948 | Bacteria | 8530 |
| 37 | Ga0105251_10003948 | 3300009011 | Bacteria | 10517 |
| 38 | Ga0105251_10027263 | 3300009011 | Bacteria | 2899 |
| 39 | Ga0105251_10064332 | 3300009011 | Bacteria | 1720 |
| 40 | Ga0105244_10002493 | 3300009036 | Bacteria | 13859 |
| 41 | Ga0105244_10004498 | 3300009036 | Bacteria | 9575 |
| 42 | Ga0105244_10010865 | 3300009036 | Bacteria | 5496 |
| 43 | Ga0105244_10088853 | 3300009036 | Bacteria | 1521 |
| 44 | Ga0105250_10001079 | 3300009092 | Bacteria | 15444 |
| 45 | Ga0105250_10020997 | 3300009092 | Bacteria | 2637 |
| 46 | Ga0105245_10029428 | 3300009098 | Bacteria | 4852 |
| 47 | Ga0105245_10129308 | 3300009098 | Bacteria | 2367 |
| 48 | Ga0105243_10000045 | 3300009148 | Bacteria | 156620 |
| 49 | Ga0105242_10058672 | 3300009176 | Bacteria | 3156 |
| 50 | Ga0105246_10006450 | 3300011119 | Bacteria | 7168 |
| 51 | Ga0105246_10042493 | 3300011119 | Bacteria | 3079 |
| 52 | Ga0105246_10160175 | 3300011119 | Bacteria | 1713 |
| 53 | Ga0157373_10000819 | 3300013100 | Bacteria | 24092 |
| 54 | Ga0157371_10012245 | 3300013102 | Bacteria | 6567 |
| 55 | Ga0157370_10166047 | 3300013104 | Bacteria | 2053 |
| 56 | Ga0163162_10233883 | 3300013306 | Bacteria | 1968 |
| 57 | Ga0163162_10348567 | 3300013306 | Bacteria | 1613 |
| 58 | Ga0157375_10356087 | 3300013308 | Bacteria | 1630 |
| 59 | Ga0182008_10024943 | 3300014497 | Bacteria | 3041 |
| 60 | Ga0182008_10035139 | 3300014497 | Bacteria | 2512 |
| 61 | Ga0182006_1004220 | 3300015261 | Bacteria | 7123 |
| 62 | Ga0182006_1008963 | 3300015261 | Bacteria | 4512 |
| 63 | Ga0182006_1040659 | 3300015261 | Bacteria | 1829 |
| 64 | Ga0182007_10000177 | 3300015262 | Bacteria | 43427 |
| 65 | Ga0182007_10021277 | 3300015262 | Bacteria | 2306 |
| 66 | Ga0182005_1003224 | 3300015265 | Bacteria | 5579 |
| 67 | Ga0182005_1008785 | 3300015265 | Bacteria | 2966 |
| 68 | Ga0163161_10075624 | 3300017792 | Bacteria | 2472 |
| 69 | Ga0163161_10279784 | 3300017792 | Bacteria | 1308 |
| 70 | Ga0213874_10054497 | 3300021377 | Bacteria | 1236 |
| 71 | Ga0213876_10014059 | 3300021384 | Bacteria | 4245 |
| 72 | Ga0213875_10095134 | 3300021388 | Bacteria | 1389 |
| 73 | Ga0209435_101168 | 3300025206 | Bacteria | 3590 |
| 74 | Ga0209760_100023 | 3300025207 | Bacteria | 159144 |
| 75 | Ga0209784_100058 | 3300025224 | Bacteria | 167327 |
| 76 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 77 | Ga0209674_100096 | 3300025226 | Bacteria | 167418 |
| 78 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 79 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 80 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 81 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 82 | Ga0209258_100446 | 3300025242 | Bacteria | 45941 |
| 83 | Ga0209646_1000147 | 3300025246 | Bacteria | 103287 |
| 84 | Ga0209677_100053 | 3300025253 | Bacteria | 167537 |
| 85 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 86 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 87 | Ga0209676_1001524 | 3300025292 | Bacteria | 21049 |
| 88 | Ga0209050_1000043 | 3300025298 | Bacteria | 398654 |
| 89 | Ga0209050_1000231 | 3300025298 | Bacteria | 122373 |
| 90 | Ga0209051_1000030 | 3300025303 | Bacteria | 398654 |
| 91 | Ga0209051_1000165 | 3300025303 | Bacteria | 122373 |
| 92 | Ga0209051_1003240 | 3300025303 | Bacteria | 10826 |
| 93 | Ga0209257_1000767 | 3300025304 | Bacteria | 47879 |
| 94 | Ga0209257_1007776 | 3300025304 | Bacteria | 6362 |
| 95 | Ga0207697_10008336 | 3300025315 | Bacteria | 4544 |
| 96 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 97 | Ga0207696_1000628 | 3300025711 | Bacteria | 25903 |
| 98 | Ga0207655_1000085 | 3300025728 | Bacteria | 206425 |
| 99 | Ga0207655_1000141 | 3300025728 | Bacteria | 138956 |
| 100 | Ga0207655_1019266 | 3300025728 | Bacteria | 3576 |
| 101 | Ga0207655_1030383 | 3300025728 | Bacteria | 2513 |
| 102 | Ga0207655_1033394 | 3300025728 | Bacteria | 2333 |
| 103 | Ga0207713_1001279 | 3300025735 | Bacteria | 20735 |
| 104 | Ga0207713_1029754 | 3300025735 | Bacteria | 2441 |
| 105 | Ga0207682_10002517 | 3300025893 | Bacteria | 8190 |
| 106 | Ga0207680_10042627 | 3300025903 | Bacteria | 2656 |
| 107 | Ga0207645_10004346 | 3300025907 | Bacteria | 10495 |
| 108 | Ga0207681_10007454 | 3300025923 | Bacteria | 6705 |
| 109 | Ga0207650_10102897 | 3300025925 | Bacteria | 2201 |
| 110 | Ga0207706_10031488 | 3300025933 | Bacteria | 4725 |
| 111 | Ga0207686_10126289 | 3300025934 | Bacteria | 1748 |
| 112 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 113 | Ga0207709_10207178 | 3300025935 | Bacteria | 1405 |
| 114 | Ga0207691_10002435 | 3300025940 | Bacteria | 18208 |
| 115 | Ga0207679_10031184 | 3300025945 | Bacteria | 3730 |
| 116 | Ga0207651_10263124 | 3300025960 | Bacteria | 1417 |
| 117 | Ga0207683_10009799 | 3300026121 | Bacteria | 8171 |
| 118 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 119 | Ga0207428_10001057 | 3300027907 | Bacteria | 30209 |
| 120 | Ga0207428_10078079 | 3300027907 | Bacteria | 2591 |
| 121 | Ga0207428_10089847 | 3300027907 | Bacteria | 2387 |
| 122 | Ga0316181_1147544 | 3300030744 | Bacteria | 2598 |
| 123 | Ga0265340_10000078 | 3300031247 | Bacteria | 46872 |
| 124 | Ga0307513_10000671 | 3300031456 | Bacteria | 49068 |
| 125 | Ga0307408_100000480 | 3300031548 | Bacteria | 34947 |
| 126 | Ga0307408_100003833 | 3300031548 | Bacteria | 10233 |
| 127 | Ga0307408_100009042 | 3300031548 | Bacteria | 6579 |
| 128 | Ga0307408_100023893 | 3300031548 | Bacteria | 4167 |
| 129 | Ga0307408_100032366 | 3300031548 | Bacteria | 3645 |
| 130 | Ga0307408_100088722 | 3300031548 | Bacteria | 2330 |
| 131 | Ga0307408_100140620 | 3300031548 | Bacteria | 1894 |
| 132 | Ga0307408_100163890 | 3300031548 | Bacteria | 1768 |
| 133 | Ga0307408_100186627 | 3300031548 | Bacteria | 1667 |
| 134 | Ga0307408_100196543 | 3300031548 | Bacteria | 1629 |
| 135 | Ga0307408_100198859 | 3300031548 | Bacteria | 1620 |
| 136 | Ga0307405_10002090 | 3300031731 | Bacteria | 8705 |
| 137 | Ga0307405_10003259 | 3300031731 | Bacteria | 7407 |
| 138 | Ga0307405_10058184 | 3300031731 | Bacteria | 2431 |
| 139 | Ga0307405_10069907 | 3300031731 | Bacteria | 2252 |
| 140 | Ga0307413_10016367 | 3300031824 | Bacteria | 3828 |
| 141 | Ga0307413_10022403 | 3300031824 | Bacteria | 3404 |
| 142 | Ga0307413_10033700 | 3300031824 | Bacteria | 2919 |
| 143 | Ga0307413_10061829 | 3300031824 | Bacteria | 2313 |
| 144 | Ga0307413_10292412 | 3300031824 | Bacteria | 1231 |
| 145 | Ga0307410_10045466 | 3300031852 | Bacteria | 2923 |
| 146 | Ga0307410_10094229 | 3300031852 | Bacteria | 2132 |
| 147 | Ga0307410_10231487 | 3300031852 | Bacteria | 1427 |
| 148 | Ga0307406_10049754 | 3300031901 | Bacteria | 2653 |
| 149 | Ga0307406_10061025 | 3300031901 | Bacteria | 2433 |
| 150 | Ga0307406_10096580 | 3300031901 | Bacteria | 2002 |
| 151 | Ga0307406_10097583 | 3300031901 | Bacteria | 1993 |
| 152 | Ga0307407_10012207 | 3300031903 | Bacteria | 4122 |
| 153 | Ga0307407_10031947 | 3300031903 | Bacteria | 2856 |
| 154 | Ga0307407_10032742 | 3300031903 | Bacteria | 2830 |
| 155 | Ga0307407_10089561 | 3300031903 | Bacteria | 1882 |
| 156 | Ga0307407_10142664 | 3300031903 | Bacteria | 1547 |
| 157 | Ga0307412_10000254 | 3300031911 | Bacteria | 34625 |
| 158 | Ga0307412_10001950 | 3300031911 | Bacteria | 11412 |
| 159 | Ga0307412_10014413 | 3300031911 | Bacteria | 4661 |
| 160 | Ga0307412_10030830 | 3300031911 | Bacteria | 3381 |
| 161 | Ga0307412_10031452 | 3300031911 | Bacteria | 3352 |
| 162 | Ga0307412_10033748 | 3300031911 | Bacteria | 3255 |
| 163 | Ga0307412_10075179 | 3300031911 | Bacteria | 2316 |
| 164 | Ga0307412_10189035 | 3300031911 | Bacteria | 1555 |
| 165 | Ga0307409_100041255 | 3300031995 | Bacteria | 3445 |
| 166 | Ga0307409_100056642 | 3300031995 | Bacteria | 3032 |
| 167 | Ga0307409_100103847 | 3300031995 | Bacteria | 2365 |
| 168 | Ga0307416_100035724 | 3300032002 | Bacteria | 3800 |
| 169 | Ga0307416_100058272 | 3300032002 | Bacteria | 3130 |
| 170 | Ga0307416_100172350 | 3300032002 | Bacteria | 2016 |
| 171 | Ga0307416_100351194 | 3300032002 | Bacteria | 1492 |
| 172 | Ga0307416_100403265 | 3300032002 | Bacteria | 1405 |
| 173 | Ga0307416_100512785 | 3300032002 | Bacteria | 1266 |
| 174 | Ga0307414_10036060 | 3300032004 | Bacteria | 3297 |
| 175 | Ga0307414_10069042 | 3300032004 | Bacteria | 2539 |
| 176 | Ga0307414_10349286 | 3300032004 | Bacteria | 1269 |
| 177 | Ga0307411_10026491 | 3300032005 | Bacteria | 3492 |
| 178 | Ga0307411_10028873 | 3300032005 | Bacteria | 3378 |
| 179 | Ga0307411_10125050 | 3300032005 | Bacteria | 1868 |
| 180 | Ga0307415_100107380 | 3300032126 | Bacteria | 2062 |
| 181 | Ga0307415_100421685 | 3300032126 | Bacteria | 1145 |
| 182 | Ga0373956_0000852 | 3300035119 | Bacteria | 12692 |
| 183 | Ga0395899_0020869 | 3300037312 | Bacteria | 4968 |
| 184 | Ga0395900_0144017 | 3300037418 | Bacteria | 2438 |
| 185 | Ga0395898_0064475 | 3300037466 | Bacteria | 3553 |
| 186 | Ga0436364_0277731 | 3300037853 | Bacteria | 7014 |
| 187 | Ga0436364_0510689 | 3300037853 | Bacteria | 9633 |
| 188 | Ga0395901_0031846 | 3300038443 | Bacteria | 5437 |
| 189 | Ga0395901_0041041 | 3300038443 | Bacteria | 4794 |
| 190 | Ga0395901_0086408 | 3300038443 | Bacteria | 3279 |
| 191 | Ga0436365_0623832 | 3300039437 | Bacteria | 4245 |
| 192 | Ga0436365_1685261 | 3300039437 | Bacteria | 3556 |
| 193 | Ga0436360_0229073 | 3300039438 | Bacteria | 1759 |
| 194 | Ga0439438_005931 | 3300041405 | Bacteria | 4409 |
| 195 | Ga0439438_010402 | 3300041405 | Bacteria | 2942 |
| 196 | Ga0439438_012718 | 3300041405 | Bacteria | 2568 |
| 197 | Ga0439438_014038 | 3300041405 | Bacteria | 2394 |
| 198 | Ga0439447_008800 | 3300041407 | Bacteria | 3103 |
| 199 | Ga0439447_010615 | 3300041407 | Bacteria | 2725 |
| 200 | Ga0439447_019574 | 3300041407 | Bacteria | 1803 |
| 201 | Ga0439466_0040439 | 3300041411 | Bacteria | 1559 |
| 202 | Ga0439433_0022638 | 3300041999 | Bacteria | 1411 |
| 203 | Ga0439442_000424 | 3300042002 | Bacteria | 9735 |
| 204 | Ga0439445_0042466 | 3300042004 | Bacteria | 1211 |
| 205 | Ga0439432_025694 | 3300042006 | Bacteria | 1930 |
| 206 | Ga0439451_002893 | 3300042009 | Bacteria | 3490 |
| 207 | Ga0439451_005181 | 3300042009 | Bacteria | 2651 |
| 208 | Ga0439451_014668 | 3300042009 | Bacteria | 1580 |
| 209 | Ga0439452_025118 | 3300042010 | Bacteria | 1515 |
| 210 | Ga0439452_025541 | 3300042010 | Bacteria | 1498 |
| 211 | Ga0439456_006139 | 3300042013 | Bacteria | 2445 |
| 212 | Ga0439456_008694 | 3300042013 | Bacteria | 2097 |
| 213 | Ga0439456_009932 | 3300042013 | Bacteria | 1964 |
| 214 | Ga0439463_000317 | 3300042016 | Bacteria | 13525 |
| 215 | Ga0439463_022499 | 3300042016 | Bacteria | 1577 |
| 216 | Ga0450911_002130 | 3300042115 | Bacteria | 4043 |
| 217 | Ga0450919_002357 | 3300042121 | Bacteria | 2447 |
| 218 | Ga0450919_004630 | 3300042121 | Bacteria | 1676 |
| 219 | Ga0450920_000141 | 3300042122 | Bacteria | 10055 |
| 220 | Ga0450902_013843 | 3300042137 | Bacteria | 1301 |
| 221 | Ga0450903_005504 | 3300042138 | Bacteria | 2118 |
| 222 | Ga0450906_003237 | 3300042145 | Bacteria | 3514 |
| 223 | Ga0450907_000010 | 3300042146 | Bacteria | 95376 |
| 224 | Ga0450907_000256 | 3300042146 | Bacteria | 18128 |
| 225 | Ga0450907_002430 | 3300042146 | Bacteria | 3553 |
| 226 | Ga0450907_011097 | 3300042146 | Bacteria | 1496 |
| 227 | Ga0450910_003445 | 3300042147 | Bacteria | 2102 |
| 228 | Ga0439446_0002445 | 3300042156 | Bacteria | 4455 |
| 229 | Ga0450909_001023 | 3300042185 | Bacteria | 3844 |
| 230 | Ga0450909_006155 | 3300042185 | Bacteria | 1731 |
| 231 | Ga0439434_0000301 | 3300042435 | Bacteria | 14180 |
| 232 | Ga0439434_0000947 | 3300042435 | Bacteria | 8356 |
| 233 | Ga0439434_0023749 | 3300042435 | Bacteria | 1847 |
| 234 | Ga0439464_0008430 | 3300042439 | Bacteria | 2700 |
| 235 | Ga0439460_0005166 | 3300042461 | Bacteria | 3198 |
| 236 | Ga0439460_0020839 | 3300042461 | Bacteria | 1785 |
| 237 | Ga0450918_002140 | 3300042531 | Bacteria | 3771 |
| 238 | Ga0450918_003225 | 3300042531 | Bacteria | 3042 |
| 239 | Ga0439440_0005108 | 3300042993 | Bacteria | 2593 |
| 240 | Ga0495617_000054 | 3300046452 | Bacteria | 102256 |
| 241 | Ga0495617_000144 | 3300046452 | Bacteria | 46606 |
| 242 | Ga0495617_008090 | 3300046452 | Bacteria | 3634 |
| 243 | Ga0495617_012000 | 3300046452 | Bacteria | 2955 |
| 244 | Ga0495617_021113 | 3300046452 | Bacteria | 2200 |
| 245 | Ga0495617_054518 | 3300046452 | Bacteria | 1327 |
| 246 | Ga0495627_000195 | 3300046453 | Bacteria | 66451 |
| 247 | Ga0495627_000308 | 3300046453 | Bacteria | 48367 |
| 248 | Ga0495590_0001206 | 3300046457 | Bacteria | 11305 |
| 249 | Ga0495590_0004191 | 3300046457 | Bacteria | 5835 |
| 250 | Ga0495590_0022988 | 3300046457 | Bacteria | 2203 |
| 251 | Ga0495590_0040867 | 3300046457 | Bacteria | 1616 |
| 252 | Ga0495591_000184 | 3300046458 | Bacteria | 64774 |
| 253 | Ga0495591_000315 | 3300046458 | Bacteria | 43798 |
| 254 | Ga0495591_008305 | 3300046458 | Bacteria | 4273 |
| 255 | Ga0495629_0144367 | 3300046459 | Bacteria | 1656 |
| 256 | Ga0495638_0054510 | 3300046460 | Bacteria | 2485 |
| 257 | Ga0495638_0100229 | 3300046460 | Bacteria | 1733 |
| 258 | Ga0495653_0037631 | 3300046463 | Bacteria | 3799 |
| 259 | Ga0495650_0000881 | 3300046471 | Bacteria | 35559 |
| 260 | Ga0495650_0005496 | 3300046471 | Bacteria | 8193 |
| 261 | Ga0495650_0006867 | 3300046471 | Bacteria | 7001 |
| 262 | Ga0495650_0011574 | 3300046471 | Bacteria | 4821 |
| 263 | Ga0495650_0018023 | 3300046471 | Bacteria | 3521 |
| 264 | Ga0495580_0018269 | 3300046472 | Bacteria | 5223 |
| 265 | Ga0495605_0000045 | 3300046474 | Bacteria | 176155 |
| 266 | Ga0495605_0000191 | 3300046474 | Bacteria | 76513 |
| 267 | Ga0495605_0000563 | 3300046474 | Bacteria | 30312 |
| 268 | Ga0495605_0000794 | 3300046474 | Bacteria | 22656 |
| 269 | Ga0495605_0001618 | 3300046474 | Bacteria | 14583 |
| 270 | Ga0495605_0003671 | 3300046474 | Bacteria | 9114 |
| 271 | Ga0495605_0010840 | 3300046474 | Bacteria | 5090 |
| 272 | Ga0495605_0039013 | 3300046474 | Bacteria | 2380 |
| 273 | Ga0495605_0045075 | 3300046474 | Bacteria | 2175 |
| 274 | Ga0495605_0074486 | 3300046474 | Bacteria | 1597 |
| 275 | Ga0495639_0000032 | 3300046475 | Bacteria | 64548 |
| 276 | Ga0495584_0000409 | 3300046491 | Bacteria | 29687 |
| 277 | Ga0495584_0000547 | 3300046491 | Bacteria | 25497 |
| 278 | Ga0495584_0001764 | 3300046491 | Bacteria | 12598 |
| 279 | Ga0495584_0004919 | 3300046491 | Bacteria | 7128 |
| 280 | Ga0495585_0014976 | 3300046492 | Bacteria | 4509 |
| 281 | Ga0495585_0029734 | 3300046492 | Bacteria | 3109 |
| 282 | Ga0495594_0005294 | 3300046499 | Bacteria | 6624 |
| 283 | Ga0495594_0014081 | 3300046499 | Bacteria | 4187 |
| 284 | Ga0495596_0045500 | 3300046500 | Bacteria | 1725 |
| 285 | Ga0495607_0000058 | 3300046501 | Bacteria | 109864 |
| 286 | Ga0495607_0000172 | 3300046501 | Bacteria | 68720 |
| 287 | Ga0495607_0000179 | 3300046501 | Bacteria | 67285 |
| 288 | Ga0495607_0000185 | 3300046501 | Bacteria | 66759 |
| 289 | Ga0495607_0000290 | 3300046501 | Bacteria | 53251 |
| 290 | Ga0495607_0000617 | 3300046501 | Bacteria | 34500 |
| 291 | Ga0495607_0006225 | 3300046501 | Bacteria | 8415 |
| 292 | Ga0495607_0015398 | 3300046501 | Bacteria | 4957 |
| 293 | Ga0495607_0018916 | 3300046501 | Bacteria | 4381 |
| 294 | Ga0495607_0026196 | 3300046501 | Bacteria | 3619 |
| 295 | Ga0495607_0036726 | 3300046501 | Bacteria | 2949 |
| 296 | Ga0495607_0037319 | 3300046501 | Bacteria | 2920 |
| 297 | Ga0495607_0043695 | 3300046501 | Bacteria | 2647 |
| 298 | Ga0495607_0124378 | 3300046501 | Bacteria | 1350 |
| 299 | Ga0495583_0000101 | 3300046506 | Bacteria | 144916 |
| 300 | Ga0495583_0000483 | 3300046506 | Bacteria | 58302 |
| 301 | Ga0495583_0010856 | 3300046506 | Bacteria | 5271 |
| 302 | Ga0495583_0018184 | 3300046506 | Bacteria | 3707 |
| 303 | Ga0495583_0030833 | 3300046506 | Bacteria | 2606 |
| 304 | Ga0495583_0034050 | 3300046506 | Bacteria | 2444 |
| 305 | Ga0495606_0023383 | 3300046507 | Bacteria | 4478 |
| 306 | Ga0495610_0016642 | 3300046512 | Bacteria | 4223 |
| 307 | Ga0495610_0080746 | 3300046512 | Bacteria | 1494 |
| 308 | Ga0495616_0000226 | 3300046513 | Bacteria | 46396 |
| 309 | Ga0495616_0000661 | 3300046513 | Bacteria | 25616 |
| 310 | Ga0495620_0000001 | 3300046515 | Bacteria | 386508 |
| 311 | Ga0495620_0000166 | 3300046515 | Bacteria | 52419 |
| 312 | Ga0495620_0004341 | 3300046515 | Bacteria | 8013 |
| 313 | Ga0495620_0021166 | 3300046515 | Bacteria | 3162 |
| 314 | Ga0495628_0214004 | 3300046516 | Bacteria | 1449 |
| 315 | Ga0495631_0004644 | 3300046518 | Bacteria | 7265 |
| 316 | Ga0495632_0000754 | 3300046519 | Bacteria | 29135 |
| 317 | Ga0495632_0001740 | 3300046519 | Bacteria | 17652 |
| 318 | Ga0495632_0005660 | 3300046519 | Bacteria | 8215 |
| 319 | Ga0495632_0012766 | 3300046519 | Bacteria | 4823 |
| 320 | Ga0495632_0075121 | 3300046519 | Bacteria | 1618 |
| 321 | Ga0495637_0000037 | 3300046520 | Bacteria | 120732 |
| 322 | Ga0495637_0001374 | 3300046520 | Bacteria | 14567 |
| 323 | Ga0495637_0005663 | 3300046520 | Bacteria | 6339 |
| 324 | Ga0495637_0007143 | 3300046520 | Bacteria | 5560 |
| 325 | Ga0495637_0007481 | 3300046520 | Bacteria | 5410 |
| 326 | Ga0495637_0022921 | 3300046520 | Bacteria | 2842 |
| 327 | Ga0495637_0035457 | 3300046520 | Bacteria | 2178 |
| 328 | Ga0495637_0089276 | 3300046520 | Bacteria | 1218 |
| 329 | Ga0495637_0100027 | 3300046520 | Bacteria | 1134 |
| 330 | Ga0495643_0054830 | 3300046522 | Bacteria | 2133 |
| 331 | Ga0495643_0063085 | 3300046522 | Bacteria | 1960 |
| 332 | Ga0495644_0001264 | 3300046523 | Bacteria | 10378 |
| 333 | Ga0495644_0039961 | 3300046523 | Bacteria | 1768 |
| 334 | Ga0495648_0000377 | 3300046524 | Bacteria | 48820 |
| 335 | Ga0495648_0001506 | 3300046524 | Bacteria | 22801 |
| 336 | Ga0495648_0003808 | 3300046524 | Bacteria | 13105 |
| 337 | Ga0495648_0035448 | 3300046524 | Bacteria | 3234 |
| 338 | Ga0495648_0044645 | 3300046524 | Bacteria | 2765 |
| 339 | Ga0495666_0025173 | 3300046526 | Bacteria | 2940 |
| 340 | Ga0495642_0000316 | 3300046528 | Bacteria | 26656 |
| 341 | Ga0495642_0004676 | 3300046528 | Bacteria | 5303 |
| 342 | Ga0495654_0000211 | 3300046530 | Bacteria | 55188 |
| 343 | Ga0495654_0000288 | 3300046530 | Bacteria | 45799 |
| 344 | Ga0495654_0000306 | 3300046530 | Bacteria | 43427 |
| 345 | Ga0495654_0034876 | 3300046530 | Bacteria | 2536 |
| 346 | Ga0495654_0045858 | 3300046530 | Bacteria | 2155 |
| 347 | Ga0495654_0106925 | 3300046530 | Bacteria | 1280 |
| 348 | Ga0495587_0004867 | 3300046536 | Bacteria | 8808 |
| 349 | Ga0495609_0000012 | 3300046538 | Bacteria | 333994 |
| 350 | Ga0495609_0000075 | 3300046538 | Bacteria | 121584 |
| 351 | Ga0495609_0001135 | 3300046538 | Bacteria | 18421 |
| 352 | Ga0495609_0007500 | 3300046538 | Bacteria | 5440 |
| 353 | Ga0495609_0008213 | 3300046538 | Bacteria | 5123 |
| 354 | Ga0495609_0021359 | 3300046538 | Bacteria | 2986 |
| 355 | Ga0495609_0083086 | 3300046538 | Bacteria | 1398 |
| 356 | Ga0495597_0000037 | 3300046542 | Bacteria | 113832 |
| 357 | Ga0495597_0002922 | 3300046542 | Bacteria | 10378 |
| 358 | Ga0495597_0012793 | 3300046542 | Bacteria | 4039 |
| 359 | Ga0495597_0081160 | 3300046542 | Bacteria | 1387 |
| 360 | Ga0495597_0085407 | 3300046542 | Bacteria | 1345 |
| 361 | Ga0495645_0043191 | 3300046543 | Bacteria | 3288 |
| 362 | Ga0495622_0000590 | 3300046557 | Bacteria | 21268 |
| 363 | Ga0495622_0007970 | 3300046557 | Bacteria | 4911 |
| 364 | Ga0495622_0011228 | 3300046557 | Bacteria | 4136 |
| 365 | Ga0495633_0000016 | 3300046558 | Bacteria | 250457 |
| 366 | Ga0495633_0027993 | 3300046558 | Bacteria | 2749 |
| 367 | Ga0495668_0045796 | 3300046616 | Bacteria | 2431 |
| 368 | Ga0495668_0066283 | 3300046616 | Bacteria | 1987 |
| 369 | Ga0495634_0000025 | 3300046642 | Bacteria | 115964 |
| 370 | Ga0495611_0002012 | 3300046648 | Bacteria | 9612 |
| 371 | Ga0495611_0010268 | 3300046648 | Bacteria | 3961 |
| 372 | Ga0495611_0013449 | 3300046648 | Bacteria | 3485 |
| 373 | Ga0495625_0000089 | 3300046660 | Bacteria | 147075 |
| 374 | Ga0495625_0000847 | 3300046660 | Bacteria | 41784 |
| 375 | Ga0495625_0041066 | 3300046660 | Bacteria | 3368 |
| 376 | Ga0495625_0067950 | 3300046660 | Bacteria | 2506 |
| 377 | Ga0495625_0221259 | 3300046660 | Bacteria | 1240 |
| 378 | Ga0495635_0034169 | 3300046663 | Bacteria | 3527 |
| 379 | Ga0495659_0003525 | 3300046664 | Bacteria | 4987 |
| 380 | Ga0495661_0000004 | 3300046665 | Bacteria | 555340 |
| 381 | Ga0495661_0000018 | 3300046665 | Bacteria | 200787 |
| 382 | Ga0495661_0000101 | 3300046665 | Bacteria | 104928 |
| 383 | Ga0495661_0004052 | 3300046665 | Bacteria | 10673 |
| 384 | Ga0495661_0015996 | 3300046665 | Bacteria | 4987 |
| 385 | Ga0495588_0032710 | 3300046674 | Bacteria | 2622 |
| 386 | Ga0495588_0040469 | 3300046674 | Bacteria | 2377 |
| 387 | Ga0495588_0108909 | 3300046674 | Bacteria | 1458 |
| 388 | Ga0495623_0030482 | 3300046679 | Bacteria | 3469 |
| 389 | Ga0495669_0001097 | 3300046684 | Bacteria | 11202 |
| 390 | Ga0495613_0273456 | 3300046689 | Bacteria | 1174 |
| 391 | Ga0495670_0005615 | 3300046691 | Bacteria | 6153 |
| 392 | Ga0495670_0013939 | 3300046691 | Bacteria | 3954 |
| 393 | Ga0495670_0053980 | 3300046691 | Bacteria | 2012 |
| 394 | Ga0495671_0000295 | 3300046692 | Bacteria | 41756 |
| 395 | Ga0495671_0001060 | 3300046692 | Bacteria | 19054 |
| 396 | Ga0495671_0004032 | 3300046692 | Bacteria | 8872 |
| 397 | Ga0495671_0018255 | 3300046692 | Bacteria | 3724 |
| 398 | Ga0495671_0019721 | 3300046692 | Bacteria | 3559 |
| 399 | Ga0495671_0065191 | 3300046692 | Bacteria | 1792 |
| 400 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 401 | Ga0495649_0000909 | 3300046694 | Bacteria | 23449 |
| 402 | Ga0495649_0048419 | 3300046694 | Bacteria | 2309 |
| 403 | Ga0495649_0069656 | 3300046694 | Bacteria | 1886 |
| 404 | Ga0495649_0081914 | 3300046694 | Bacteria | 1725 |
| 405 | Ga0495589_0000141 | 3300046794 | Bacteria | 66457 |
| 406 | Ga0495589_0000422 | 3300046794 | Bacteria | 31472 |
| 407 | Ga0495589_0025067 | 3300046794 | Bacteria | 3027 |
| 408 | Ga0495589_0059160 | 3300046794 | Bacteria | 1883 |
| 409 | Ga0495660_0000638 | 3300046810 | Bacteria | 27219 |
| 410 | Ga0495660_0003263 | 3300046810 | Bacteria | 10066 |
| 411 | Ga0495660_0009554 | 3300046810 | Bacteria | 5654 |
| 412 | Ga0495660_0014526 | 3300046810 | Bacteria | 4554 |
| 413 | Ga0495660_0022659 | 3300046810 | Bacteria | 3584 |
| 414 | Ga0495660_0041165 | 3300046810 | Bacteria | 2559 |
| 415 | Ga0495660_0050079 | 3300046810 | Bacteria | 2277 |
| 416 | Ga0495660_0058798 | 3300046810 | Bacteria | 2069 |
| 417 | Ga0495660_0124783 | 3300046810 | Bacteria | 1298 |
| 418 | Ga0495581_0001774 | 3300047315 | Bacteria | 12047 |
| 419 | Ga0495581_0020492 | 3300047315 | Bacteria | 3836 |
| 420 | Ga0495581_0031915 | 3300047315 | Bacteria | 3051 |
| 421 | Ga0495604_0002087 | 3300047317 | Bacteria | 16085 |
| 422 | Ga0495672_0001978 | 3300047320 | Bacteria | 19360 |
| 423 | Ga0495672_0004789 | 3300047320 | Bacteria | 10912 |
| 424 | Ga0495672_0006656 | 3300047320 | Bacteria | 8875 |
| 425 | Ga0495672_0023786 | 3300047320 | Bacteria | 3958 |
| 426 | Ga0495672_0028056 | 3300047320 | Bacteria | 3568 |
| 427 | Ga0495672_0028983 | 3300047320 | Bacteria | 3493 |
| 428 | Ga0495672_0054995 | 3300047320 | Bacteria | 2323 |
| 429 | Ga0495672_0070543 | 3300047320 | Bacteria | 1979 |
| 430 | Ga0495672_0071995 | 3300047320 | Bacteria | 1954 |
| 431 | Ga0495676_0000020 | 3300047321 | Bacteria | 166813 |
| 432 | Ga0495676_0049626 | 3300047321 | Bacteria | 3372 |
| 433 | Ga0495680_0003983 | 3300047322 | Bacteria | 14264 |
| 434 | Ga0495683_0000063 | 3300047323 | Bacteria | 113542 |
| 435 | Ga0495683_0000765 | 3300047323 | Bacteria | 23107 |
| 436 | Ga0495683_0006189 | 3300047323 | Bacteria | 6552 |
| 437 | Ga0495683_0023975 | 3300047323 | Bacteria | 3134 |
| 438 | Ga0495683_0024980 | 3300047323 | Bacteria | 3063 |
| 439 | Ga0495683_0035032 | 3300047323 | Bacteria | 2551 |
| 440 | Ga0495683_0051312 | 3300047323 | Bacteria | 2062 |
| 441 | Ga0495687_000715 | 3300047443 | Bacteria | 36786 |
| 442 | Ga0495687_004143 | 3300047443 | Bacteria | 9986 |
| 443 | Ga0495687_008394 | 3300047443 | Bacteria | 5915 |
| 444 | Ga0495687_012721 | 3300047443 | Bacteria | 4435 |
| 445 | Ga0495687_048786 | 3300047443 | Bacteria | 1814 |
| 446 | Ga0495677_0005322 | 3300047445 | Bacteria | 4881 |
| 447 | Ga0495679_000079 | 3300047446 | Bacteria | 90806 |
| 448 | Ga0495679_000165 | 3300047446 | Bacteria | 59805 |
| 449 | Ga0495679_000711 | 3300047446 | Bacteria | 21533 |
| 450 | Ga0495679_005912 | 3300047446 | Bacteria | 5361 |
| 451 | Ga0495679_014366 | 3300047446 | Bacteria | 2937 |
| 452 | Ga0495685_047414 | 3300047447 | Bacteria | 1461 |
| 453 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 454 | Ga0495673_0000421 | 3300047469 | Bacteria | 48148 |
| 455 | Ga0495673_0000833 | 3300047469 | Bacteria | 28784 |
| 456 | Ga0495673_0002046 | 3300047469 | Bacteria | 14767 |
| 457 | Ga0495673_0005618 | 3300047469 | Bacteria | 7540 |
| 458 | Ga0495673_0007797 | 3300047469 | Bacteria | 6097 |
| 459 | Ga0495673_0026305 | 3300047469 | Bacteria | 2783 |
| 460 | Ga0495673_0028696 | 3300047469 | Bacteria | 2633 |
| 461 | Ga0495673_0034809 | 3300047469 | Bacteria | 2326 |
| 462 | Ga0495673_0072115 | 3300047469 | Bacteria | 1450 |
| 463 | Ga0495681_0000027 | 3300047470 | Bacteria | 141884 |
| 464 | Ga0495681_0000237 | 3300047470 | Bacteria | 45823 |
| 465 | Ga0495681_0004824 | 3300047470 | Bacteria | 9129 |
| 466 | Ga0495681_0004871 | 3300047470 | Bacteria | 9074 |
| 467 | Ga0495681_0016054 | 3300047470 | Bacteria | 4217 |
| 468 | Ga0495686_0049913 | 3300047472 | Bacteria | 2630 |
| 469 | Ga0495593_0034064 | 3300047673 | Bacteria | 2771 |
| 470 | Ga0495614_0067331 | 3300048089 | Bacteria | 1541 |
| 471 | Ga0495626_0000041 | 3300048091 | Bacteria | 172663 |
| 472 | Ga0495626_0000352 | 3300048091 | Bacteria | 48007 |
| 473 | Ga0495626_0005473 | 3300048091 | Bacteria | 7412 |
| 474 | Ga0495626_0011493 | 3300048091 | Bacteria | 4681 |
| 475 | Ga0495626_0015886 | 3300048091 | Bacteria | 3841 |
| 476 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 477 | Ga0496102_0015377 | 3300048905 | Bacteria | 6665 |
| 478 | Ga0496102_0028870 | 3300048905 | Bacteria | 4958 |
| 479 | Ga0496103_0010330 | 3300048906 | Bacteria | 5524 |
| 480 | Ga0496103_0033182 | 3300048906 | Bacteria | 3153 |
| 481 | Ga0496103_0148053 | 3300048906 | Bacteria | 1503 |
| 482 | Ga0496104_0173998 | 3300048907 | Bacteria | 2063 |
| 483 | Ga0496104_0197962 | 3300048907 | Bacteria | 1921 |
| 484 | Ga0496105_0069085 | 3300048908 | Bacteria | 2919 |
| 485 | Ga0496105_0087722 | 3300048908 | Bacteria | 2570 |
| 486 | Ga0496105_0127667 | 3300048908 | Bacteria | 2096 |
| 487 | Ga0496106_0057923 | 3300048909 | Bacteria | 2931 |
| 488 | Ga0496106_0113790 | 3300048909 | Bacteria | 2109 |
| 489 | Ga0496109_0085516 | 3300048912 | Bacteria | 2911 |
| 490 | Ga0496109_0457397 | 3300048912 | Bacteria | 1205 |
| 491 | Ga0496110_0028956 | 3300048913 | Bacteria | 4761 |
| 492 | Ga0496110_0273962 | 3300048913 | Bacteria | 1536 |
| 493 | Ga0496110_0332514 | 3300048913 | Bacteria | 1384 |
| 494 | Ga0496110_0395721 | 3300048913 | Bacteria | 1259 |
| 495 | Ga0496111_0173469 | 3300048914 | Bacteria | 1602 |
| 496 | Ga0496114_0141449 | 3300048917 | Bacteria | 2083 |
| 497 | Ga0496115_0095672 | 3300048918 | Bacteria | 2431 |
| 498 | Ga0496115_0382929 | 3300048918 | Bacteria | 1144 |
| 499 | Ga0496116_0000984 | 3300048919 | Bacteria | 34981 |
| 500 | Ga0496116_0034820 | 3300048919 | Bacteria | 3545 |
| 501 | Ga0496116_0137549 | 3300048919 | Bacteria | 1380 |
| 502 | Ga0496117_0032512 | 3300048920 | Bacteria | 3962 |
| 503 | Ga0496117_0036374 | 3300048920 | Bacteria | 3684 |
| 504 | Ga0496117_0067105 | 3300048920 | Bacteria | 2429 |
| 505 | Ga0496118_0024337 | 3300048921 | Bacteria | 5228 |
| 506 | Ga0496118_0038172 | 3300048921 | Bacteria | 3853 |
| 507 | Ga0496118_0066079 | 3300048921 | Bacteria | 2641 |
| 508 | Ga0496118_0098853 | 3300048921 | Bacteria | 1980 |
| 509 | Ga0496119_0012321 | 3300048922 | Bacteria | 6959 |
| 510 | Ga0496121_0004753 | 3300048924 | Bacteria | 17930 |
| 511 | Ga0496121_0007545 | 3300048924 | Bacteria | 13107 |
| 512 | Ga0496122_0025572 | 3300048925 | Bacteria | 5122 |
| 513 | Ga0496122_0185679 | 3300048925 | Bacteria | 1233 |
| 514 | Ga0496123_0038678 | 3300048926 | Bacteria | 3349 |
| 515 | Ga0496123_0060944 | 3300048926 | Bacteria | 2429 |
| 516 | Ga0496124_0000280 | 3300048927 | Bacteria | 97221 |
| 517 | Ga0496124_0003909 | 3300048927 | Bacteria | 17810 |
| 518 | Ga0496124_0098283 | 3300048927 | Bacteria | 2376 |
| 519 | Ga0496124_0100235 | 3300048927 | Bacteria | 2348 |
| 520 | Ga0496124_0129309 | 3300048927 | Bacteria | 2008 |
| 521 | Ga0496125_0048546 | 3300048928 | Bacteria | 3538 |
| 522 | Ga0496126_0057901 | 3300048929 | Bacteria | 3495 |
| 523 | Ga0496126_0060509 | 3300048929 | Bacteria | 3405 |
| 524 | Ga0495678_000036 | 3300049459 | Bacteria | 198018 |
| 525 | Ga0495678_000724 | 3300049459 | Bacteria | 29966 |
| 526 | Ga0495678_001110 | 3300049459 | Bacteria | 22429 |
| 527 | Ga0495678_002190 | 3300049459 | Bacteria | 13698 |
| 528 | Ga0495678_007868 | 3300049459 | Bacteria | 5475 |
| 529 | Ga0495678_011307 | 3300049459 | Bacteria | 4278 |
| 530 | Ga0495678_046306 | 3300049459 | Bacteria | 1710 |
| 531 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 532 | Ga0495682_0000065 | 3300049460 | Bacteria | 98530 |
| 533 | Ga0495682_0001677 | 3300049460 | Bacteria | 11299 |
| 534 | Ga0495682_0009847 | 3300049460 | Bacteria | 3719 |
| 535 | Ga0495682_0024863 | 3300049460 | Bacteria | 2230 |
| 536 | Ga0495682_0038743 | 3300049460 | Bacteria | 1751 |
| 537 | Ga0501032_0023484 | 3300049569 | Bacteria | 4259 |
| 538 | Ga0501034_0000480 | 3300049571 | Bacteria | 65697 |
| 539 | Ga0501037_0080952 | 3300049573 | Bacteria | 2355 |
| 540 | Ga0501222_006611 | 3300049662 | Bacteria | 1556 |
| 541 | nmdc:mga00v17_65991_c1 | 3300050491 | Bacteria | 2234 |
| 542 | Ga0500618_008253 | 3300053125 | Bacteria | 2921 |
| 543 | Ga0500618_008300 | 3300053125 | Bacteria | 2906 |
| 544 | Ga0500573_0117685 | 3300053140 | Bacteria | 1482 |
| 545 | Ga0500616_0001659 | 3300053153 | Bacteria | 20584 |
| 546 | Ga0500634_0047057 | 3300053161 | Bacteria | 2329 |
| 547 | Ga0530510_0180133 | 3300061734 | Bacteria | 1567 |
| 548 | 2511258480 | 2511231004 | Bacteria | 6669789 |
| 549 | 2511272544 | 2511231007 | Bacteria | 6306603 |
| 550 | 2511290774 | 2511231010 | Bacteria | 6373152 |
| 551 | 2511313849 | 2511231014 | Bacteria | 6462302 |
| 552 | 2511327777 | 2511231016 | Bacteria | 6704427 |
| 553 | 2511343834 | 2511231019 | Bacteria | 6520662 |
| 554 | 2511358632 | 2511231021 | Bacteria | 7302637 |
| 555 | 2599502203 | 2599185188 | Bacteria | 6164180 |
| 556 | 2599616068 | 2599185212 | Bacteria | 6765997 |
| 557 | 2599772657 | 2599185248 | Bacteria | 6696816 |
| 558 | 2599881043 | 2599185288 | Bacteria | 6666191 |
| 559 | 2599885067 | 2599185289 | Bacteria | 6778765 |
| 560 | 2599899792 | 2599185291 | Bacteria | 6775623 |
| 561 | 2599932737 | 2599185300 | Bacteria | 6062622 |
| 562 | 2599945253 | 2599185302 | Bacteria | 5954930 |
| 563 | 2599949675 | 2599185303 | Bacteria | 6512725 |
| 564 | 2599955395 | 2599185304 | Bacteria | 5951361 |
| 565 | 2599960883 | 2599185305 | Bacteria | 6748700 |
| 566 | 2599965488 | 2599185306 | Bacteria | 6637356 |
| 567 | 2599973749 | 2599185307 | Bacteria | 6194719 |
| 568 | 2599976603 | 2599185308 | Bacteria | 6621546 |
| 569 | 2599984428 | 2599185309 | Bacteria | 5969593 |
| 570 | 2599990401 | 2599185310 | Bacteria | 6014457 |
| 571 | 2599992828 | 2599185311 | Bacteria | 6354990 |
| 572 | 2600001657 | 2599185312 | Bacteria | 5912071 |
| 573 | 2600008911 | 2599185313 | Bacteria | 6658188 |
| 574 | 2600010652 | 2599185314 | Bacteria | 6621749 |
| 575 | 2600018377 | 2599185315 | Bacteria | 6771107 |
| 576 | 2600023307 | 2599185316 | Bacteria | 6320029 |
| 577 | 2600028220 | 2599185317 | Bacteria | 6435722 |
| 578 | 2600034157 | 2599185318 | Bacteria | 6961590 |
| 579 | 2600040330 | 2599185319 | Bacteria | 6637840 |
| 580 | 2600049237 | 2599185320 | Bacteria | 5963263 |
| 581 | 2600052897 | 2599185321 | Bacteria | 6764560 |
| 582 | 2600056978 | 2599185322 | Bacteria | 6763055 |
| 583 | 2600066805 | 2599185323 | Bacteria | 6688755 |
| 584 | 2600074057 | 2599185324 | Bacteria | 6590677 |
| 585 | 2600077536 | 2599185325 | Bacteria | 6324919 |
| 586 | 2600357331 | 2600254930 | Bacteria | 6431253 |
| 587 | 2601690403 | 2600255296 | Bacteria | 5784754 |
| 588 | 2624491490 | 2623620446 | Bacteria | 6500345 |
| 589 | 2644190363 | 2643221633 | Bacteria | 6733554 |
| 590 | 2644284919 | 2643221650 | Bacteria | 7029547 |
| 591 | 2652547172 | 2651869719 | Bacteria | 6047974 |
| 592 | 2671094655 | 2667528170 | Bacteria | 6786960 |
| 593 | 2671124823 | 2667528176 | Bacteria | 6724917 |
| 594 | 2678263883 | 2675903515 | Bacteria | 6580491 |
| 595 | 2738690745 | 2738541271 | Bacteria | 5657310 |
| 596 | 2738810538 | 2738541294 | Bacteria | 6925949 |
| 597 | 2738897898 | 2738541309 | Bacteria | 6926455 |
| 598 | 2739257985 | 2738543015 | Bacteria | 6750701 |
| 599 | 2739266519 | 2738543016 | Bacteria | 5657564 |
| 600 | 2745004336 | 2744054620 | Bacteria | 6551379 |
| 601 | 2774123124 | 2773857670 | Bacteria | 6407454 |
| 602 | 2775657010 | 2775506735 | Bacteria | 4556596 |
| 603 | 2784315470 | 2784132072 | Bacteria | 6596533 |
| 604 | 2794594728 | 2791355520 | Bacteria | 5948615 |
| 605 | 2808829251 | 2808606357 | Bacteria | 4466944 |
| 606 | 2808854894 | 2808606361 | Bacteria | 6136259 |
| 607 | 2808898445 | 2808606371 | Bacteria | 4251511 |
| 608 | 2808926324 | 2808606376 | Bacteria | 6248667 |
| 609 | 2808932737 | 2808606377 | Bacteria | 6646337 |
| 610 | 2808934911 | 2808606378 | Bacteria | 6177535 |
| 611 | 2808948425 | 2808606380 | Bacteria | 6248705 |
| 612 | 2808954873 | 2808606381 | Bacteria | 6646461 |
| 613 | 2808963308 | 2808606383 | Bacteria | 6138645 |
| 614 | 2808978541 | 2808606385 | Bacteria | 6711065 |
| 615 | 2808993932 | 2808606388 | Bacteria | 6706662 |
| 616 | 2808998287 | 2808606389 | Bacteria | 6138126 |
| 617 | 2812319003 | 2811994871 | Bacteria | 4497550 |
| 618 | 2825657330 | 2825651385 | Bacteria | 6715909 |
| 619 | 2842858383 | 2842854478 | Bacteria | 6143501 |
| 620 | 2852617429 | 2852612431 | Bacteria | 6885235 |
| 621 | 2852672452 | 2852667396 | Bacteria | 6885555 |
| 622 | 2857744457 | 2857740372 | Bacteria | 4782044 |
| 623 | 2860342509 | 2860339153 | Bacteria | 6846989 |
| 624 | 2904497668 | 2904497146 | Bacteria | 4731781 |
| 625 | 2904780690 | 2904776348 | Bacteria | 4658726 |
| 626 | 2910812221 | 2910809715 | Bacteria | 4982797 |
| 627 | 2913039291 | 2913036834 | Bacteria | 6704877 |
| 628 | 2919038686 | 2919034639 | Bacteria | 4763403 |
| 629 | 2919062494 | 2919059106 | Bacteria | 4991624 |
| 630 | 2919456639 | 2919456309 | Bacteria | 6586567 |
| 631 | 2919485291 | 2919481497 | Bacteria | 6907839 |
| 632 | 2919539682 | 2919538618 | Bacteria | 4677069 |
| 633 | 2919700951 | 2919697872 | Bacteria | 6553725 |
| 634 | 2923586582 | 2923586266 | Bacteria | 6565975 |
| 635 | 2929147882 | 2929144301 | Bacteria | 6622272 |
| 636 | 2931369746 | 2931369376 | Bacteria | 6847892 |
| 637 | 2931402593 | 2931396565 | Bacteria | 7251677 |
| 638 | 2933422093 | 2933418574 | Bacteria | 4476724 |
| 639 | 2939647410 | 2939647034 | Bacteria | 4681660 |
| 640 | 2945933875 | 2945928738 | Bacteria | 6053221 |
| 641 | 2945956447 | 2945956166 | Bacteria | 5110334 |
| 642 | 2946041218 | 2946037020 | Bacteria | 4900426 |
| 643 | 2946060525 | 2946059875 | Bacteria | 4386623 |
| 644 | 2953998342 | 2953998280 | Bacteria | 4812144 |
| 645 | 2988729464 | 2988728565 | Bacteria | 6124362 |
| 646 | 3007869744 | 3007866637 | Bacteria | 5899198 |
| 647 | 8019778383 | 8019775933 | Bacteria | 6858656 |
| 648 | 8054505803 | 8054503363 | Bacteria | 6101651 |
| 649 | 8056145536 | 8056143049 | Bacteria | 6307666 |
| 650 | 8056156913 | 8056155041 | Bacteria | 6486948 |
| 651 | 8056166484 | 8056161164 | Bacteria | 6106669 |
| 652 | Ga0065714_10000548 | |||
| 653 | MRS2a_Contig_11 | |||
| 654 | SwRhRL2b_contig_1122291 | |||
| 655 | JGI25162J39368_1000060 | |||
| 656 | JGI25163J39215_1000792 | |||
| 657 | JGI25164J39214_1000037 | |||
| 658 | JGI25165J46597_1000118 | |||
| 659 | Ga0055538_1000158 | |||
| 660 | Ga0055539_1000208 | |||
| 661 | Ga0055533_1000209 | |||
| 662 | Ga0055532_1000214 | |||
| 663 | Ga0055525_1000287 | |||
| 664 | Ga0055536_1000046 | |||
| 665 | Ga0055530_10000133 | |||
| 666 | Ga0055530_10000373 | |||
| 667 | Ga0055540_1000070 | |||
| 668 | Ga0055540_1000168 | |||
| 669 | Ga0055541_1000067 | |||
| 670 | Ga0065714_10014210 | |||
| 671 | Ga0065714_10064673 | |||
| 672 | Ga0065714_10138475 | |||
| 673 | Ga0065704_10002589 | |||
| 674 | Ga0070670_100101802 | |||
| 675 | Ga0070677_10002370 | |||
| 676 | Ga0070666_10056923 | |||
| 677 | Ga0070668_100232101 | |||
| 678 | Ga0070669_100043365 | |||
| 679 | Ga0070675_100009872 | |||
| 680 | Ga0070667_100011368 | |||
| 681 | Ga0070678_100230010 | |||
| 682 | Ga0070662_100094493 | |||
| 683 | Ga0070698_100184684 | |||
| 684 | Ga0070664_100002081 | |||
| 685 | Ga0075364_10120357 | |||
| 686 | Ga0079104_1000823 | |||
| 687 | Ga0099826_10006487 | |||
| 688 | Ga0105251_10003948 | |||
| 689 | Ga0105251_10027263 | |||
| 690 | Ga0105251_10064332 | |||
| 691 | Ga0105244_10002493 | |||
| 692 | Ga0105244_10004498 | |||
| 693 | Ga0105244_10010865 | |||
| 694 | Ga0105244_10088853 | |||
| 695 | Ga0105250_10001079 | |||
| 696 | Ga0105250_10020997 | |||
| 697 | Ga0105245_10029428 | |||
| 698 | Ga0105245_10129308 | |||
| 699 | Ga0105243_10000045 | |||
| 700 | Ga0105242_10058672 | |||
| 701 | Ga0105246_10006450 | |||
| 702 | Ga0105246_10042493 | |||
| 703 | Ga0105246_10160175 | |||
| 704 | Ga0157373_10000819 | |||
| 705 | Ga0157371_10012245 | |||
| 706 | Ga0157370_10166047 | |||
| 707 | Ga0163162_10233883 | |||
| 708 | Ga0163162_10348567 | |||
| 709 | Ga0157375_10356087 | |||
| 710 | Ga0182008_10024943 | |||
| 711 | Ga0182008_10035139 | |||
| 712 | Ga0182006_1004220 | |||
| 713 | Ga0182006_1008963 | |||
| 714 | Ga0182006_1040659 | |||
| 715 | Ga0182007_10000177 | |||
| 716 | Ga0182007_10021277 | |||
| 717 | Ga0182005_1003224 | |||
| 718 | Ga0182005_1008785 | |||
| 719 | Ga0163161_10075624 | |||
| 720 | Ga0163161_10279784 | |||
| 721 | Ga0213874_10054497 | |||
| 722 | Ga0213876_10014059 | |||
| 723 | Ga0213875_10095134 | |||
| 724 | Ga0209435_101168 | |||
| 725 | Ga0209760_100023 | |||
| 726 | Ga0209784_100058 | |||
| 727 | Ga0209566_100045 | |||
| 728 | Ga0209674_100096 | |||
| 729 | Ga0209147_100056 | |||
| 730 | Ga0209563_100064 | |||
| 731 | Ga0207427_100018 | |||
| 732 | Ga0209437_100031 | |||
| 733 | Ga0209258_100446 | |||
| 734 | Ga0209646_1000147 | |||
| 735 | Ga0209677_100053 | |||
| 736 | Ga0209233_1000012 | |||
| 737 | Ga0209676_1000055 | |||
| 738 | Ga0209676_1001524 | |||
| 739 | Ga0209050_1000043 | |||
| 740 | Ga0209050_1000231 | |||
| 741 | Ga0209051_1000030 | |||
| 742 | Ga0209051_1000165 | |||
| 743 | Ga0209051_1003240 | |||
| 744 | Ga0209257_1000767 | |||
| 745 | Ga0209257_1007776 | |||
| 746 | Ga0207697_10008336 | |||
| 747 | Ga0207696_1000041 | |||
| 748 | Ga0207696_1000628 | |||
| 749 | Ga0207655_1000085 | |||
| 750 | Ga0207655_1000141 | |||
| 751 | Ga0207655_1019266 | |||
| 752 | Ga0207655_1030383 | |||
| 753 | Ga0207655_1033394 | |||
| 754 | Ga0207713_1001279 | |||
| 755 | Ga0207713_1029754 | |||
| 756 | Ga0207682_10002517 | |||
| 757 | Ga0207680_10042627 | |||
| 758 | Ga0207645_10004346 | |||
| 759 | Ga0207681_10007454 | |||
| 760 | Ga0207650_10102897 | |||
| 761 | Ga0207706_10031488 | |||
| 762 | Ga0207686_10126289 | |||
| 763 | Ga0207709_10000011 | |||
| 764 | Ga0207709_10207178 | |||
| 765 | Ga0207691_10002435 | |||
| 766 | Ga0207679_10031184 | |||
| 767 | Ga0207651_10263124 | |||
| 768 | Ga0207683_10009799 | |||
| 769 | Ga0209281_1000009 | |||
| 770 | Ga0207428_10001057 | |||
| 771 | Ga0207428_10078079 | |||
| 772 | Ga0207428_10089847 | |||
| 773 | Ga0316181_1147544 | |||
| 774 | Ga0265340_10000078 | |||
| 775 | Ga0307513_10000671 | |||
| 776 | Ga0307408_100000480 | |||
| 777 | Ga0307408_100003833 | |||
| 778 | Ga0307408_100009042 | |||
| 779 | Ga0307408_100023893 | |||
| 780 | Ga0307408_100032366 | |||
| 781 | Ga0307408_100088722 | |||
| 782 | Ga0307408_100140620 | |||
| 783 | Ga0307408_100163890 | |||
| 784 | Ga0307408_100186627 | |||
| 785 | Ga0307408_100196543 | |||
| 786 | Ga0307408_100198859 | |||
| 787 | Ga0307405_10002090 | |||
| 788 | Ga0307405_10003259 | |||
| 789 | Ga0307405_10058184 | |||
| 790 | Ga0307405_10069907 | |||
| 791 | Ga0307413_10016367 | |||
| 792 | Ga0307413_10022403 | |||
| 793 | Ga0307413_10033700 | |||
| 794 | Ga0307413_10061829 | |||
| 795 | Ga0307413_10292412 | |||
| 796 | Ga0307410_10045466 | |||
| 797 | Ga0307410_10094229 | |||
| 798 | Ga0307410_10231487 | |||
| 799 | Ga0307406_10049754 | |||
| 800 | Ga0307406_10061025 | |||
| 801 | Ga0307406_10096580 | |||
| 802 | Ga0307406_10097583 | |||
| 803 | Ga0307407_10012207 | |||
| 804 | Ga0307407_10031947 | |||
| 805 | Ga0307407_10032742 | |||
| 806 | Ga0307407_10089561 | |||
| 807 | Ga0307407_10142664 | |||
| 808 | Ga0307412_10000254 | |||
| 809 | Ga0307412_10001950 | |||
| 810 | Ga0307412_10014413 | |||
| 811 | Ga0307412_10030830 | |||
| 812 | Ga0307412_10031452 | |||
| 813 | Ga0307412_10033748 | |||
| 814 | Ga0307412_10075179 | |||
| 815 | Ga0307412_10189035 | |||
| 816 | Ga0307409_100041255 | |||
| 817 | Ga0307409_100056642 | |||
| 818 | Ga0307409_100103847 | |||
| 819 | Ga0307416_100035724 | |||
| 820 | Ga0307416_100058272 | |||
| 821 | Ga0307416_100172350 | |||
| 822 | Ga0307416_100351194 | |||
| 823 | Ga0307416_100403265 | |||
| 824 | Ga0307416_100512785 | |||
| 825 | Ga0307414_10036060 | |||
| 826 | Ga0307414_10069042 | |||
| 827 | Ga0307414_10349286 | |||
| 828 | Ga0307411_10026491 | |||
| 829 | Ga0307411_10028873 | |||
| 830 | Ga0307411_10125050 | |||
| 831 | Ga0307415_100107380 | |||
| 832 | Ga0307415_100421685 | |||
| 833 | Ga0373956_0000852 | |||
| 834 | Ga0395899_0020869 | |||
| 835 | Ga0395900_0144017 | |||
| 836 | Ga0395898_0064475 | |||
| 837 | Ga0436364_0277731 | |||
| 838 | Ga0436364_0510689 | |||
| 839 | Ga0395901_0031846 | |||
| 840 | Ga0395901_0041041 | |||
| 841 | Ga0395901_0086408 | |||
| 842 | Ga0436365_0623832 | |||
| 843 | Ga0436365_1685261 | |||
| 844 | Ga0436360_0229073 | |||
| 845 | Ga0439438_005931 | |||
| 846 | Ga0439438_010402 | |||
| 847 | Ga0439438_012718 | |||
| 848 | Ga0439438_014038 | |||
| 849 | Ga0439447_008800 | |||
| 850 | Ga0439447_010615 | |||
| 851 | Ga0439447_019574 | |||
| 852 | Ga0439466_0040439 | |||
| 853 | Ga0439433_0022638 | |||
| 854 | Ga0439442_000424 | |||
| 855 | Ga0439445_0042466 | |||
| 856 | Ga0439432_025694 | |||
| 857 | Ga0439451_002893 | |||
| 858 | Ga0439451_005181 | |||
| 859 | Ga0439451_014668 | |||
| 860 | Ga0439452_025118 | |||
| 861 | Ga0439452_025541 | |||
| 862 | Ga0439456_006139 | |||
| 863 | Ga0439456_008694 | |||
| 864 | Ga0439456_009932 | |||
| 865 | Ga0439463_000317 | |||
| 866 | Ga0439463_022499 | |||
| 867 | Ga0450911_002130 | |||
| 868 | Ga0450919_002357 | |||
| 869 | Ga0450919_004630 | |||
| 870 | Ga0450920_000141 | |||
| 871 | Ga0450902_013843 | |||
| 872 | Ga0450903_005504 | |||
| 873 | Ga0450906_003237 | |||
| 874 | Ga0450907_000010 | |||
| 875 | Ga0450907_000256 | |||
| 876 | Ga0450907_002430 | |||
| 877 | Ga0450907_011097 | |||
| 878 | Ga0450910_003445 | |||
| 879 | Ga0439446_0002445 | |||
| 880 | Ga0450909_001023 | |||
| 881 | Ga0450909_006155 | |||
| 882 | Ga0439434_0000301 | |||
| 883 | Ga0439434_0000947 | |||
| 884 | Ga0439434_0023749 | |||
| 885 | Ga0439464_0008430 | |||
| 886 | Ga0439460_0005166 | |||
| 887 | Ga0439460_0020839 | |||
| 888 | Ga0450918_002140 | |||
| 889 | Ga0450918_003225 | |||
| 890 | Ga0439440_0005108 | |||
| 891 | Ga0495617_000054 | |||
| 892 | Ga0495617_000144 | |||
| 893 | Ga0495617_008090 | |||
| 894 | Ga0495617_012000 | |||
| 895 | Ga0495617_021113 | |||
| 896 | Ga0495617_054518 | |||
| 897 | Ga0495627_000195 | |||
| 898 | Ga0495627_000308 | |||
| 899 | Ga0495590_0001206 | |||
| 900 | Ga0495590_0004191 | |||
| 901 | Ga0495590_0022988 | |||
| 902 | Ga0495590_0040867 | |||
| 903 | Ga0495591_000184 | |||
| 904 | Ga0495591_000315 | |||
| 905 | Ga0495591_008305 | |||
| 906 | Ga0495629_0144367 | |||
| 907 | Ga0495638_0054510 | |||
| 908 | Ga0495638_0100229 | |||
| 909 | Ga0495653_0037631 | |||
| 910 | Ga0495650_0000881 | |||
| 911 | Ga0495650_0005496 | |||
| 912 | Ga0495650_0006867 | |||
| 913 | Ga0495650_0011574 | |||
| 914 | Ga0495650_0018023 | |||
| 915 | Ga0495580_0018269 | |||
| 916 | Ga0495605_0000045 | |||
| 917 | Ga0495605_0000191 | |||
| 918 | Ga0495605_0000563 | |||
| 919 | Ga0495605_0000794 | |||
| 920 | Ga0495605_0001618 | |||
| 921 | Ga0495605_0003671 | |||
| 922 | Ga0495605_0010840 | |||
| 923 | Ga0495605_0039013 | |||
| 924 | Ga0495605_0045075 | |||
| 925 | Ga0495605_0074486 | |||
| 926 | Ga0495639_0000032 | |||
| 927 | Ga0495584_0000409 | |||
| 928 | Ga0495584_0000547 | |||
| 929 | Ga0495584_0001764 | |||
| 930 | Ga0495584_0004919 | |||
| 931 | Ga0495585_0014976 | |||
| 932 | Ga0495585_0029734 | |||
| 933 | Ga0495594_0005294 | |||
| 934 | Ga0495594_0014081 | |||
| 935 | Ga0495596_0045500 | |||
| 936 | Ga0495607_0000058 | |||
| 937 | Ga0495607_0000172 | |||
| 938 | Ga0495607_0000179 | |||
| 939 | Ga0495607_0000185 | |||
| 940 | Ga0495607_0000290 | |||
| 941 | Ga0495607_0000617 | |||
| 942 | Ga0495607_0006225 | |||
| 943 | Ga0495607_0015398 | |||
| 944 | Ga0495607_0018916 | |||
| 945 | Ga0495607_0026196 | |||
| 946 | Ga0495607_0036726 | |||
| 947 | Ga0495607_0037319 | |||
| 948 | Ga0495607_0043695 | |||
| 949 | Ga0495607_0124378 | |||
| 950 | Ga0495583_0000101 | |||
| 951 | Ga0495583_0000483 | |||
| 952 | Ga0495583_0010856 | |||
| 953 | Ga0495583_0018184 | |||
| 954 | Ga0495583_0030833 | |||
| 955 | Ga0495583_0034050 | |||
| 956 | Ga0495606_0023383 | |||
| 957 | Ga0495610_0016642 | |||
| 958 | Ga0495610_0080746 | |||
| 959 | Ga0495616_0000226 | |||
| 960 | Ga0495616_0000661 | |||
| 961 | Ga0495620_0000001 | |||
| 962 | Ga0495620_0000166 | |||
| 963 | Ga0495620_0004341 | |||
| 964 | Ga0495620_0021166 | |||
| 965 | Ga0495628_0214004 | |||
| 966 | Ga0495631_0004644 | |||
| 967 | Ga0495632_0000754 | |||
| 968 | Ga0495632_0001740 | |||
| 969 | Ga0495632_0005660 | |||
| 970 | Ga0495632_0012766 | |||
| 971 | Ga0495632_0075121 | |||
| 972 | Ga0495637_0000037 | |||
| 973 | Ga0495637_0001374 | |||
| 974 | Ga0495637_0005663 | |||
| 975 | Ga0495637_0007143 | |||
| 976 | Ga0495637_0007481 | |||
| 977 | Ga0495637_0022921 | |||
| 978 | Ga0495637_0035457 | |||
| 979 | Ga0495637_0089276 | |||
| 980 | Ga0495637_0100027 | |||
| 981 | Ga0495643_0054830 | |||
| 982 | Ga0495643_0063085 | |||
| 983 | Ga0495644_0001264 | |||
| 984 | Ga0495644_0039961 | |||
| 985 | Ga0495648_0000377 | |||
| 986 | Ga0495648_0001506 | |||
| 987 | Ga0495648_0003808 | |||
| 988 | Ga0495648_0035448 | |||
| 989 | Ga0495648_0044645 | |||
| 990 | Ga0495666_0025173 | |||
| 991 | Ga0495642_0000316 | |||
| 992 | Ga0495642_0004676 | |||
| 993 | Ga0495654_0000211 | |||
| 994 | Ga0495654_0000288 | |||
| 995 | Ga0495654_0000306 | |||
| 996 | Ga0495654_0034876 | |||
| 997 | Ga0495654_0045858 | |||
| 998 | Ga0495654_0106925 | |||
| 999 | Ga0495587_0004867 | |||
| 1000 | Ga0495609_0000012 | |||
| 1001 | Ga0495609_0000075 | |||
| 1002 | Ga0495609_0001135 | |||
| 1003 | Ga0495609_0007500 | |||
| 1004 | Ga0495609_0008213 | |||
| 1005 | Ga0495609_0021359 | |||
| 1006 | Ga0495609_0083086 | |||
| 1007 | Ga0495597_0000037 | |||
| 1008 | Ga0495597_0002922 | |||
| 1009 | Ga0495597_0012793 | |||
| 1010 | Ga0495597_0081160 | |||
| 1011 | Ga0495597_0085407 | |||
| 1012 | Ga0495645_0043191 | |||
| 1013 | Ga0495622_0000590 | |||
| 1014 | Ga0495622_0007970 | |||
| 1015 | Ga0495622_0011228 | |||
| 1016 | Ga0495633_0000016 | |||
| 1017 | Ga0495633_0027993 | |||
| 1018 | Ga0495668_0045796 | |||
| 1019 | Ga0495668_0066283 | |||
| 1020 | Ga0495634_0000025 | |||
| 1021 | Ga0495611_0002012 | |||
| 1022 | Ga0495611_0010268 | |||
| 1023 | Ga0495611_0013449 | |||
| 1024 | Ga0495625_0000089 | |||
| 1025 | Ga0495625_0000847 | |||
| 1026 | Ga0495625_0041066 | |||
| 1027 | Ga0495625_0067950 | |||
| 1028 | Ga0495625_0221259 | |||
| 1029 | Ga0495635_0034169 | |||
| 1030 | Ga0495659_0003525 | |||
| 1031 | Ga0495661_0000004 | |||
| 1032 | Ga0495661_0000018 | |||
| 1033 | Ga0495661_0000101 | |||
| 1034 | Ga0495661_0004052 | |||
| 1035 | Ga0495661_0015996 | |||
| 1036 | Ga0495588_0032710 | |||
| 1037 | Ga0495588_0040469 | |||
| 1038 | Ga0495588_0108909 | |||
| 1039 | Ga0495623_0030482 | |||
| 1040 | Ga0495669_0001097 | |||
| 1041 | Ga0495613_0273456 | |||
| 1042 | Ga0495670_0005615 | |||
| 1043 | Ga0495670_0013939 | |||
| 1044 | Ga0495670_0053980 | |||
| 1045 | Ga0495671_0000295 | |||
| 1046 | Ga0495671_0001060 | |||
| 1047 | Ga0495671_0004032 | |||
| 1048 | Ga0495671_0018255 | |||
| 1049 | Ga0495671_0019721 | |||
| 1050 | Ga0495671_0065191 | |||
| 1051 | Ga0495649_0000013 | |||
| 1052 | Ga0495649_0000909 | |||
| 1053 | Ga0495649_0048419 | |||
| 1054 | Ga0495649_0069656 | |||
| 1055 | Ga0495649_0081914 | |||
| 1056 | Ga0495589_0000141 | |||
| 1057 | Ga0495589_0000422 | |||
| 1058 | Ga0495589_0025067 | |||
| 1059 | Ga0495589_0059160 | |||
| 1060 | Ga0495660_0000638 | |||
| 1061 | Ga0495660_0003263 | |||
| 1062 | Ga0495660_0009554 | |||
| 1063 | Ga0495660_0014526 | |||
| 1064 | Ga0495660_0022659 | |||
| 1065 | Ga0495660_0041165 | |||
| 1066 | Ga0495660_0050079 | |||
| 1067 | Ga0495660_0058798 | |||
| 1068 | Ga0495660_0124783 | |||
| 1069 | Ga0495581_0001774 | |||
| 1070 | Ga0495581_0020492 | |||
| 1071 | Ga0495581_0031915 | |||
| 1072 | Ga0495604_0002087 | |||
| 1073 | Ga0495672_0001978 | |||
| 1074 | Ga0495672_0004789 | |||
| 1075 | Ga0495672_0006656 | |||
| 1076 | Ga0495672_0023786 | |||
| 1077 | Ga0495672_0028056 | |||
| 1078 | Ga0495672_0028983 | |||
| 1079 | Ga0495672_0054995 | |||
| 1080 | Ga0495672_0070543 | |||
| 1081 | Ga0495672_0071995 | |||
| 1082 | Ga0495676_0000020 | |||
| 1083 | Ga0495676_0049626 | |||
| 1084 | Ga0495680_0003983 | |||
| 1085 | Ga0495683_0000063 | |||
| 1086 | Ga0495683_0000765 | |||
| 1087 | Ga0495683_0006189 | |||
| 1088 | Ga0495683_0023975 | |||
| 1089 | Ga0495683_0024980 | |||
| 1090 | Ga0495683_0035032 | |||
| 1091 | Ga0495683_0051312 | |||
| 1092 | Ga0495687_000715 | |||
| 1093 | Ga0495687_004143 | |||
| 1094 | Ga0495687_008394 | |||
| 1095 | Ga0495687_012721 | |||
| 1096 | Ga0495687_048786 | |||
| 1097 | Ga0495677_0005322 | |||
| 1098 | Ga0495679_000079 | |||
| 1099 | Ga0495679_000165 | |||
| 1100 | Ga0495679_000711 | |||
| 1101 | Ga0495679_005912 | |||
| 1102 | Ga0495679_014366 | |||
| 1103 | Ga0495685_047414 | |||
| 1104 | Ga0495673_0000190 | |||
| 1105 | Ga0495673_0000421 | |||
| 1106 | Ga0495673_0000833 | |||
| 1107 | Ga0495673_0002046 | |||
| 1108 | Ga0495673_0005618 | |||
| 1109 | Ga0495673_0007797 | |||
| 1110 | Ga0495673_0026305 | |||
| 1111 | Ga0495673_0028696 | |||
| 1112 | Ga0495673_0034809 | |||
| 1113 | Ga0495673_0072115 | |||
| 1114 | Ga0495681_0000027 | |||
| 1115 | Ga0495681_0000237 | |||
| 1116 | Ga0495681_0004824 | |||
| 1117 | Ga0495681_0004871 | |||
| 1118 | Ga0495681_0016054 | |||
| 1119 | Ga0495686_0049913 | |||
| 1120 | Ga0495593_0034064 | |||
| 1121 | Ga0495614_0067331 | |||
| 1122 | Ga0495626_0000041 | |||
| 1123 | Ga0495626_0000352 | |||
| 1124 | Ga0495626_0005473 | |||
| 1125 | Ga0495626_0011493 | |||
| 1126 | Ga0495626_0015886 | |||
| 1127 | Ga0496102_0000038 | |||
| 1128 | Ga0496102_0015377 | |||
| 1129 | Ga0496102_0028870 | |||
| 1130 | Ga0496103_0010330 | |||
| 1131 | Ga0496103_0033182 | |||
| 1132 | Ga0496103_0148053 | |||
| 1133 | Ga0496104_0173998 | |||
| 1134 | Ga0496104_0197962 | |||
| 1135 | Ga0496105_0069085 | |||
| 1136 | Ga0496105_0087722 | |||
| 1137 | Ga0496105_0127667 | |||
| 1138 | Ga0496106_0057923 | |||
| 1139 | Ga0496106_0113790 | |||
| 1140 | Ga0496109_0085516 | |||
| 1141 | Ga0496109_0457397 | |||
| 1142 | Ga0496110_0028956 | |||
| 1143 | Ga0496110_0273962 | |||
| 1144 | Ga0496110_0332514 | |||
| 1145 | Ga0496110_0395721 | |||
| 1146 | Ga0496111_0173469 | |||
| 1147 | Ga0496114_0141449 | |||
| 1148 | Ga0496115_0095672 | |||
| 1149 | Ga0496115_0382929 | |||
| 1150 | Ga0496116_0000984 | |||
| 1151 | Ga0496116_0034820 | |||
| 1152 | Ga0496116_0137549 | |||
| 1153 | Ga0496117_0032512 | |||
| 1154 | Ga0496117_0036374 | |||
| 1155 | Ga0496117_0067105 | |||
| 1156 | Ga0496118_0024337 | |||
| 1157 | Ga0496118_0038172 | |||
| 1158 | Ga0496118_0066079 | |||
| 1159 | Ga0496118_0098853 | |||
| 1160 | Ga0496119_0012321 | |||
| 1161 | Ga0496121_0004753 | |||
| 1162 | Ga0496121_0007545 | |||
| 1163 | Ga0496122_0025572 | |||
| 1164 | Ga0496122_0185679 | |||
| 1165 | Ga0496123_0038678 | |||
| 1166 | Ga0496123_0060944 | |||
| 1167 | Ga0496124_0000280 | |||
| 1168 | Ga0496124_0003909 | |||
| 1169 | Ga0496124_0098283 | |||
| 1170 | Ga0496124_0100235 | |||
| 1171 | Ga0496124_0129309 | |||
| 1172 | Ga0496125_0048546 | |||
| 1173 | Ga0496126_0057901 | |||
| 1174 | Ga0496126_0060509 | |||
| 1175 | Ga0495678_000036 | |||
| 1176 | Ga0495678_000724 | |||
| 1177 | Ga0495678_001110 | |||
| 1178 | Ga0495678_002190 | |||
| 1179 | Ga0495678_007868 | |||
| 1180 | Ga0495678_011307 | |||
| 1181 | Ga0495678_046306 | |||
| 1182 | Ga0495682_0000020 | |||
| 1183 | Ga0495682_0000065 | |||
| 1184 | Ga0495682_0001677 | |||
| 1185 | Ga0495682_0009847 | |||
| 1186 | Ga0495682_0024863 | |||
| 1187 | Ga0495682_0038743 | |||
| 1188 | Ga0501032_0023484 | |||
| 1189 | Ga0501034_0000480 | |||
| 1190 | Ga0501037_0080952 | |||
| 1191 | Ga0501222_006611 | |||
| 1192 | nmdc:mga00v17_65991_c1 | |||
| 1193 | Ga0500618_008253 | |||
| 1194 | Ga0500618_008300 | |||
| 1195 | Ga0500573_0117685 | |||
| 1196 | Ga0500616_0001659 | |||
| 1197 | Ga0500634_0047057 | |||
| 1198 | Ga0530510_0180133 | |||
| 1199 | 2511258480 | |||
| 1200 | 2511272544 | |||
| 1201 | 2511290774 | |||
| 1202 | 2511313849 | |||
| 1203 | 2511327777 | |||
| 1204 | 2511343834 | |||
| 1205 | 2511358632 | |||
| 1206 | 2599502203 | |||
| 1207 | 2599616068 | |||
| 1208 | 2599772657 | |||
| 1209 | 2599881043 | |||
| 1210 | 2599885067 | |||
| 1211 | 2599899792 | |||
| 1212 | 2599932737 | |||
| 1213 | 2599945253 | |||
| 1214 | 2599949675 | |||
| 1215 | 2599955395 | |||
| 1216 | 2599960883 | |||
| 1217 | 2599965488 | |||
| 1218 | 2599973749 | |||
| 1219 | 2599976603 | |||
| 1220 | 2599984428 | |||
| 1221 | 2599990401 | |||
| 1222 | 2599992828 | |||
| 1223 | 2600001657 | |||
| 1224 | 2600008911 | |||
| 1225 | 2600010652 | |||
| 1226 | 2600018377 | |||
| 1227 | 2600023307 | |||
| 1228 | 2600028220 | |||
| 1229 | 2600034157 | |||
| 1230 | 2600040330 | |||
| 1231 | 2600049237 | |||
| 1232 | 2600052897 | |||
| 1233 | 2600056978 | |||
| 1234 | 2600066805 | |||
| 1235 | 2600074057 | |||
| 1236 | 2600077536 | |||
| 1237 | 2600357331 | |||
| 1238 | 2601690403 | |||
| 1239 | 2624491490 | |||
| 1240 | 2644190363 | |||
| 1241 | 2644284919 | |||
| 1242 | 2652547172 | |||
| 1243 | 2671094655 | |||
| 1244 | 2671124823 | |||
| 1245 | 2678263883 | |||
| 1246 | 2738690745 | |||
| 1247 | 2738810538 | |||
| 1248 | 2738897898 | |||
| 1249 | 2739257985 | |||
| 1250 | 2739266519 | |||
| 1251 | 2745004336 | |||
| 1252 | 2774123124 | |||
| 1253 | 2775657010 | |||
| 1254 | 2784315470 | |||
| 1255 | 2794594728 | |||
| 1256 | 2808829251 | |||
| 1257 | 2808854894 | |||
| 1258 | 2808898445 | |||
| 1259 | 2808926324 | |||
| 1260 | 2808932737 | |||
| 1261 | 2808934911 | |||
| 1262 | 2808948425 | |||
| 1263 | 2808954873 | |||
| 1264 | 2808963308 | |||
| 1265 | 2808978541 | |||
| 1266 | 2808993932 | |||
| 1267 | 2808998287 | |||
| 1268 | 2812319003 | |||
| 1269 | 2825657330 | |||
| 1270 | 2842858383 | |||
| 1271 | 2852617429 | |||
| 1272 | 2852672452 | |||
| 1273 | 2857744457 | |||
| 1274 | 2860342509 | |||
| 1275 | 2904497668 | |||
| 1276 | 2904780690 | |||
| 1277 | 2910812221 | |||
| 1278 | 2913039291 | |||
| 1279 | 2919038686 | |||
| 1280 | 2919062494 | |||
| 1281 | 2919456639 | |||
| 1282 | 2919485291 | |||
| 1283 | 2919539682 | |||
| 1284 | 2919700951 | |||
| 1285 | 2923586582 | |||
| 1286 | 2929147882 | |||
| 1287 | 2931369746 | |||
| 1288 | 2931402593 | |||
| 1289 | 2933422093 | |||
| 1290 | 2939647410 | |||
| 1291 | 2945933875 | |||
| 1292 | 2945956447 | |||
| 1293 | 2946041218 | |||
| 1294 | 2946060525 | |||
| 1295 | 2953998342 | |||
| 1296 | 2988729464 | |||
| 1297 | 3007869744 | |||
| 1298 | 8019778383 | |||
| 1299 | 8054505803 | |||
| 1300 | 8056145536 | |||
| 1301 | 8056156913 | |||
| 1302 | 8056166484 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gfg-assembly6.cif.gz_L | structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form | 0.9284 | 15 | 352 |
| 3e82-assembly2.cif.gz_E | crystal structure of a putative oxidoreductase from klebsiella pneumoniae | 0.9273 | 14 | 353 |
| 3gfg-assembly3.cif.gz_F | structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form | 0.9266 | 14 | 352 |
| 3gfg-assembly6.cif.gz_L | structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form | 0.9257 | 15 | 352 |
| 3gfg-assembly5.cif.gz_I | structure of putative oxidoreductase yvaa from bacillus subtilis in triclinic form | 0.9251 | 15 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xeaB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9222 | 15 | 132 | 3.40.50.720 |
| af_P77376_2_121_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9136 | 14 | 133 | 3.90.1150.10 |
| af_P75931_1_120_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9118 | 15 | 132 | 3.40.50.720 |
| 3e82E02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9107 | 139 | 353 | 3.30.360.10 |
| af_O42896_134_368_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9081 | 143 | 351 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y8VD34-F1-model_v4 | deleted | 0.9839 | 15 | 125 |
|
| AF-F3GH84-F1-model_v4 | Oxidoreductase | 0.9704 | 200 | 351 |
|
| AF-W6VDA6-F1-model_v4 | Oxidoreductase domain protein | 0.9671 | 1 | 362 |
GO:0000166
GO:0016491 |
| AF-W6VDA6-F1-model_v4 | Oxidoreductase domain protein | 0.9644 | 1 | 362 |
GO:0000166
GO:0016491 |
| AF-F3GH84-F1-model_v4 | Oxidoreductase | 0.9581 | 200 | 351 |
|