F472576
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 651 | 380 | 621 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100024607|Ga0068868_1000246074 |
| Length | 313 |
| Sequence | VLAGSQSRRVDRTVNCVAAERGGGTRDDGRMTTFATLTYEVRDAKAYVTLNRPDRLNAIDDVMPGEIRTAVEQANADDAVRVIVVQGSGRAFCAGYDLKRFAEGDAGDRWRQPSGLAWDPVRDYREMRRNTDDFFTLWRSLKPTIAKVHGHAVAGGSDIALSCDLLVIADDARIGYPPARVWGCPTTAMWVYRLGAERAKRMLLTGDTIDGATACAWGLAVESVPAGELDVAVERLADRIAGVPINQLVMQKLLINQAYDNMGLQGTQLLATLFDGIARHSPEGNWFKELAESQGFHAAVEWRDSGRPIPDGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 7 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 8 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 9 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 10 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 11 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 12 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 13 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 14 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 15 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 16 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 17 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 18 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 19 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 20 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 21 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 22 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 23 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 24 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 25 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 26 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 27 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 28 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 29 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 30 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 31 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 32 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 33 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 34 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 35 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 39 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 40 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 59 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 83 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 87 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 226 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 227 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 228 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 229 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 255 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 264 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 265 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 266 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 267 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 268 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 269 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 270 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 271 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 275 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 276 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 277 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 283 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 365 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 373 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 375 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 380 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.93 |
| Metatranscriptomes | 0.46 |
| Isolates | 4.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.67 |
| Nodule | 0.31 |
| Rhizoplane | 3.23 |
| Rhizosphere | 76.19 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 4.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10047029 | 3300001979 | Bacteria | 1262 |
| 2 | JGI24737J22298_10018106 | 3300001990 | Bacteria | 2262 |
| 3 | JGI25152J39213_1002976 | 3300002773 | Bacteria | 6022 |
| 4 | JGI25150J39212_1001199 | 3300002774 | Bacteria | 7683 |
| 5 | JGI25159J45721_1004050 | 3300002987 | Bacteria | 4981 |
| 6 | JGI25151J46595_10001227 | 3300003187 | Bacteria | 18335 |
| 7 | JGI25151J46595_10006242 | 3300003187 | Bacteria | 6022 |
| 8 | JGI25151J46595_10011114 | 3300003187 | Bacteria | 4150 |
| 9 | JGI25153J46596_10004165 | 3300003215 | Bacteria | 7853 |
| 10 | JGI25153J46596_10005241 | 3300003215 | Bacteria | 6821 |
| 11 | JGI25160J50197_1005994 | 3300003354 | Bacteria | 4981 |
| 12 | JGI25161J50226_1002303 | 3300003374 | Bacteria | 4977 |
| 13 | JGI25161J50226_1003843 | 3300003374 | Bacteria | 3300 |
| 14 | Ga0055535_1002054 | 3300003761 | Bacteria | 8096 |
| 15 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 16 | Ga0055526_1008757 | 3300003771 | Bacteria | 4987 |
| 17 | Ga0055526_1008769 | 3300003771 | Bacteria | 4981 |
| 18 | Ga0055537_1003324 | 3300003773 | Bacteria | 4981 |
| 19 | Ga0055537_1003336 | 3300003773 | Bacteria | 4967 |
| 20 | Ga0055524_1006672 | 3300003775 | Bacteria | 4987 |
| 21 | Ga0055524_1006686 | 3300003775 | Bacteria | 4981 |
| 22 | Ga0055536_1000670 | 3300003781 | Bacteria | 23038 |
| 23 | Ga0055536_1001491 | 3300003781 | Bacteria | 14069 |
| 24 | Ga0055534_1003471 | 3300003784 | Bacteria | 4944 |
| 25 | Ga0055528_1007145 | 3300003790 | Bacteria | 4981 |
| 26 | Ga0055530_10001248 | 3300003791 | Bacteria | 19381 |
| 27 | Ga0055540_1001683 | 3300003792 | Bacteria | 12753 |
| 28 | Ga0055540_1005912 | 3300003792 | Bacteria | 4996 |
| 29 | Ga0055540_1011347 | 3300003792 | Bacteria | 2881 |
| 30 | Ga0055531_10009364 | 3300003794 | Bacteria | 5013 |
| 31 | Ga0055531_10037724 | 3300003794 | Bacteria | 1464 |
| 32 | Ga0055543_1002488 | 3300004625 | Bacteria | 6060 |
| 33 | Ga0055543_1004991 | 3300004625 | Bacteria | 3474 |
| 34 | Ga0065165_1006562 | 3300005262 | Bacteria | 6060 |
| 35 | Ga0070676_10003481 | 3300005328 | Bacteria | 8208 |
| 36 | Ga0070676_10010313 | 3300005328 | Bacteria | 5067 |
| 37 | Ga0070676_10025317 | 3300005328 | Bacteria | 3353 |
| 38 | Ga0070676_10116437 | 3300005328 | Bacteria | 1671 |
| 39 | Ga0070683_100047257 | 3300005329 | Bacteria | 3977 |
| 40 | Ga0070683_100130673 | 3300005329 | Bacteria | 2376 |
| 41 | Ga0070683_100277773 | 3300005329 | Bacteria | 1593 |
| 42 | Ga0070690_100006594 | 3300005330 | Bacteria | 6597 |
| 43 | Ga0070670_100002708 | 3300005331 | Bacteria | 14639 |
| 44 | Ga0070677_10007702 | 3300005333 | Bacteria | 3605 |
| 45 | Ga0070677_10119918 | 3300005333 | Bacteria | 1186 |
| 46 | Ga0068869_100005465 | 3300005334 | Bacteria | 7996 |
| 47 | Ga0068869_100045407 | 3300005334 | Bacteria | 3163 |
| 48 | Ga0070666_10007580 | 3300005335 | Bacteria | 6696 |
| 49 | Ga0070666_10030719 | 3300005335 | Bacteria | 3541 |
| 50 | Ga0070680_100000009 | 3300005336 | Bacteria | 98360 |
| 51 | Ga0070680_100015422 | 3300005336 | Bacteria | 5990 |
| 52 | Ga0070680_100022322 | 3300005336 | Bacteria | 5040 |
| 53 | Ga0070680_100092404 | 3300005336 | Bacteria | 2506 |
| 54 | Ga0070682_100283970 | 3300005337 | Bacteria | 1208 |
| 55 | Ga0068868_100002833 | 3300005338 | Bacteria | 12010 |
| 56 | Ga0068868_100024607 | 3300005338 | Bacteria | 4571 |
| 57 | Ga0068868_100071676 | 3300005338 | Bacteria | 2763 |
| 58 | Ga0068868_100095757 | 3300005338 | Bacteria | 2396 |
| 59 | Ga0068868_100312955 | 3300005338 | Bacteria | 1336 |
| 60 | Ga0070660_100072749 | 3300005339 | Bacteria | 2687 |
| 61 | Ga0070689_100039129 | 3300005340 | Bacteria | 3630 |
| 62 | Ga0070689_100176808 | 3300005340 | Bacteria | 1732 |
| 63 | Ga0070661_100049360 | 3300005344 | Bacteria | 3080 |
| 64 | Ga0070661_100049907 | 3300005344 | Bacteria | 3063 |
| 65 | Ga0070668_100002516 | 3300005347 | Bacteria | 13492 |
| 66 | Ga0070668_100078720 | 3300005347 | Bacteria | 2579 |
| 67 | Ga0070669_100034279 | 3300005353 | Bacteria | 3675 |
| 68 | Ga0070669_100054039 | 3300005353 | Bacteria | 2941 |
| 69 | Ga0070675_100004849 | 3300005354 | Bacteria | 10264 |
| 70 | Ga0070675_100012003 | 3300005354 | Bacteria | 6791 |
| 71 | Ga0070675_100020095 | 3300005354 | Bacteria | 5327 |
| 72 | Ga0070675_100028486 | 3300005354 | Bacteria | 4495 |
| 73 | Ga0070671_100000530 | 3300005355 | Bacteria | 26763 |
| 74 | Ga0070671_100019096 | 3300005355 | Bacteria | 5574 |
| 75 | Ga0070671_100045228 | 3300005355 | Bacteria | 3660 |
| 76 | Ga0070671_100091130 | 3300005355 | Bacteria | 2553 |
| 77 | Ga0070674_100003872 | 3300005356 | Bacteria | 8470 |
| 78 | Ga0070674_100166337 | 3300005356 | Bacteria | 1678 |
| 79 | Ga0070674_100243781 | 3300005356 | Bacteria | 1408 |
| 80 | Ga0070673_100026718 | 3300005364 | Bacteria | 4268 |
| 81 | Ga0070688_100135288 | 3300005365 | Bacteria | 1668 |
| 82 | Ga0070659_100000066 | 3300005366 | Bacteria | 82349 |
| 83 | Ga0070659_100029864 | 3300005366 | Bacteria | 4215 |
| 84 | Ga0070667_100020395 | 3300005367 | Bacteria | 5502 |
| 85 | Ga0070667_100386551 | 3300005367 | Bacteria | 1272 |
| 86 | Ga0070667_100599019 | 3300005367 | Bacteria | 1015 |
| 87 | Ga0070705_100028816 | 3300005440 | Bacteria | 3045 |
| 88 | Ga0070694_100034823 | 3300005444 | Bacteria | 3324 |
| 89 | Ga0070708_100166281 | 3300005445 | Bacteria | 2058 |
| 90 | Ga0070663_100000535 | 3300005455 | Bacteria | 20127 |
| 91 | Ga0070663_100115290 | 3300005455 | Bacteria | 2024 |
| 92 | Ga0070678_100019865 | 3300005456 | Bacteria | 4393 |
| 93 | Ga0070678_100027619 | 3300005456 | Bacteria | 3856 |
| 94 | Ga0070678_100076727 | 3300005456 | Bacteria | 2518 |
| 95 | Ga0070678_100180785 | 3300005456 | Bacteria | 1726 |
| 96 | Ga0070662_100010338 | 3300005457 | Bacteria | 6119 |
| 97 | Ga0070662_100071999 | 3300005457 | Bacteria | 2551 |
| 98 | Ga0070662_100076339 | 3300005457 | Bacteria | 2483 |
| 99 | Ga0070681_10000031 | 3300005458 | Bacteria | 102366 |
| 100 | Ga0070681_10043409 | 3300005458 | Bacteria | 4505 |
| 101 | Ga0070681_10078643 | 3300005458 | Bacteria | 3255 |
| 102 | Ga0068867_100003229 | 3300005459 | Bacteria | 11492 |
| 103 | Ga0068867_100022478 | 3300005459 | Bacteria | 4510 |
| 104 | Ga0068867_100057412 | 3300005459 | Bacteria | 2883 |
| 105 | Ga0068867_100134125 | 3300005459 | Bacteria | 1928 |
| 106 | Ga0070706_100453917 | 3300005467 | Bacteria | 1193 |
| 107 | Ga0070679_100000136 | 3300005530 | Bacteria | 59466 |
| 108 | Ga0070679_100015728 | 3300005530 | Bacteria | 7277 |
| 109 | Ga0070679_100096870 | 3300005530 | Bacteria | 2938 |
| 110 | Ga0070679_100146798 | 3300005530 | Bacteria | 2336 |
| 111 | Ga0070684_100106530 | 3300005535 | Bacteria | 2510 |
| 112 | Ga0070684_100254132 | 3300005535 | Bacteria | 1606 |
| 113 | Ga0068853_100006453 | 3300005539 | Bacteria | 9326 |
| 114 | Ga0070672_100003316 | 3300005543 | Bacteria | 10423 |
| 115 | Ga0070672_100036024 | 3300005543 | Bacteria | 3766 |
| 116 | Ga0070686_100232709 | 3300005544 | Bacteria | 1338 |
| 117 | Ga0070695_100007952 | 3300005545 | Bacteria | 6280 |
| 118 | Ga0070696_100085924 | 3300005546 | Bacteria | 2233 |
| 119 | Ga0070665_100311598 | 3300005548 | Bacteria | 1578 |
| 120 | Ga0070665_100338893 | 3300005548 | Bacteria | 1508 |
| 121 | Ga0070704_100017973 | 3300005549 | Bacteria | 4510 |
| 122 | Ga0070704_100074742 | 3300005549 | Bacteria | 2473 |
| 123 | Ga0068857_100108772 | 3300005577 | Bacteria | 2491 |
| 124 | Ga0068854_100056458 | 3300005578 | Bacteria | 2830 |
| 125 | Ga0068854_100209536 | 3300005578 | Bacteria | 1537 |
| 126 | Ga0068854_100318303 | 3300005578 | Bacteria | 1264 |
| 127 | Ga0068856_100024311 | 3300005614 | Bacteria | 5895 |
| 128 | Ga0070702_100116456 | 3300005615 | Bacteria | 1666 |
| 129 | Ga0068852_100015916 | 3300005616 | Bacteria | 5851 |
| 130 | Ga0068852_100085186 | 3300005616 | Bacteria | 2815 |
| 131 | Ga0068852_100193068 | 3300005616 | Bacteria | 1922 |
| 132 | Ga0068859_100003584 | 3300005617 | Bacteria | 15817 |
| 133 | Ga0068864_100250749 | 3300005618 | Bacteria | 1643 |
| 134 | Ga0068864_100266262 | 3300005618 | Bacteria | 1595 |
| 135 | Ga0068866_10027317 | 3300005718 | Bacteria | 2705 |
| 136 | Ga0068866_10246009 | 3300005718 | Bacteria | 1092 |
| 137 | Ga0068861_100017373 | 3300005719 | Bacteria | 5106 |
| 138 | Ga0068861_100255398 | 3300005719 | Bacteria | 1498 |
| 139 | Ga0068851_10028238 | 3300005834 | Bacteria | 2771 |
| 140 | Ga0068851_10052516 | 3300005834 | Bacteria | 2072 |
| 141 | Ga0068863_100002273 | 3300005841 | Bacteria | 19085 |
| 142 | Ga0068863_100237828 | 3300005841 | Bacteria | 1758 |
| 143 | Ga0068858_100002102 | 3300005842 | Bacteria | 20214 |
| 144 | Ga0068858_100034403 | 3300005842 | Bacteria | 4700 |
| 145 | Ga0068858_100035047 | 3300005842 | Bacteria | 4655 |
| 146 | Ga0068858_100046962 | 3300005842 | Bacteria | 4003 |
| 147 | Ga0068860_100007803 | 3300005843 | Bacteria | 10688 |
| 148 | Ga0068860_100009984 | 3300005843 | Bacteria | 9410 |
| 149 | Ga0068860_100052671 | 3300005843 | Bacteria | 3870 |
| 150 | Ga0068860_100151427 | 3300005843 | Bacteria | 2234 |
| 151 | Ga0068862_100045821 | 3300005844 | Bacteria | 3732 |
| 152 | Ga0068862_100108186 | 3300005844 | Bacteria | 2438 |
| 153 | Ga0068862_100448788 | 3300005844 | Bacteria | 1215 |
| 154 | Ga0075365_10263373 | 3300006038 | Bacteria | 1212 |
| 155 | Ga0075363_100004625 | 3300006048 | Bacteria | 6047 |
| 156 | Ga0075363_100150853 | 3300006048 | Bacteria | 1312 |
| 157 | Ga0075362_10004754 | 3300006177 | Bacteria | 4905 |
| 158 | Ga0097621_100073590 | 3300006237 | Bacteria | 2829 |
| 159 | Ga0097621_100087007 | 3300006237 | Bacteria | 2609 |
| 160 | Ga0075370_10010827 | 3300006353 | Bacteria | 4780 |
| 161 | Ga0075370_10020076 | 3300006353 | Bacteria | 3646 |
| 162 | Ga0075370_10025322 | 3300006353 | Bacteria | 3281 |
| 163 | Ga0068871_100018082 | 3300006358 | Bacteria | 5350 |
| 164 | Ga0068871_100221663 | 3300006358 | Bacteria | 1639 |
| 165 | Ga0068871_100301480 | 3300006358 | Bacteria | 1407 |
| 166 | Ga0075428_100525101 | 3300006844 | Bacteria | 1266 |
| 167 | Ga0075430_100000447 | 3300006846 | Bacteria | 30766 |
| 168 | Ga0068865_100008047 | 3300006881 | Bacteria | 6509 |
| 169 | Ga0068865_100099960 | 3300006881 | Bacteria | 2122 |
| 170 | Ga0075436_100207955 | 3300006914 | Bacteria | 1387 |
| 171 | Ga0097620_100003584 | 3300006931 | Bacteria | 15817 |
| 172 | Ga0105240_10470388 | 3300009093 | Bacteria | 1403 |
| 173 | Ga0111539_10461697 | 3300009094 | Bacteria | 1479 |
| 174 | Ga0105245_10000228 | 3300009098 | Bacteria | 53451 |
| 175 | Ga0105245_10346418 | 3300009098 | Bacteria | 1471 |
| 176 | Ga0105243_10002282 | 3300009148 | Bacteria | 16080 |
| 177 | Ga0105243_10017318 | 3300009148 | Bacteria | 5448 |
| 178 | Ga0105243_10321804 | 3300009148 | Bacteria | 1410 |
| 179 | Ga0105243_10768085 | 3300009148 | Bacteria | 947 |
| 180 | Ga0105241_10090870 | 3300009174 | Bacteria | 2408 |
| 181 | Ga0105242_10276887 | 3300009176 | Bacteria | 1522 |
| 182 | Ga0105248_10020017 | 3300009177 | Bacteria | 7409 |
| 183 | Ga0105248_10311823 | 3300009177 | Bacteria | 1772 |
| 184 | Ga0105248_10472930 | 3300009177 | Bacteria | 1413 |
| 185 | Ga0105237_10005983 | 3300009545 | Bacteria | 13627 |
| 186 | Ga0105237_10432764 | 3300009545 | Bacteria | 1321 |
| 187 | Ga0105238_10524415 | 3300009551 | Bacteria | 1187 |
| 188 | Ga0105249_10013202 | 3300009553 | Bacteria | 7289 |
| 189 | Ga0105249_10135664 | 3300009553 | Bacteria | 2354 |
| 190 | Ga0105249_10609062 | 3300009553 | Bacteria | 1147 |
| 191 | Ga0105246_10119168 | 3300011119 | Bacteria | 1952 |
| 192 | Ga0105246_10125982 | 3300011119 | Bacteria | 1905 |
| 193 | Ga0105246_10453131 | 3300011119 | Bacteria | 1079 |
| 194 | Ga0157373_10047343 | 3300013100 | Bacteria | 3067 |
| 195 | Ga0157371_10217466 | 3300013102 | Bacteria | 1372 |
| 196 | Ga0157370_10019746 | 3300013104 | Bacteria | 6746 |
| 197 | Ga0157370_10296440 | 3300013104 | Bacteria | 1493 |
| 198 | Ga0157370_10475861 | 3300013104 | Bacteria | 1148 |
| 199 | Ga0157369_10001727 | 3300013105 | Bacteria | 26551 |
| 200 | Ga0157369_10002082 | 3300013105 | Bacteria | 24188 |
| 201 | Ga0157369_10016310 | 3300013105 | Bacteria | 8361 |
| 202 | Ga0157369_10016713 | 3300013105 | Bacteria | 8247 |
| 203 | Ga0157369_10017016 | 3300013105 | Bacteria | 8171 |
| 204 | Ga0157369_10177250 | 3300013105 | Bacteria | 2244 |
| 205 | Ga0157374_10041536 | 3300013296 | Bacteria | 4239 |
| 206 | Ga0157374_10169426 | 3300013296 | Bacteria | 2129 |
| 207 | Ga0163162_10278559 | 3300013306 | Bacteria | 1804 |
| 208 | Ga0163162_10298191 | 3300013306 | Bacteria | 1744 |
| 209 | Ga0157375_10011892 | 3300013308 | Bacteria | 7700 |
| 210 | Ga0157375_10104814 | 3300013308 | Bacteria | 2917 |
| 211 | Ga0157375_10139104 | 3300013308 | Bacteria | 2554 |
| 212 | Ga0163163_10002764 | 3300014325 | Bacteria | 14808 |
| 213 | Ga0157380_10069612 | 3300014326 | Bacteria | 2840 |
| 214 | Ga0157380_10197827 | 3300014326 | Bacteria | 1781 |
| 215 | Ga0157380_10354837 | 3300014326 | Bacteria | 1374 |
| 216 | Ga0182008_10010913 | 3300014497 | Bacteria | 4846 |
| 217 | Ga0157377_10223409 | 3300014745 | Bacteria | 1207 |
| 218 | Ga0157379_10000632 | 3300014968 | Bacteria | 28339 |
| 219 | Ga0157379_10016152 | 3300014968 | Bacteria | 6566 |
| 220 | Ga0157379_10022399 | 3300014968 | Bacteria | 5596 |
| 221 | Ga0157379_10049410 | 3300014968 | Bacteria | 3756 |
| 222 | Ga0157376_10037068 | 3300014969 | Bacteria | 3954 |
| 223 | Ga0157376_10131724 | 3300014969 | Bacteria | 2232 |
| 224 | Ga0157376_10142798 | 3300014969 | Bacteria | 2150 |
| 225 | Ga0157376_10432903 | 3300014969 | Bacteria | 1279 |
| 226 | Ga0163161_10000092 | 3300017792 | Bacteria | 90636 |
| 227 | Ga0163161_10025313 | 3300017792 | Bacteria | 4199 |
| 228 | Ga0163161_10068971 | 3300017792 | Bacteria | 2584 |
| 229 | Ga0206354_10170213 | 3300020081 | Bacteria | 1208 |
| 230 | Ga0206353_10699119 | 3300020082 | Bacteria | 9885 |
| 231 | Ga0206353_11294257 | 3300020082 | Bacteria | 3571 |
| 232 | Ga0213873_10026812 | 3300021358 | Bacteria | 1402 |
| 233 | Ga0213874_10046544 | 3300021377 | Bacteria | 1317 |
| 234 | Ga0213876_10016071 | 3300021384 | Bacteria | 3958 |
| 235 | Ga0209436_101782 | 3300025208 | Bacteria | 7033 |
| 236 | Ga0209436_102759 | 3300025208 | Bacteria | 5027 |
| 237 | Ga0209672_100930 | 3300025228 | Bacteria | 13214 |
| 238 | Ga0209147_101551 | 3300025229 | Bacteria | 7874 |
| 239 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 240 | Ga0207425_1000365 | 3300025245 | Bacteria | 31393 |
| 241 | Ga0207425_1007215 | 3300025245 | Bacteria | 2956 |
| 242 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 243 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 244 | Ga0209129_1002036 | 3300025258 | Bacteria | 10457 |
| 245 | Ga0209129_1003152 | 3300025258 | Bacteria | 7388 |
| 246 | Ga0209129_1003474 | 3300025258 | Bacteria | 6824 |
| 247 | Ga0209565_1000199 | 3300025263 | Bacteria | 71613 |
| 248 | Ga0209565_1001616 | 3300025263 | Bacteria | 9524 |
| 249 | Ga0209673_1000128 | 3300025273 | Bacteria | 164482 |
| 250 | Ga0209673_1000304 | 3300025273 | Bacteria | 91151 |
| 251 | Ga0209130_1000321 | 3300025284 | Bacteria | 56239 |
| 252 | Ga0209130_1002727 | 3300025284 | Bacteria | 8368 |
| 253 | Ga0209675_1000298 | 3300025291 | Bacteria | 45731 |
| 254 | Ga0209675_1006447 | 3300025291 | Bacteria | 4699 |
| 255 | Ga0209675_1007353 | 3300025291 | Bacteria | 4236 |
| 256 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 257 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 258 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 259 | Ga0209025_1000248 | 3300025294 | Bacteria | 126818 |
| 260 | Ga0209025_1001298 | 3300025294 | Bacteria | 34116 |
| 261 | Ga0209025_1011593 | 3300025294 | Bacteria | 5783 |
| 262 | Ga0209564_1000360 | 3300025295 | Bacteria | 84454 |
| 263 | Ga0209564_1000603 | 3300025295 | Bacteria | 56168 |
| 264 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 265 | Ga0209758_1015133 | 3300025297 | Bacteria | 4025 |
| 266 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 267 | Ga0209050_1012636 | 3300025298 | Bacteria | 3847 |
| 268 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 269 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 270 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 271 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 272 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 273 | Ga0209051_1000541 | 3300025303 | Bacteria | 46579 |
| 274 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 275 | Ga0209257_1004309 | 3300025304 | Bacteria | 11181 |
| 276 | Ga0209257_1007991 | 3300025304 | Bacteria | 6179 |
| 277 | Ga0207682_10006348 | 3300025893 | Bacteria | 4771 |
| 278 | Ga0207682_10026133 | 3300025893 | Bacteria | 2319 |
| 279 | Ga0207642_10033539 | 3300025899 | Bacteria | 2173 |
| 280 | Ga0207642_10169894 | 3300025899 | Bacteria | 1179 |
| 281 | Ga0207688_10008823 | 3300025901 | Bacteria | 5487 |
| 282 | Ga0207680_10009114 | 3300025903 | Bacteria | 4907 |
| 283 | Ga0207680_10052435 | 3300025903 | Bacteria | 2444 |
| 284 | Ga0207685_10073673 | 3300025905 | Bacteria | 1392 |
| 285 | Ga0207645_10008037 | 3300025907 | Bacteria | 7399 |
| 286 | Ga0207645_10010765 | 3300025907 | Bacteria | 6270 |
| 287 | Ga0207645_10020197 | 3300025907 | Bacteria | 4362 |
| 288 | Ga0207645_10035730 | 3300025907 | Bacteria | 3190 |
| 289 | Ga0207645_10101313 | 3300025907 | Bacteria | 1858 |
| 290 | Ga0207643_10023982 | 3300025908 | Bacteria | 3366 |
| 291 | Ga0207705_10166050 | 3300025909 | Bacteria | 1660 |
| 292 | Ga0207684_10104147 | 3300025910 | Bacteria | 2426 |
| 293 | Ga0207707_10000074 | 3300025912 | Bacteria | 102367 |
| 294 | Ga0207707_10036567 | 3300025912 | Bacteria | 4292 |
| 295 | Ga0207707_10094367 | 3300025912 | Bacteria | 2614 |
| 296 | Ga0207671_10065160 | 3300025914 | Bacteria | 2709 |
| 297 | Ga0207660_10000153 | 3300025917 | Bacteria | 42603 |
| 298 | Ga0207660_10018152 | 3300025917 | Bacteria | 4685 |
| 299 | Ga0207660_10021106 | 3300025917 | Bacteria | 4377 |
| 300 | Ga0207660_10043166 | 3300025917 | Bacteria | 3168 |
| 301 | Ga0207662_10061311 | 3300025918 | Bacteria | 2258 |
| 302 | Ga0207662_10100450 | 3300025918 | Bacteria | 1792 |
| 303 | Ga0207657_10029882 | 3300025919 | Bacteria | 4954 |
| 304 | Ga0207657_10063815 | 3300025919 | Bacteria | 3147 |
| 305 | Ga0207657_10080297 | 3300025919 | Bacteria | 2742 |
| 306 | Ga0207657_10116342 | 3300025919 | Bacteria | 2203 |
| 307 | Ga0207649_10014381 | 3300025920 | Bacteria | 4429 |
| 308 | Ga0207652_10000374 | 3300025921 | Bacteria | 46565 |
| 309 | Ga0207652_10016058 | 3300025921 | Bacteria | 6105 |
| 310 | Ga0207652_10027027 | 3300025921 | Bacteria | 4781 |
| 311 | Ga0207652_10104509 | 3300025921 | Bacteria | 2505 |
| 312 | Ga0207652_10110766 | 3300025921 | Bacteria | 2434 |
| 313 | Ga0207681_10004767 | 3300025923 | Bacteria | 8349 |
| 314 | Ga0207650_10001000 | 3300025925 | Bacteria | 21248 |
| 315 | Ga0207650_10242427 | 3300025925 | Bacteria | 1457 |
| 316 | Ga0207659_10001048 | 3300025926 | Bacteria | 16382 |
| 317 | Ga0207659_10013986 | 3300025926 | Bacteria | 5164 |
| 318 | Ga0207659_10179240 | 3300025926 | Bacteria | 1677 |
| 319 | Ga0207659_10201677 | 3300025926 | Bacteria | 1589 |
| 320 | Ga0207687_10124244 | 3300025927 | Bacteria | 1935 |
| 321 | Ga0207644_10029760 | 3300025931 | Bacteria | 3790 |
| 322 | Ga0207644_10051632 | 3300025931 | Bacteria | 2952 |
| 323 | Ga0207644_10069994 | 3300025931 | Bacteria | 2563 |
| 324 | Ga0207644_10140871 | 3300025931 | Bacteria | 1857 |
| 325 | Ga0207690_10002600 | 3300025932 | Bacteria | 10890 |
| 326 | Ga0207690_10056869 | 3300025932 | Bacteria | 2641 |
| 327 | Ga0207690_10075646 | 3300025932 | Bacteria | 2335 |
| 328 | Ga0207706_10006805 | 3300025933 | Bacteria | 10571 |
| 329 | Ga0207706_10063411 | 3300025933 | Bacteria | 3254 |
| 330 | Ga0207686_10244319 | 3300025934 | Bacteria | 1308 |
| 331 | Ga0207709_10000467 | 3300025935 | Bacteria | 37277 |
| 332 | Ga0207709_10030408 | 3300025935 | Bacteria | 3141 |
| 333 | Ga0207709_10311153 | 3300025935 | Bacteria | 1175 |
| 334 | Ga0207670_10050995 | 3300025936 | Bacteria | 2776 |
| 335 | Ga0207670_10105529 | 3300025936 | Bacteria | 2020 |
| 336 | Ga0207669_10324598 | 3300025937 | Bacteria | 1179 |
| 337 | Ga0207704_10131606 | 3300025938 | Bacteria | 1733 |
| 338 | Ga0207691_10001568 | 3300025940 | Bacteria | 22703 |
| 339 | Ga0207691_10003901 | 3300025940 | Bacteria | 14484 |
| 340 | Ga0207691_10010473 | 3300025940 | Bacteria | 8894 |
| 341 | Ga0207691_10021378 | 3300025940 | Bacteria | 6111 |
| 342 | Ga0207691_10032483 | 3300025940 | Bacteria | 4865 |
| 343 | Ga0207691_10241385 | 3300025940 | Bacteria | 1562 |
| 344 | Ga0207689_10001729 | 3300025942 | Bacteria | 20638 |
| 345 | Ga0207689_10083637 | 3300025942 | Bacteria | 2624 |
| 346 | Ga0207661_10156567 | 3300025944 | Bacteria | 1974 |
| 347 | Ga0207661_10210083 | 3300025944 | Bacteria | 1715 |
| 348 | Ga0207661_10310517 | 3300025944 | Bacteria | 1415 |
| 349 | Ga0207667_10022513 | 3300025949 | Bacteria | 6958 |
| 350 | Ga0207667_10365390 | 3300025949 | Bacteria | 1471 |
| 351 | Ga0207667_10733715 | 3300025949 | Bacteria | 988 |
| 352 | Ga0207651_10001581 | 3300025960 | Bacteria | 10423 |
| 353 | Ga0207651_10039672 | 3300025960 | Bacteria | 3107 |
| 354 | Ga0207712_10004089 | 3300025961 | Bacteria | 9205 |
| 355 | Ga0207712_10517239 | 3300025961 | Bacteria | 1022 |
| 356 | Ga0207668_10136427 | 3300025972 | Bacteria | 1880 |
| 357 | Ga0207668_10277727 | 3300025972 | Bacteria | 1372 |
| 358 | Ga0207640_10147026 | 3300025981 | Bacteria | 1726 |
| 359 | Ga0207658_10007808 | 3300025986 | Bacteria | 7286 |
| 360 | Ga0207658_10009704 | 3300025986 | Bacteria | 6535 |
| 361 | Ga0207658_10063285 | 3300025986 | Bacteria | 2772 |
| 362 | Ga0207658_10121953 | 3300025986 | Bacteria | 2080 |
| 363 | Ga0207658_10122474 | 3300025986 | Bacteria | 2076 |
| 364 | Ga0207658_10157885 | 3300025986 | Bacteria | 1856 |
| 365 | Ga0207677_10010787 | 3300026023 | Bacteria | 5181 |
| 366 | Ga0207677_10389108 | 3300026023 | Bacteria | 1179 |
| 367 | Ga0207677_10395500 | 3300026023 | Bacteria | 1170 |
| 368 | Ga0207703_10004561 | 3300026035 | Bacteria | 11359 |
| 369 | Ga0207703_10005803 | 3300026035 | Bacteria | 9893 |
| 370 | Ga0207703_10021193 | 3300026035 | Bacteria | 5087 |
| 371 | Ga0207703_10060645 | 3300026035 | Bacteria | 3094 |
| 372 | Ga0207639_10018046 | 3300026041 | Bacteria | 5007 |
| 373 | Ga0207639_10024775 | 3300026041 | Bacteria | 4347 |
| 374 | Ga0207639_10140573 | 3300026041 | Bacteria | 2011 |
| 375 | Ga0207678_10004423 | 3300026067 | Bacteria | 12642 |
| 376 | Ga0207708_10077147 | 3300026075 | Bacteria | 2557 |
| 377 | Ga0207708_10253286 | 3300026075 | Bacteria | 1419 |
| 378 | Ga0207702_10296478 | 3300026078 | Bacteria | 1533 |
| 379 | Ga0207641_10006097 | 3300026088 | Bacteria | 10204 |
| 380 | Ga0207641_10134804 | 3300026088 | Bacteria | 2221 |
| 381 | Ga0207648_10016997 | 3300026089 | Bacteria | 6630 |
| 382 | Ga0207648_10047268 | 3300026089 | Bacteria | 3773 |
| 383 | Ga0207648_10322513 | 3300026089 | Bacteria | 1388 |
| 384 | Ga0207676_10003710 | 3300026095 | Bacteria | 10799 |
| 385 | Ga0207676_10101835 | 3300026095 | Bacteria | 2382 |
| 386 | Ga0207676_10193792 | 3300026095 | Bacteria | 1790 |
| 387 | Ga0207676_10450712 | 3300026095 | Bacteria | 1213 |
| 388 | Ga0207674_10086723 | 3300026116 | Bacteria | 3124 |
| 389 | Ga0207675_100000267 | 3300026118 | Bacteria | 49570 |
| 390 | Ga0207675_100004220 | 3300026118 | Bacteria | 13908 |
| 391 | Ga0207683_10010011 | 3300026121 | Bacteria | 8092 |
| 392 | Ga0207683_10024674 | 3300026121 | Bacteria | 5180 |
| 393 | Ga0207698_10025696 | 3300026142 | Bacteria | 4153 |
| 394 | Ga0207698_10067865 | 3300026142 | Bacteria | 2814 |
| 395 | Ga0207698_10084910 | 3300026142 | Bacteria | 2568 |
| 396 | Ga0268265_10064051 | 3300028380 | Bacteria | 2831 |
| 397 | Ga0268264_10011894 | 3300028381 | Bacteria | 7170 |
| 398 | Ga0268264_10029646 | 3300028381 | Bacteria | 4483 |
| 399 | Ga0268264_10049503 | 3300028381 | Bacteria | 3496 |
| 400 | Ga0268264_10077404 | 3300028381 | Bacteria | 2833 |
| 401 | Ga0265338_10010034 | 3300028800 | Bacteria | 11193 |
| 402 | Ga0314311_1042102 | 3300030733 | Bacteria | 3096 |
| 403 | Ga0265339_10007383 | 3300031249 | Bacteria | 7111 |
| 404 | Ga0265327_10000454 | 3300031251 | Bacteria | 73503 |
| 405 | Ga0307509_10029262 | 3300031507 | Bacteria | 6116 |
| 406 | Ga0307408_100019166 | 3300031548 | Bacteria | 4604 |
| 407 | Ga0307408_100133633 | 3300031548 | Bacteria | 1938 |
| 408 | Ga0307408_100151922 | 3300031548 | Bacteria | 1829 |
| 409 | Ga0307408_100338299 | 3300031548 | Bacteria | 1273 |
| 410 | Ga0316575_10009769 | 3300031665 | Bacteria | 3517 |
| 411 | Ga0316579_10001451 | 3300031691 | Bacteria | 8614 |
| 412 | Ga0316576_10012856 | 3300031727 | Bacteria | 5540 |
| 413 | Ga0316576_10013736 | 3300031727 | Bacteria | 5392 |
| 414 | Ga0316576_10021252 | 3300031727 | Bacteria | 4485 |
| 415 | Ga0316576_10093814 | 3300031727 | Bacteria | 2238 |
| 416 | Ga0316578_10029456 | 3300031728 | Bacteria | 3116 |
| 417 | Ga0307405_10001548 | 3300031731 | Bacteria | 9747 |
| 418 | Ga0307405_10016399 | 3300031731 | Bacteria | 4040 |
| 419 | Ga0307405_10030887 | 3300031731 | Bacteria | 3146 |
| 420 | Ga0316577_10096657 | 3300031733 | Bacteria | 1654 |
| 421 | Ga0307413_10136986 | 3300031824 | Bacteria | 1685 |
| 422 | Ga0307410_10365100 | 3300031852 | Bacteria | 1157 |
| 423 | Ga0326468_10001530 | 3300031889 | Bacteria | 1993 |
| 424 | Ga0307406_10006772 | 3300031901 | Bacteria | 6337 |
| 425 | Ga0307406_10011607 | 3300031901 | Bacteria | 5004 |
| 426 | Ga0307407_10048774 | 3300031903 | Bacteria | 2412 |
| 427 | Ga0307407_10058052 | 3300031903 | Bacteria | 2248 |
| 428 | Ga0307412_10004436 | 3300031911 | Bacteria | 7817 |
| 429 | Ga0307412_10200455 | 3300031911 | Bacteria | 1515 |
| 430 | Ga0307409_100145075 | 3300031995 | Bacteria | 2051 |
| 431 | Ga0307416_100015973 | 3300032002 | Bacteria | 5202 |
| 432 | Ga0307416_100025154 | 3300032002 | Bacteria | 4360 |
| 433 | Ga0307414_10025136 | 3300032004 | Bacteria | 3809 |
| 434 | Ga0307414_10123218 | 3300032004 | Bacteria | 1997 |
| 435 | Ga0307415_100088614 | 3300032126 | Bacteria | 2233 |
| 436 | Ga0307415_100365718 | 3300032126 | Bacteria | 1219 |
| 437 | Ga0373948_0021459 | 3300034817 | Bacteria | 1237 |
| 438 | Ga0373944_0029210 | 3300035089 | Bacteria | 1647 |
| 439 | Ga0373952_0018043 | 3300035092 | Bacteria | 1456 |
| 440 | Ga0373936_0014025 | 3300035113 | Bacteria | 3061 |
| 441 | Ga0373939_0121418 | 3300035114 | Bacteria | 922 |
| 442 | Ga0373954_0112820 | 3300035118 | Bacteria | 1316 |
| 443 | Ga0373960_0048206 | 3300035121 | Bacteria | 1256 |
| 444 | Ga0373946_0138848 | 3300035171 | Bacteria | 1125 |
| 445 | Ga0316574_0014170 | 3300035398 | Bacteria | 4599 |
| 446 | Ga0316574_0033536 | 3300035398 | Bacteria | 3125 |
| 447 | Ga0316574_0189575 | 3300035398 | Bacteria | 1322 |
| 448 | Ga0373931_0011667 | 3300035691 | Bacteria | 4246 |
| 449 | Ga0373931_0034917 | 3300035691 | Bacteria | 2612 |
| 450 | Ga0373935_0001145 | 3300035692 | Bacteria | 14506 |
| 451 | Ga0373927_0010784 | 3300035695 | Bacteria | 6088 |
| 452 | Ga0316582_0005798 | 3300036647 | Bacteria | 6411 |
| 453 | Ga0316584_0009071 | 3300036712 | Bacteria | 6886 |
| 454 | Ga0316584_0063908 | 3300036712 | Bacteria | 2756 |
| 455 | Ga0373925_0029026 | 3300037068 | Bacteria | 4057 |
| 456 | Ga0373925_0041133 | 3300037068 | Bacteria | 3425 |
| 457 | Ga0395900_0553086 | 3300037418 | Bacteria | 1095 |
| 458 | Ga0395898_0191714 | 3300037466 | Bacteria | 1953 |
| 459 | Ga0316581_0007718 | 3300037588 | Bacteria | 2899 |
| 460 | Ga0395901_0224895 | 3300038443 | Bacteria | 1961 |
| 461 | Ga0395901_0358059 | 3300038443 | Bacteria | 1505 |
| 462 | Ga0436365_0672943 | 3300039437 | Bacteria | 3233 |
| 463 | Ga0436362_0012354 | 3300039453 | Bacteria | 2863 |
| 464 | Ga0436362_0612717 | 3300039453 | Bacteria | 1571 |
| 465 | Ga0436362_1282224 | 3300039453 | Bacteria | 1226 |
| 466 | Ga0439436_0002232 | 3300041404 | Bacteria | 5791 |
| 467 | Ga0439447_011250 | 3300041407 | Bacteria | 2621 |
| 468 | Ga0439466_0001685 | 3300041411 | Bacteria | 8628 |
| 469 | Ga0439465_0000168 | 3300041413 | Bacteria | 16705 |
| 470 | Ga0451841_1206030 | 3300041498 | Bacteria | 969 |
| 471 | Ga0439431_0001575 | 3300041997 | Bacteria | 5052 |
| 472 | Ga0439433_0000126 | 3300041999 | Bacteria | 11123 |
| 473 | Ga0439442_001795 | 3300042002 | Bacteria | 4198 |
| 474 | Ga0439445_0000357 | 3300042004 | Bacteria | 9073 |
| 475 | Ga0439432_000800 | 3300042006 | Bacteria | 11745 |
| 476 | Ga0439449_0004822 | 3300042007 | Bacteria | 5201 |
| 477 | Ga0439449_0005452 | 3300042007 | Bacteria | 4874 |
| 478 | Ga0439452_001221 | 3300042010 | Bacteria | 10955 |
| 479 | Ga0439457_001416 | 3300042014 | Bacteria | 7214 |
| 480 | Ga0439462_0016850 | 3300042015 | Bacteria | 1891 |
| 481 | Ga0439446_0105955 | 3300042156 | Bacteria | 893 |
| 482 | Ga0439434_0002102 | 3300042435 | Bacteria | 5762 |
| 483 | Ga0466969_0053138 | 3300044656 | Bacteria | 1989 |
| 484 | Ga0466965_0005041 | 3300044683 | Bacteria | 5919 |
| 485 | Ga0466965_0020083 | 3300044683 | Bacteria | 3209 |
| 486 | Ga0466966_0056859 | 3300044684 | Bacteria | 2474 |
| 487 | Ga0466966_0092495 | 3300044684 | Bacteria | 1876 |
| 488 | Ga0466961_0003906 | 3300044693 | Bacteria | 9319 |
| 489 | Ga0466961_0103209 | 3300044693 | Bacteria | 1795 |
| 490 | Ga0466961_0242267 | 3300044693 | Bacteria | 1108 |
| 491 | Ga0466963_0007892 | 3300044694 | Bacteria | 6371 |
| 492 | Ga0466963_0035271 | 3300044694 | Bacteria | 3258 |
| 493 | Ga0466964_0070617 | 3300044706 | Bacteria | 1476 |
| 494 | Ga0453684_0091919 | 3300044712 | Bacteria | 3743 |
| 495 | Ga0466957_0003797 | 3300044842 | Bacteria | 8350 |
| 496 | Ga0466960_0017758 | 3300044901 | Bacteria | 3109 |
| 497 | Ga0466959_0063858 | 3300045049 | Bacteria | 2673 |
| 498 | Ga0466959_0127340 | 3300045049 | Bacteria | 1807 |
| 499 | Ga0466959_0149345 | 3300045049 | Bacteria | 1648 |
| 500 | Ga0466959_0188251 | 3300045049 | Bacteria | 1441 |
| 501 | Ga0451576_0222141 | 3300045051 | Bacteria | 1972 |
| 502 | Ga0451576_0269665 | 3300045051 | Bacteria | 1779 |
| 503 | Ga0466958_0012609 | 3300045836 | Bacteria | 4790 |
| 504 | Ga0466958_0129014 | 3300045836 | Bacteria | 1587 |
| 505 | Ga0466958_0176831 | 3300045836 | Bacteria | 1353 |
| 506 | Ga0466967_0000635 | 3300045976 | Bacteria | 17623 |
| 507 | Ga0466967_0230988 | 3300045976 | Bacteria | 1761 |
| 508 | Ga0495627_012887 | 3300046453 | Bacteria | 2952 |
| 509 | Ga0495638_0004803 | 3300046460 | Bacteria | 10181 |
| 510 | Ga0495616_0010436 | 3300046513 | Bacteria | 5376 |
| 511 | Ga0495620_0016240 | 3300046515 | Bacteria | 3742 |
| 512 | Ga0495620_0080398 | 3300046515 | Bacteria | 1319 |
| 513 | Ga0495631_0002314 | 3300046518 | Bacteria | 10853 |
| 514 | Ga0495637_0020297 | 3300046520 | Bacteria | 3059 |
| 515 | Ga0495645_0117420 | 3300046543 | Bacteria | 1877 |
| 516 | Ga0495645_0121745 | 3300046543 | Bacteria | 1836 |
| 517 | Ga0495633_0046232 | 3300046558 | Bacteria | 2060 |
| 518 | Ga0495668_0001182 | 3300046616 | Bacteria | 26545 |
| 519 | Ga0495668_0053320 | 3300046616 | Bacteria | 2236 |
| 520 | Ga0495625_0007255 | 3300046660 | Bacteria | 9695 |
| 521 | Ga0495588_0173408 | 3300046674 | Bacteria | 1140 |
| 522 | Ga0495657_0182702 | 3300046675 | Bacteria | 1286 |
| 523 | Ga0495647_0085558 | 3300046681 | Bacteria | 1285 |
| 524 | Ga0495658_0030507 | 3300046683 | Bacteria | 2928 |
| 525 | Ga0495658_0188615 | 3300046683 | Bacteria | 1281 |
| 526 | Ga0495671_0006863 | 3300046692 | Bacteria | 6538 |
| 527 | Ga0496100_0021838 | 3300048903 | Bacteria | 3863 |
| 528 | Ga0496102_0072865 | 3300048905 | Bacteria | 3157 |
| 529 | Ga0496104_0143768 | 3300048907 | Bacteria | 2291 |
| 530 | Ga0496105_0204956 | 3300048908 | Bacteria | 1609 |
| 531 | Ga0496106_0178465 | 3300048909 | Bacteria | 1685 |
| 532 | Ga0496107_0007111 | 3300048910 | Bacteria | 7710 |
| 533 | Ga0496108_0027297 | 3300048911 | Bacteria | 4713 |
| 534 | Ga0496108_0168300 | 3300048911 | Bacteria | 1895 |
| 535 | Ga0496108_0186215 | 3300048911 | Bacteria | 1798 |
| 536 | Ga0496109_0556093 | 3300048912 | Bacteria | 1082 |
| 537 | Ga0496110_0082418 | 3300048913 | Bacteria | 2869 |
| 538 | Ga0496110_0100467 | 3300048913 | Bacteria | 2593 |
| 539 | Ga0496111_0281641 | 3300048914 | Bacteria | 1233 |
| 540 | Ga0496112_0225210 | 3300048915 | Bacteria | 1831 |
| 541 | Ga0496114_0021232 | 3300048917 | Bacteria | 5281 |
| 542 | Ga0496114_0060927 | 3300048917 | Bacteria | 3155 |
| 543 | Ga0496114_0071290 | 3300048917 | Bacteria | 2920 |
| 544 | Ga0496115_0094996 | 3300048918 | Bacteria | 2440 |
| 545 | Ga0496116_0085384 | 3300048919 | Bacteria | 1940 |
| 546 | Ga0496117_0009933 | 3300048920 | Bacteria | 8755 |
| 547 | Ga0496117_0188537 | 3300048920 | Bacteria | 1177 |
| 548 | Ga0496118_0142612 | 3300048921 | Bacteria | 1515 |
| 549 | Ga0496121_0088726 | 3300048924 | Bacteria | 2423 |
| 550 | Ga0496121_0106814 | 3300048924 | Bacteria | 2145 |
| 551 | Ga0496123_0147016 | 3300048926 | Bacteria | 1278 |
| 552 | Ga0496125_0067493 | 3300048928 | Bacteria | 2817 |
| 553 | Ga0501032_0240561 | 3300049569 | Bacteria | 1176 |
| 554 | Ga0501034_0256035 | 3300049571 | Bacteria | 1694 |
| 555 | Ga0501036_0024906 | 3300049572 | Bacteria | 5047 |
| 556 | Ga0501036_0170730 | 3300049572 | Bacteria | 1832 |
| 557 | Ga0501037_0031283 | 3300049573 | Bacteria | 3929 |
| 558 | Ga0501038_0005179 | 3300049574 | Bacteria | 12129 |
| 559 | Ga0501038_0064269 | 3300049574 | Bacteria | 3130 |
| 560 | Ga0501038_0087216 | 3300049574 | Bacteria | 2621 |
| 561 | Ga0501040_0004492 | 3300049576 | Bacteria | 9063 |
| 562 | Ga0501041_0092128 | 3300049577 | Bacteria | 1871 |
| 563 | Ga0501042_0007629 | 3300049578 | Bacteria | 7098 |
| 564 | Ga0501043_0016462 | 3300049579 | Bacteria | 5795 |
| 565 | Ga0501047_0029519 | 3300049581 | Bacteria | 5287 |
| 566 | Ga0501047_0089437 | 3300049581 | Bacteria | 2956 |
| 567 | Ga0501047_0467436 | 3300049581 | Bacteria | 1090 |
| 568 | Ga0501048_0019506 | 3300049582 | Bacteria | 4974 |
| 569 | Ga0501067_0151799 | 3300049583 | Bacteria | 1291 |
| 570 | Ga0501068_0072848 | 3300049584 | Bacteria | 2098 |
| 571 | Ga0501069_0000817 | 3300049585 | Bacteria | 14685 |
| 572 | Ga0501070_0000942 | 3300049586 | Bacteria | 26254 |
| 573 | Ga0501071_0117819 | 3300049587 | Bacteria | 1967 |
| 574 | Ga0501072_0002619 | 3300049588 | Bacteria | 13479 |
| 575 | Ga0501073_0005506 | 3300049589 | Bacteria | 9483 |
| 576 | Ga0501074_0019230 | 3300049590 | Bacteria | 4960 |
| 577 | Ga0501074_0029733 | 3300049590 | Bacteria | 3958 |
| 578 | Ga0501075_0004267 | 3300049591 | Bacteria | 9657 |
| 579 | Ga0501076_0000042 | 3300049592 | Bacteria | 62280 |
| 580 | Ga0501076_0022052 | 3300049592 | Bacteria | 4891 |
| 581 | Ga0501079_0069947 | 3300049741 | Bacteria | 2709 |
| 582 | Ga0501079_0094589 | 3300049741 | Bacteria | 2315 |
| 583 | Ga0501080_0002559 | 3300049742 | Bacteria | 15922 |
| 584 | Ga0501080_0025973 | 3300049742 | Bacteria | 5441 |
| 585 | Ga0501081_0003144 | 3300049743 | Bacteria | 10497 |
| 586 | Ga0501083_0000608 | 3300049744 | Bacteria | 23082 |
| 587 | Ga0501035_0038546 | 3300049822 | Bacteria | 4327 |
| 588 | Ga0501044_0028234 | 3300049823 | Bacteria | 5923 |
| 589 | Ga0501044_0140066 | 3300049823 | Bacteria | 2408 |
| 590 | nmdc:mga03683_2335_c1 | 3300050489 | Bacteria | 5873 |
| 591 | nmdc:mga0yw44_311356_c1 | 3300050492 | Bacteria | 1056 |
| 592 | nmdc:mga07m45_14518_c1 | 3300050496 | Bacteria | 3841 |
| 593 | nmdc:mga05p37_787528_c1 | 3300050507 | Bacteria | 1042 |
| 594 | nmdc:mga0qj67_11224_c1 | 3300050509 | Bacteria | 6709 |
| 595 | nmdc:mga08y16_304068_c1 | 3300050511 | Bacteria | 1643 |
| 596 | nmdc:mga0rr50_141226_c1 | 3300050513 | Bacteria | 1937 |
| 597 | Ga0495601_0059381 | 3300053077 | Bacteria | 2425 |
| 598 | Ga0500610_0007456 | 3300053079 | Bacteria | 4688 |
| 599 | Ga0500610_0021950 | 3300053079 | Bacteria | 3140 |
| 600 | Ga0495619_0273352 | 3300053085 | Bacteria | 1171 |
| 601 | Ga0500644_0015557 | 3300053088 | Bacteria | 2173 |
| 602 | Ga0500562_009817 | 3300053108 | Bacteria | 2420 |
| 603 | Ga0500593_001561 | 3300053117 | Bacteria | 8242 |
| 604 | Ga0500594_0001099 | 3300053118 | Bacteria | 5799 |
| 605 | Ga0500595_016138 | 3300053119 | Bacteria | 2787 |
| 606 | Ga0500607_004625 | 3300053121 | Bacteria | 9372 |
| 607 | Ga0500607_051948 | 3300053121 | Bacteria | 2178 |
| 608 | Ga0500658_0000986 | 3300053134 | Bacteria | 11626 |
| 609 | Ga0500559_0012541 | 3300053136 | Bacteria | 3598 |
| 610 | Ga0500568_0004310 | 3300053139 | Bacteria | 7633 |
| 611 | Ga0500577_0007908 | 3300053142 | Bacteria | 3003 |
| 612 | Ga0500616_0032665 | 3300053153 | Bacteria | 2844 |
| 613 | Ga0500620_068079 | 3300053155 | Bacteria | 1222 |
| 614 | Ga0500627_0001689 | 3300053158 | Bacteria | 6248 |
| 615 | Ga0500634_0014262 | 3300053161 | Bacteria | 4192 |
| 616 | Ga0501084_0003722 | 3300054114 | Bacteria | 12378 |
| 617 | Ga0501084_0004424 | 3300054114 | Bacteria | 11466 |
| 618 | Ga0501082_0006831 | 3300060353 | Bacteria | 9864 |
| 619 | Ga0501082_0122034 | 3300060353 | Bacteria | 2259 |
| 620 | Ga0466962_0022392 | 3300061719 | Bacteria | 3036 |
| 621 | Ga0530510_0002153 | 3300061734 | Bacteria | 13523 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_1282224 | Ga0436362_1282224_94_894 | 242 |
| 2 | 3300021358 | Ga0213873_10026812 | Ga0213873_100268122 | 257 |
| 3 | 3300021384 | Ga0213876_10016071 | Ga0213876_100160712 | 260 |
| 4 | 3300039437 | Ga0436365_0672943 | Ga0436365_0672943_2142_2972 | 260 |
| 5 | 3300039453 | Ga0436362_0012354 | Ga0436362_0012354_1452_2282 | 260 |
| 6 | 3300035113 | Ga0373936_0014025 | Ga0373936_0014025_1788_2621 | 267 |
| 7 | 3300035692 | Ga0373935_0001145 | Ga0373935_0001145_8552_9385 | 267 |
| 8 | 3300035695 | Ga0373927_0010784 | Ga0373927_0010784_1776_2609 | 267 |
| 9 | iso_pu_bacteria | 2876808645 | 2876813612 | 269 |
| 10 | iso_pu_bacteria | 2879110137 | 2879117458 | 269 |
| 11 | 3300031727 | Ga0316576_10093814 | Ga0316576_100938142 | 270 |
| 12 | 3300035398 | Ga0316574_0014170 | Ga0316574_0014170_2536_3432 | 270 |
| 13 | 3300025935 | Ga0207709_10311153 | Ga0207709_103111532 | 271 |
| 14 | 3300026075 | Ga0207708_10253286 | Ga0207708_102532862 | 271 |
| 15 | 3300048918 | Ga0496115_0094996 | Ga0496115_0094996_1592_2419 | 272 |
| 16 | 3300031548 | Ga0307408_100338299 | Ga0307408_1003382991 | 273 |
| 17 | 3300044683 | Ga0466965_0005041 | Ga0466965_0005041_1920_2819 | 274 |
| 18 | 3300003215 | JGI25153J46596_10004165 | JGI25153J46596_100041659 | 275 |
| 19 | 3300009094 | Ga0111539_10461697 | Ga0111539_104616972 | 275 |
| 20 | 3300011119 | Ga0105246_10453131 | Ga0105246_104531312 | 275 |
| 21 | 3300035398 | Ga0316574_0189575 | Ga0316574_0189575_196_1047 | 275 |
| 22 | 3300048913 | Ga0496110_0082418 | Ga0496110_0082418_1830_2660 | 275 |
| 23 | 3300049822 | Ga0501035_0038546 | Ga0501035_0038546_3204_4061 | 275 |
| 24 | 3300050511 | nmdc:mga08y16_304068_c1 | nmdc:mga08y16_304068_c1_286_1116 | 275 |
| 25 | 3300049581 | Ga0501047_0029519 | Ga0501047_0029519_1364_2224 | 276 |
| 26 | 3300005718 | Ga0068866_10246009 | Ga0068866_102460092 | 277 |
| 27 | 3300031251 | Ga0265327_10000454 | Ga0265327_1000045416 | 277 |
| 28 | 3300009098 | Ga0105245_10000228 | Ga0105245_1000022811 | 278 |
| 29 | 3300009177 | Ga0105248_10311823 | Ga0105248_103118232 | 278 |
| 30 | 3300009545 | Ga0105237_10005983 | Ga0105237_1000598312 | 278 |
| 31 | 3300013105 | Ga0157369_10016310 | Ga0157369_100163105 | 278 |
| 32 | 3300014969 | Ga0157376_10131724 | Ga0157376_101317242 | 278 |
| 33 | 3300025914 | Ga0207671_10065160 | Ga0207671_100651602 | 278 |
| 34 | 3300026095 | Ga0207676_10450712 | Ga0207676_104507122 | 278 |
| 35 | 3300045976 | Ga0466967_0230988 | Ga0466967_0230988_799_1641 | 278 |
| 36 | 3300005338 | Ga0068868_100024607 | Ga0068868_1000246074 | 279 |
| 37 | 3300005366 | Ga0070659_100000066 | Ga0070659_10000006685 | 279 |
| 38 | 3300006844 | Ga0075428_100525101 | Ga0075428_1005251012 | 279 |
| 39 | 3300013105 | Ga0157369_10001727 | Ga0157369_100017279 | 279 |
| 40 | 3300025932 | Ga0207690_10002600 | Ga0207690_100026004 | 279 |
| 41 | 3300028800 | Ga0265338_10010034 | Ga0265338_100100349 | 279 |
| 42 | 3300031507 | Ga0307509_10029262 | Ga0307509_100292627 | 279 |
| 43 | 3300039453 | Ga0436362_0612717 | Ga0436362_0612717_382_1233 | 279 |
| 44 | 3300049572 | Ga0501036_0170730 | Ga0501036_0170730_719_1561 | 279 |
| 45 | 3300049574 | Ga0501038_0087216 | Ga0501038_0087216_140_982 | 279 |
| 46 | 3300049576 | Ga0501040_0004492 | Ga0501040_0004492_3512_4354 | 279 |
| 47 | 3300049577 | Ga0501041_0092128 | Ga0501041_0092128_296_1138 | 279 |
| 48 | 3300049578 | Ga0501042_0007629 | Ga0501042_0007629_963_1805 | 279 |
| 49 | 3300049583 | Ga0501067_0151799 | Ga0501067_0151799_91_939 | 279 |
| 50 | 3300049584 | Ga0501068_0072848 | Ga0501068_0072848_565_1413 | 279 |
| 51 | 3300049585 | Ga0501069_0000817 | Ga0501069_0000817_10465_11313 | 279 |
| 52 | 3300049586 | Ga0501070_0000942 | Ga0501070_0000942_14362_15210 | 279 |
| 53 | 3300049587 | Ga0501071_0117819 | Ga0501071_0117819_1086_1928 | 279 |
| 54 | 3300049588 | Ga0501072_0002619 | Ga0501072_0002619_1566_2408 | 279 |
| 55 | 3300049589 | Ga0501073_0005506 | Ga0501073_0005506_4981_5829 | 279 |
| 56 | 3300049590 | Ga0501074_0029733 | Ga0501074_0029733_2728_3576 | 279 |
| 57 | 3300049591 | Ga0501075_0004267 | Ga0501075_0004267_4164_5006 | 279 |
| 58 | 3300049592 | Ga0501076_0000042 | Ga0501076_0000042_4002_4844 | 279 |
| 59 | 3300049592 | Ga0501076_0022052 | Ga0501076_0022052_1132_1974 | 279 |
| 60 | 3300049741 | Ga0501079_0069947 | Ga0501079_0069947_1275_2123 | 279 |
| 61 | 3300049741 | Ga0501079_0094589 | Ga0501079_0094589_1125_1967 | 279 |
| 62 | 3300049742 | Ga0501080_0002559 | Ga0501080_0002559_13656_14498 | 279 |
| 63 | 3300049742 | Ga0501080_0025973 | Ga0501080_0025973_2284_3132 | 279 |
| 64 | 3300049743 | Ga0501081_0003144 | Ga0501081_0003144_3850_4692 | 279 |
| 65 | 3300049744 | Ga0501083_0000608 | Ga0501083_0000608_11756_12604 | 279 |
| 66 | 3300054114 | Ga0501084_0003722 | Ga0501084_0003722_3899_4741 | 279 |
| 67 | 3300054114 | Ga0501084_0004424 | Ga0501084_0004424_4280_5128 | 279 |
| 68 | 3300060353 | Ga0501082_0006831 | Ga0501082_0006831_7137_7979 | 279 |
| 69 | 3300060353 | Ga0501082_0122034 | Ga0501082_0122034_1049_1897 | 279 |
| 70 | 3300061734 | Ga0530510_0002153 | Ga0530510_0002153_4652_5494 | 279 |
| 71 | iso_pu_bacteria | 2870782633 | 2870787837 | 279 |
| 72 | 3300005336 | Ga0070680_100000009 | Ga0070680_10000000965 | 280 |
| 73 | 3300005445 | Ga0070708_100166281 | Ga0070708_1001662812 | 280 |
| 74 | 3300005458 | Ga0070681_10000031 | Ga0070681_1000003168 | 280 |
| 75 | 3300005467 | Ga0070706_100453917 | Ga0070706_1004539171 | 280 |
| 76 | 3300005530 | Ga0070679_100000136 | Ga0070679_10000013622 | 280 |
| 77 | 3300025910 | Ga0207684_10104147 | Ga0207684_101041473 | 280 |
| 78 | 3300025912 | Ga0207707_10000074 | Ga0207707_1000007468 | 280 |
| 79 | 3300025917 | Ga0207660_10000153 | Ga0207660_1000015337 | 280 |
| 80 | 3300025921 | Ga0207652_10000374 | Ga0207652_1000037423 | 280 |
| 81 | 3300025944 | Ga0207661_10210083 | Ga0207661_102100833 | 280 |
| 82 | 3300025986 | Ga0207658_10122474 | Ga0207658_101224742 | 280 |
| 83 | 3300031665 | Ga0316575_10009769 | Ga0316575_100097691 | 280 |
| 84 | 3300031691 | Ga0316579_10001451 | Ga0316579_100014513 | 280 |
| 85 | 3300036647 | Ga0316582_0005798 | Ga0316582_0005798_5057_5902 | 280 |
| 86 | 3300037418 | Ga0395900_0553086 | Ga0395900_0553086_68_916 | 280 |
| 87 | 3300037588 | Ga0316581_0007718 | Ga0316581_0007718_1788_2633 | 280 |
| 88 | 3300042156 | Ga0439446_0105955 | Ga0439446_0105955_25_870 | 280 |
| 89 | 3300049571 | Ga0501034_0256035 | Ga0501034_0256035_95_976 | 280 |
| 90 | 3300009148 | Ga0105243_10768085 | Ga0105243_107680851 | 281 |
| 91 | 3300044656 | Ga0466969_0053138 | Ga0466969_0053138_848_1711 | 281 |
| 92 | 3300044684 | Ga0466966_0092495 | Ga0466966_0092495_816_1679 | 281 |
| 93 | 3300044693 | Ga0466961_0003906 | Ga0466961_0003906_4145_5005 | 281 |
| 94 | 3300045049 | Ga0466959_0188251 | Ga0466959_0188251_180_1043 | 281 |
| 95 | 3300005336 | Ga0070680_100022322 | Ga0070680_1000223225 | 282 |
| 96 | 3300005336 | Ga0070680_100092404 | Ga0070680_1000924042 | 282 |
| 97 | 3300005339 | Ga0070660_100072749 | Ga0070660_1000727493 | 282 |
| 98 | 3300005366 | Ga0070659_100029864 | Ga0070659_1000298642 | 282 |
| 99 | 3300005367 | Ga0070667_100599019 | Ga0070667_1005990191 | 282 |
| 100 | 3300005440 | Ga0070705_100028816 | Ga0070705_1000288161 | 282 |
| 101 | 3300005444 | Ga0070694_100034823 | Ga0070694_1000348233 | 282 |
| 102 | 3300005458 | Ga0070681_10078643 | Ga0070681_100786434 | 282 |
| 103 | 3300005530 | Ga0070679_100015728 | Ga0070679_1000157284 | 282 |
| 104 | 3300005545 | Ga0070695_100007952 | Ga0070695_1000079527 | 282 |
| 105 | 3300005546 | Ga0070696_100085924 | Ga0070696_1000859242 | 282 |
| 106 | 3300005548 | Ga0070665_100338893 | Ga0070665_1003388932 | 282 |
| 107 | 3300005549 | Ga0070704_100074742 | Ga0070704_1000747423 | 282 |
| 108 | 3300009553 | Ga0105249_10135664 | Ga0105249_101356642 | 282 |
| 109 | 3300021377 | Ga0213874_10046544 | Ga0213874_100465442 | 282 |
| 110 | 3300025917 | Ga0207660_10018152 | Ga0207660_100181523 | 282 |
| 111 | 3300025917 | Ga0207660_10043166 | Ga0207660_100431663 | 282 |
| 112 | 3300025919 | Ga0207657_10063815 | Ga0207657_100638152 | 282 |
| 113 | 3300025921 | Ga0207652_10027027 | Ga0207652_100270273 | 282 |
| 114 | 3300025921 | Ga0207652_10104509 | Ga0207652_101045092 | 282 |
| 115 | 3300025932 | Ga0207690_10075646 | Ga0207690_100756462 | 282 |
| 116 | 3300025961 | Ga0207712_10517239 | Ga0207712_105172391 | 282 |
| 117 | 3300025986 | Ga0207658_10157885 | Ga0207658_101578852 | 282 |
| 118 | 3300044706 | Ga0466964_0070617 | Ga0466964_0070617_185_1039 | 282 |
| 119 | 3300045976 | Ga0466967_0000635 | Ga0466967_0000635_14337_15191 | 282 |
| 120 | iso_pu_bacteria | 2899370129 | 2899370603 | 282 |
| 121 | 3300005530 | Ga0070679_100146798 | Ga0070679_1001467981 | 283 |
| 122 | 3300011119 | Ga0105246_10119168 | Ga0105246_101191682 | 283 |
| 123 | 3300025949 | Ga0207667_10733715 | Ga0207667_107337151 | 283 |
| 124 | 3300034817 | Ga0373948_0021459 | Ga0373948_0021459_281_1141 | 283 |
| 125 | 3300035691 | Ga0373931_0034917 | Ga0373931_0034917_262_1122 | 283 |
| 126 | 3300044693 | Ga0466961_0103209 | Ga0466961_0103209_893_1750 | 283 |
| 127 | 3300045049 | Ga0466959_0149345 | Ga0466959_0149345_412_1269 | 283 |
| 128 | 3300006048 | Ga0075363_100150853 | Ga0075363_1001508531 | 284 |
| 129 | 3300006914 | Ga0075436_100207955 | Ga0075436_1002079552 | 284 |
| 130 | 3300009176 | Ga0105242_10276887 | Ga0105242_102768872 | 284 |
| 131 | 3300013105 | Ga0157369_10017016 | Ga0157369_100170164 | 284 |
| 132 | 3300014969 | Ga0157376_10142798 | Ga0157376_101427981 | 284 |
| 133 | 3300046616 | Ga0495668_0001182 | Ga0495668_0001182_368_1249 | 284 |
| 134 | 3300048911 | Ga0496108_0027297 | Ga0496108_0027297_1678_2556 | 284 |
| 135 | 3300005329 | Ga0070683_100277773 | Ga0070683_1002777732 | 285 |
| 136 | 3300005367 | Ga0070667_100386551 | Ga0070667_1003865512 | 285 |
| 137 | 3300005530 | Ga0070679_100096870 | Ga0070679_1000968703 | 285 |
| 138 | 3300013105 | Ga0157369_10177250 | Ga0157369_101772503 | 285 |
| 139 | 3300020081 | Ga0206354_10170213 | Ga0206354_101702132 | 285 |
| 140 | 3300020082 | Ga0206353_10699119 | Ga0206353_106991197 | 285 |
| 141 | 3300025912 | Ga0207707_10036567 | Ga0207707_100365673 | 285 |
| 142 | 3300025921 | Ga0207652_10110766 | Ga0207652_101107663 | 285 |
| 143 | 3300025944 | Ga0207661_10156567 | Ga0207661_101565672 | 285 |
| 144 | 3300025986 | Ga0207658_10063285 | Ga0207658_100632852 | 285 |
| 145 | 3300031548 | Ga0307408_100133633 | Ga0307408_1001336333 | 285 |
| 146 | 3300031824 | Ga0307413_10136986 | Ga0307413_101369863 | 285 |
| 147 | 3300031852 | Ga0307410_10365100 | Ga0307410_103651001 | 285 |
| 148 | 3300031903 | Ga0307407_10048774 | Ga0307407_100487742 | 285 |
| 149 | 3300031911 | Ga0307412_10200455 | Ga0307412_102004552 | 285 |
| 150 | 3300031995 | Ga0307409_100145075 | Ga0307409_1001450752 | 285 |
| 151 | 3300032004 | Ga0307414_10025136 | Ga0307414_100251365 | 285 |
| 152 | 3300032004 | Ga0307414_10123218 | Ga0307414_101232181 | 285 |
| 153 | 3300032126 | Ga0307415_100365718 | Ga0307415_1003657181 | 285 |
| 154 | 3300038443 | Ga0395901_0358059 | Ga0395901_0358059_474_1337 | 285 |
| 155 | 3300041498 | Ga0451841_1206030 | Ga0451841_1206030_26_901 | 285 |
| 156 | 3300053155 | Ga0500620_068079 | Ga0500620_068079_16_891 | 285 |
| 157 | iso_pu_bacteria | 3002998708 | 3003002380 | 285 |
| 158 | 3300005455 | Ga0070663_100000535 | Ga0070663_10000053510 | 286 |
| 159 | 3300026067 | Ga0207678_10004423 | Ga0207678_1000442311 | 286 |
| 160 | 3300030733 | Ga0314311_1042102 | Ga0314311_10421022 | 286 |
| 161 | 3300031889 | Ga0326468_10001530 | Ga0326468_100015302 | 286 |
| 162 | 3300046674 | Ga0495588_0173408 | Ga0495588_0173408_21_881 | 286 |
| 163 | 3300046675 | Ga0495657_0182702 | Ga0495657_0182702_38_907 | 286 |
| 164 | 3300048913 | Ga0496110_0100467 | Ga0496110_0100467_1239_2108 | 286 |
| 165 | 3300048915 | Ga0496112_0225210 | Ga0496112_0225210_343_1212 | 286 |
| 166 | 3300048917 | Ga0496114_0021232 | Ga0496114_0021232_580_1449 | 286 |
| 167 | 3300049569 | Ga0501032_0240561 | Ga0501032_0240561_83_952 | 286 |
| 168 | 3300049572 | Ga0501036_0024906 | Ga0501036_0024906_3008_3877 | 286 |
| 169 | 3300049573 | Ga0501037_0031283 | Ga0501037_0031283_2869_3738 | 286 |
| 170 | 3300049574 | Ga0501038_0005179 | Ga0501038_0005179_10245_11114 | 286 |
| 171 | 3300049574 | Ga0501038_0064269 | Ga0501038_0064269_549_1418 | 286 |
| 172 | 3300049579 | Ga0501043_0016462 | Ga0501043_0016462_2849_3718 | 286 |
| 173 | 3300049581 | Ga0501047_0089437 | Ga0501047_0089437_1306_2175 | 286 |
| 174 | 3300049581 | Ga0501047_0467436 | Ga0501047_0467436_35_904 | 286 |
| 175 | 3300049582 | Ga0501048_0019506 | Ga0501048_0019506_411_1280 | 286 |
| 176 | 3300049590 | Ga0501074_0019230 | Ga0501074_0019230_2931_3800 | 286 |
| 177 | 3300049823 | Ga0501044_0028234 | Ga0501044_0028234_86_955 | 286 |
| 178 | 3300049823 | Ga0501044_0140066 | Ga0501044_0140066_812_1681 | 286 |
| 179 | 3300053085 | Ga0495619_0273352 | Ga0495619_0273352_267_1136 | 286 |
| 180 | 3300053088 | Ga0500644_0015557 | Ga0500644_0015557_1016_1882 | 286 |
| 181 | 3300053142 | Ga0500577_0007908 | Ga0500577_0007908_1713_2579 | 286 |
| 182 | iso_pu_bacteria | 2904535858 | 2904536865 | 286 |
| 183 | iso_pu_bacteria | 2922554459 | 2922555299 | 286 |
| 184 | 3300005329 | Ga0070683_100047257 | Ga0070683_1000472575 | 287 |
| 185 | 3300005535 | Ga0070684_100106530 | Ga0070684_1001065302 | 287 |
| 186 | 3300020082 | Ga0206353_11294257 | Ga0206353_112942572 | 287 |
| 187 | 3300026075 | Ga0207708_10077147 | Ga0207708_100771473 | 287 |
| 188 | 3300053119 | Ga0500595_016138 | Ga0500595_016138_1786_2694 | 287 |
| 189 | iso_pu_bacteria | 2565956761 | 2566993774 | 287 |
| 190 | 3300001990 | JGI24737J22298_10018106 | JGI24737J22298_100181062 | 289 |
| 191 | 3300005719 | Ga0068861_100255398 | Ga0068861_1002553982 | 289 |
| 192 | 3300014326 | Ga0157380_10069612 | Ga0157380_100696123 | 289 |
| 193 | 3300025899 | Ga0207642_10169894 | Ga0207642_101698942 | 289 |
| 194 | 3300031727 | Ga0316576_10012856 | Ga0316576_100128565 | 289 |
| 195 | 3300031727 | Ga0316576_10013736 | Ga0316576_100137366 | 289 |
| 196 | 3300031727 | Ga0316576_10021252 | Ga0316576_100212523 | 289 |
| 197 | 3300031728 | Ga0316578_10029456 | Ga0316578_100294562 | 289 |
| 198 | 3300031733 | Ga0316577_10096657 | Ga0316577_100966572 | 289 |
| 199 | 3300035398 | Ga0316574_0033536 | Ga0316574_0033536_775_1674 | 289 |
| 200 | 3300036712 | Ga0316584_0009071 | Ga0316584_0009071_2762_3658 | 289 |
| 201 | 3300036712 | Ga0316584_0063908 | Ga0316584_0063908_850_1749 | 289 |
| 202 | 3300044694 | Ga0466963_0035271 | Ga0466963_0035271_563_1444 | 289 |
| 203 | 3300045836 | Ga0466958_0176831 | Ga0466958_0176831_430_1311 | 289 |
| 204 | 3300046515 | Ga0495620_0080398 | Ga0495620_0080398_228_1106 | 289 |
| 205 | 3300005549 | Ga0070704_100017973 | Ga0070704_1000179734 | 290 |
| 206 | 3300006038 | Ga0075365_10263373 | Ga0075365_102633731 | 290 |
| 207 | 3300006048 | Ga0075363_100004625 | Ga0075363_1000046257 | 290 |
| 208 | 3300006353 | Ga0075370_10020076 | Ga0075370_100200762 | 290 |
| 209 | 3300035114 | Ga0373939_0121418 | Ga0373939_0121418_20_907 | 290 |
| 210 | 3300044683 | Ga0466965_0020083 | Ga0466965_0020083_523_1431 | 290 |
| 211 | 3300044684 | Ga0466966_0056859 | Ga0466966_0056859_1446_2354 | 290 |
| 212 | 3300044693 | Ga0466961_0242267 | Ga0466961_0242267_114_992 | 290 |
| 213 | 3300044694 | Ga0466963_0007892 | Ga0466963_0007892_270_1178 | 290 |
| 214 | 3300044712 | Ga0453684_0091919 | Ga0453684_0091919_103_1005 | 290 |
| 215 | 3300044842 | Ga0466957_0003797 | Ga0466957_0003797_3795_4703 | 290 |
| 216 | 3300045049 | Ga0466959_0063858 | Ga0466959_0063858_883_1791 | 290 |
| 217 | 3300045051 | Ga0451576_0269665 | Ga0451576_0269665_540_1442 | 290 |
| 218 | 3300045836 | Ga0466958_0012609 | Ga0466958_0012609_138_1046 | 290 |
| 219 | 3300045836 | Ga0466958_0129014 | Ga0466958_0129014_635_1513 | 290 |
| 220 | 3300048928 | Ga0496125_0067493 | Ga0496125_0067493_1135_2016 | 290 |
| 221 | 3300050492 | nmdc:mga0yw44_311356_c1 | nmdc:mga0yw44_311356_c1_134_1015 | 290 |
| 222 | 3300050496 | nmdc:mga07m45_14518_c1 | nmdc:mga07m45_14518_c1_2095_2976 | 290 |
| 223 | 3300050513 | nmdc:mga0rr50_141226_c1 | nmdc:mga0rr50_141226_c1_383_1270 | 290 |
| 224 | 3300061719 | Ga0466962_0022392 | Ga0466962_0022392_315_1223 | 290 |
| 225 | 3300025919 | Ga0207657_10080297 | Ga0207657_100802975 | 291 |
| 226 | 3300006846 | Ga0075430_100000447 | Ga0075430_1000004471 | 292 |
| 227 | 3300037466 | Ga0395898_0191714 | Ga0395898_0191714_245_1132 | 292 |
| 228 | 3300038443 | Ga0395901_0224895 | Ga0395901_0224895_429_1316 | 292 |
| 229 | 3300050507 | nmdc:mga05p37_787528_c1 | nmdc:mga05p37_787528_c1_115_1032 | 292 |
| 230 | 3300050509 | nmdc:mga0qj67_11224_c1 | nmdc:mga0qj67_11224_c1_5610_6497 | 292 |
| 231 | 3300045049 | Ga0466959_0127340 | Ga0466959_0127340_331_1221 | 293 |
| 232 | 3300003781 | Ga0055536_1001491 | Ga0055536_100149115 | 297 |
| 233 | 3300003791 | Ga0055530_10001248 | Ga0055530_1000124816 | 297 |
| 234 | 3300003792 | Ga0055540_1005912 | Ga0055540_10059125 | 297 |
| 235 | 3300003794 | Ga0055531_10009364 | Ga0055531_100093642 | 297 |
| 236 | 3300025292 | Ga0209676_1000122 | Ga0209676_100012299 | 297 |
| 237 | 3300025298 | Ga0209050_1000002 | Ga0209050_10000021670 | 297 |
| 238 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021440 | 297 |
| 239 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021581 | 297 |
| 240 | 3300031249 | Ga0265339_10007383 | Ga0265339_100073833 | 297 |
| 241 | 3300003374 | JGI25161J50226_1003843 | JGI25161J50226_10038434 | 298 |
| 242 | 3300003771 | Ga0055526_1008757 | Ga0055526_10087575 | 298 |
| 243 | 3300003773 | Ga0055537_1003336 | Ga0055537_10033362 | 298 |
| 244 | 3300003775 | Ga0055524_1006672 | Ga0055524_10066725 | 298 |
| 245 | 3300004625 | Ga0055543_1004991 | Ga0055543_10049913 | 298 |
| 246 | 3300006353 | Ga0075370_10025322 | Ga0075370_100253224 | 298 |
| 247 | 3300025208 | Ga0209436_101782 | Ga0209436_1017825 | 298 |
| 248 | 3300025245 | Ga0207425_1007215 | Ga0207425_10072152 | 298 |
| 249 | 3300025258 | Ga0209129_1003152 | Ga0209129_10031523 | 298 |
| 250 | 3300025263 | Ga0209565_1001616 | Ga0209565_10016165 | 298 |
| 251 | 3300025273 | Ga0209673_1000128 | Ga0209673_1000128140 | 298 |
| 252 | 3300025284 | Ga0209130_1002727 | Ga0209130_10027277 | 298 |
| 253 | 3300025291 | Ga0209675_1007353 | Ga0209675_10073532 | 298 |
| 254 | 3300025294 | Ga0209025_1011593 | Ga0209025_10115933 | 298 |
| 255 | 3300025295 | Ga0209564_1000360 | Ga0209564_100036070 | 298 |
| 256 | 3300025297 | Ga0209758_1015133 | Ga0209758_10151333 | 298 |
| 257 | 3300025299 | Ga0209256_1000063 | Ga0209256_1000063134 | 298 |
| 258 | 3300025302 | Ga0207426_1000028 | Ga0207426_1000028352 | 298 |
| 259 | 3300042435 | Ga0439434_0002102 | Ga0439434_0002102_1790_2710 | 300 |
| 260 | iso_pu_bacteria | 2885192300 | 2885192435 | 300 |
| 261 | 3300005578 | Ga0068854_100318303 | Ga0068854_1003183032 | 301 |
| 262 | 3300014326 | Ga0157380_10354837 | Ga0157380_103548372 | 301 |
| 263 | 3300025893 | Ga0207682_10026133 | Ga0207682_100261332 | 301 |
| 264 | 3300025908 | Ga0207643_10023982 | Ga0207643_100239822 | 301 |
| 265 | iso_pu_bacteria | 2599185214 | 2599623619 | 303 |
| 266 | iso_pu_bacteria | 2599185226 | 2599671762 | 303 |
| 267 | iso_pu_bacteria | 2599185227 | 2599681225 | 303 |
| 268 | iso_pu_bacteria | 2599185229 | 2599693372 | 303 |
| 269 | iso_pu_bacteria | 2643221683 | 2644468136 | 303 |
| 270 | iso_pu_bacteria | 2885198086 | 2885204420 | 303 |
| 271 | iso_pu_bacteria | 2885211737 | 2885218073 | 303 |
| 272 | iso_pu_bacteria | 2904541872 | 2904548124 | 303 |
| 273 | iso_pu_bacteria | 2928070936 | 2928071762 | 303 |
| 274 | iso_pu_bacteria | 2928084124 | 2928084289 | 303 |
| 275 | iso_pu_bacteria | 2929160207 | 2929163054 | 303 |
| 276 | iso_pu_bacteria | 2945909444 | 2945911564 | 303 |
| 277 | iso_pu_bacteria | 2945984333 | 2945986098 | 303 |
| 278 | 3300025918 | Ga0207662_10100450 | Ga0207662_101004502 | 304 |
| 279 | 3300041404 | Ga0439436_0002232 | Ga0439436_0002232_2033_2968 | 304 |
| 280 | 3300041407 | Ga0439447_011250 | Ga0439447_011250_498_1433 | 304 |
| 281 | 3300041411 | Ga0439466_0001685 | Ga0439466_0001685_5421_6356 | 304 |
| 282 | 3300041413 | Ga0439465_0000168 | Ga0439465_0000168_7652_8587 | 304 |
| 283 | 3300041997 | Ga0439431_0001575 | Ga0439431_0001575_3058_3993 | 304 |
| 284 | 3300041999 | Ga0439433_0000126 | Ga0439433_0000126_1301_2236 | 304 |
| 285 | 3300042002 | Ga0439442_001795 | Ga0439442_001795_10_945 | 304 |
| 286 | 3300042004 | Ga0439445_0000357 | Ga0439445_0000357_7130_8065 | 304 |
| 287 | 3300042006 | Ga0439432_000800 | Ga0439432_000800_2811_3746 | 304 |
| 288 | 3300042007 | Ga0439449_0004822 | Ga0439449_0004822_3996_4931 | 304 |
| 289 | 3300042010 | Ga0439452_001221 | Ga0439452_001221_3799_4734 | 304 |
| 290 | 3300042014 | Ga0439457_001416 | Ga0439457_001416_4425_5360 | 304 |
| 291 | 3300042015 | Ga0439462_0016850 | Ga0439462_0016850_319_1254 | 304 |
| 292 | 3300005329 | Ga0070683_100130673 | Ga0070683_1001306733 | 306 |
| 293 | 3300005344 | Ga0070661_100049907 | Ga0070661_1000499074 | 306 |
| 294 | 3300005535 | Ga0070684_100254132 | Ga0070684_1002541322 | 306 |
| 295 | 3300005614 | Ga0068856_100024311 | Ga0068856_1000243114 | 306 |
| 296 | 3300013100 | Ga0157373_10047343 | Ga0157373_100473434 | 306 |
| 297 | 3300013105 | Ga0157369_10016713 | Ga0157369_1001671311 | 306 |
| 298 | 3300025912 | Ga0207707_10094367 | Ga0207707_100943673 | 306 |
| 299 | 3300025920 | Ga0207649_10014381 | Ga0207649_100143812 | 306 |
| 300 | 3300025944 | Ga0207661_10310517 | Ga0207661_103105172 | 306 |
| 301 | 3300026041 | Ga0207639_10140573 | Ga0207639_101405732 | 306 |
| 302 | 3300026078 | Ga0207702_10296478 | Ga0207702_102964781 | 306 |
| 303 | iso_pu_bacteria | 2818991446 | 2819597175 | 306 |
| 304 | iso_pu_bacteria | 2831265667 | 2831266301 | 306 |
| 305 | iso_pu_bacteria | 2838054893 | 2838057587 | 306 |
| 306 | iso_pu_bacteria | 2899924645 | 2899924679 | 306 |
| 307 | iso_pu_bacteria | 2928037797 | 2928039194 | 306 |
| 308 | iso_pu_bacteria | 2928044640 | 2928045201 | 306 |
| 309 | iso_pu_bacteria | 2928051484 | 2928053006 | 306 |
| 310 | iso_pu_bacteria | 2928064002 | 2928064323 | 306 |
| 311 | 3300003187 | JGI25151J46595_10001227 | JGI25151J46595_1000122717 | 307 |
| 312 | 3300003187 | JGI25151J46595_10011114 | JGI25151J46595_100111144 | 307 |
| 313 | 3300003781 | Ga0055536_1000670 | Ga0055536_10006703 | 307 |
| 314 | 3300003792 | Ga0055540_1001683 | Ga0055540_10016835 | 307 |
| 315 | 3300005328 | Ga0070676_10003481 | Ga0070676_100034813 | 307 |
| 316 | 3300005328 | Ga0070676_10010313 | Ga0070676_100103133 | 307 |
| 317 | 3300005328 | Ga0070676_10025317 | Ga0070676_100253173 | 307 |
| 318 | 3300005328 | Ga0070676_10116437 | Ga0070676_101164371 | 307 |
| 319 | 3300005330 | Ga0070690_100006594 | Ga0070690_1000065945 | 307 |
| 320 | 3300005331 | Ga0070670_100002708 | Ga0070670_10000270811 | 307 |
| 321 | 3300005333 | Ga0070677_10007702 | Ga0070677_100077024 | 307 |
| 322 | 3300005333 | Ga0070677_10119918 | Ga0070677_101199182 | 307 |
| 323 | 3300005334 | Ga0068869_100005465 | Ga0068869_1000054654 | 307 |
| 324 | 3300005334 | Ga0068869_100045407 | Ga0068869_1000454073 | 307 |
| 325 | 3300005335 | Ga0070666_10007580 | Ga0070666_100075803 | 307 |
| 326 | 3300005335 | Ga0070666_10030719 | Ga0070666_100307192 | 307 |
| 327 | 3300005336 | Ga0070680_100015422 | Ga0070680_1000154229 | 307 |
| 328 | 3300005337 | Ga0070682_100283970 | Ga0070682_1002839701 | 307 |
| 329 | 3300005338 | Ga0068868_100002833 | Ga0068868_1000028332 | 307 |
| 330 | 3300005338 | Ga0068868_100071676 | Ga0068868_1000716762 | 307 |
| 331 | 3300005338 | Ga0068868_100095757 | Ga0068868_1000957572 | 307 |
| 332 | 3300005338 | Ga0068868_100312955 | Ga0068868_1003129551 | 307 |
| 333 | 3300005340 | Ga0070689_100039129 | Ga0070689_1000391292 | 307 |
| 334 | 3300005340 | Ga0070689_100176808 | Ga0070689_1001768082 | 307 |
| 335 | 3300005344 | Ga0070661_100049360 | Ga0070661_1000493603 | 307 |
| 336 | 3300005347 | Ga0070668_100002516 | Ga0070668_1000025165 | 307 |
| 337 | 3300005347 | Ga0070668_100078720 | Ga0070668_1000787201 | 307 |
| 338 | 3300005353 | Ga0070669_100034279 | Ga0070669_1000342792 | 307 |
| 339 | 3300005353 | Ga0070669_100054039 | Ga0070669_1000540393 | 307 |
| 340 | 3300005354 | Ga0070675_100004849 | Ga0070675_1000048492 | 307 |
| 341 | 3300005354 | Ga0070675_100012003 | Ga0070675_1000120033 | 307 |
| 342 | 3300005354 | Ga0070675_100020095 | Ga0070675_1000200954 | 307 |
| 343 | 3300005354 | Ga0070675_100028486 | Ga0070675_1000284864 | 307 |
| 344 | 3300005355 | Ga0070671_100000530 | Ga0070671_10000053015 | 307 |
| 345 | 3300005355 | Ga0070671_100019096 | Ga0070671_1000190964 | 307 |
| 346 | 3300005355 | Ga0070671_100045228 | Ga0070671_1000452284 | 307 |
| 347 | 3300005355 | Ga0070671_100091130 | Ga0070671_1000911302 | 307 |
| 348 | 3300005356 | Ga0070674_100003872 | Ga0070674_1000038722 | 307 |
| 349 | 3300005356 | Ga0070674_100166337 | Ga0070674_1001663371 | 307 |
| 350 | 3300005356 | Ga0070674_100243781 | Ga0070674_1002437812 | 307 |
| 351 | 3300005364 | Ga0070673_100026718 | Ga0070673_1000267182 | 307 |
| 352 | 3300005365 | Ga0070688_100135288 | Ga0070688_1001352882 | 307 |
| 353 | 3300005367 | Ga0070667_100020395 | Ga0070667_1000203953 | 307 |
| 354 | 3300005455 | Ga0070663_100115290 | Ga0070663_1001152902 | 307 |
| 355 | 3300005456 | Ga0070678_100019865 | Ga0070678_1000198653 | 307 |
| 356 | 3300005456 | Ga0070678_100027619 | Ga0070678_1000276191 | 307 |
| 357 | 3300005456 | Ga0070678_100076727 | Ga0070678_1000767272 | 307 |
| 358 | 3300005456 | Ga0070678_100180785 | Ga0070678_1001807852 | 307 |
| 359 | 3300005457 | Ga0070662_100010338 | Ga0070662_1000103384 | 307 |
| 360 | 3300005457 | Ga0070662_100071999 | Ga0070662_1000719993 | 307 |
| 361 | 3300005457 | Ga0070662_100076339 | Ga0070662_1000763391 | 307 |
| 362 | 3300005458 | Ga0070681_10043409 | Ga0070681_100434094 | 307 |
| 363 | 3300005459 | Ga0068867_100003229 | Ga0068867_1000032298 | 307 |
| 364 | 3300005459 | Ga0068867_100022478 | Ga0068867_1000224782 | 307 |
| 365 | 3300005459 | Ga0068867_100057412 | Ga0068867_1000574122 | 307 |
| 366 | 3300005459 | Ga0068867_100134125 | Ga0068867_1001341252 | 307 |
| 367 | 3300005539 | Ga0068853_100006453 | Ga0068853_1000064536 | 307 |
| 368 | 3300005543 | Ga0070672_100003316 | Ga0070672_1000033166 | 307 |
| 369 | 3300005543 | Ga0070672_100036024 | Ga0070672_1000360244 | 307 |
| 370 | 3300005544 | Ga0070686_100232709 | Ga0070686_1002327091 | 307 |
| 371 | 3300005548 | Ga0070665_100311598 | Ga0070665_1003115982 | 307 |
| 372 | 3300005577 | Ga0068857_100108772 | Ga0068857_1001087721 | 307 |
| 373 | 3300005578 | Ga0068854_100056458 | Ga0068854_1000564582 | 307 |
| 374 | 3300005578 | Ga0068854_100209536 | Ga0068854_1002095361 | 307 |
| 375 | 3300005615 | Ga0070702_100116456 | Ga0070702_1001164562 | 307 |
| 376 | 3300005616 | Ga0068852_100015916 | Ga0068852_1000159165 | 307 |
| 377 | 3300005616 | Ga0068852_100085186 | Ga0068852_1000851862 | 307 |
| 378 | 3300005616 | Ga0068852_100193068 | Ga0068852_1001930682 | 307 |
| 379 | 3300005617 | Ga0068859_100003584 | Ga0068859_1000035849 | 307 |
| 380 | 3300005618 | Ga0068864_100250749 | Ga0068864_1002507492 | 307 |
| 381 | 3300005618 | Ga0068864_100266262 | Ga0068864_1002662622 | 307 |
| 382 | 3300005718 | Ga0068866_10027317 | Ga0068866_100273172 | 307 |
| 383 | 3300005719 | Ga0068861_100017373 | Ga0068861_1000173733 | 307 |
| 384 | 3300005834 | Ga0068851_10028238 | Ga0068851_100282383 | 307 |
| 385 | 3300005834 | Ga0068851_10052516 | Ga0068851_100525162 | 307 |
| 386 | 3300005841 | Ga0068863_100002273 | Ga0068863_10000227314 | 307 |
| 387 | 3300005841 | Ga0068863_100237828 | Ga0068863_1002378282 | 307 |
| 388 | 3300005842 | Ga0068858_100002102 | Ga0068858_1000021024 | 307 |
| 389 | 3300005842 | Ga0068858_100034403 | Ga0068858_1000344034 | 307 |
| 390 | 3300005842 | Ga0068858_100035047 | Ga0068858_1000350472 | 307 |
| 391 | 3300005842 | Ga0068858_100046962 | Ga0068858_1000469622 | 307 |
| 392 | 3300005843 | Ga0068860_100007803 | Ga0068860_1000078037 | 307 |
| 393 | 3300005843 | Ga0068860_100009984 | Ga0068860_1000099846 | 307 |
| 394 | 3300005843 | Ga0068860_100052671 | Ga0068860_1000526712 | 307 |
| 395 | 3300005843 | Ga0068860_100151427 | Ga0068860_1001514272 | 307 |
| 396 | 3300005844 | Ga0068862_100045821 | Ga0068862_1000458212 | 307 |
| 397 | 3300005844 | Ga0068862_100108186 | Ga0068862_1001081862 | 307 |
| 398 | 3300005844 | Ga0068862_100448788 | Ga0068862_1004487882 | 307 |
| 399 | 3300006177 | Ga0075362_10004754 | Ga0075362_100047544 | 307 |
| 400 | 3300006237 | Ga0097621_100073590 | Ga0097621_1000735903 | 307 |
| 401 | 3300006237 | Ga0097621_100087007 | Ga0097621_1000870072 | 307 |
| 402 | 3300006353 | Ga0075370_10010827 | Ga0075370_100108272 | 307 |
| 403 | 3300006358 | Ga0068871_100018082 | Ga0068871_1000180822 | 307 |
| 404 | 3300006358 | Ga0068871_100221663 | Ga0068871_1002216632 | 307 |
| 405 | 3300006358 | Ga0068871_100301480 | Ga0068871_1003014802 | 307 |
| 406 | 3300006881 | Ga0068865_100008047 | Ga0068865_1000080473 | 307 |
| 407 | 3300006881 | Ga0068865_100099960 | Ga0068865_1000999602 | 307 |
| 408 | 3300006931 | Ga0097620_100003584 | Ga0097620_1000035849 | 307 |
| 409 | 3300009098 | Ga0105245_10346418 | Ga0105245_103464182 | 307 |
| 410 | 3300009148 | Ga0105243_10002282 | Ga0105243_1000228215 | 307 |
| 411 | 3300009148 | Ga0105243_10017318 | Ga0105243_100173183 | 307 |
| 412 | 3300009148 | Ga0105243_10321804 | Ga0105243_103218042 | 307 |
| 413 | 3300009174 | Ga0105241_10090870 | Ga0105241_100908702 | 307 |
| 414 | 3300009177 | Ga0105248_10020017 | Ga0105248_100200174 | 307 |
| 415 | 3300009177 | Ga0105248_10472930 | Ga0105248_104729301 | 307 |
| 416 | 3300009545 | Ga0105237_10432764 | Ga0105237_104327642 | 307 |
| 417 | 3300009551 | Ga0105238_10524415 | Ga0105238_105244151 | 307 |
| 418 | 3300009553 | Ga0105249_10013202 | Ga0105249_100132023 | 307 |
| 419 | 3300009553 | Ga0105249_10609062 | Ga0105249_106090622 | 307 |
| 420 | 3300011119 | Ga0105246_10125982 | Ga0105246_101259821 | 307 |
| 421 | 3300013102 | Ga0157371_10217466 | Ga0157371_102174662 | 307 |
| 422 | 3300013104 | Ga0157370_10019746 | Ga0157370_100197463 | 307 |
| 423 | 3300013104 | Ga0157370_10475861 | Ga0157370_104758611 | 307 |
| 424 | 3300013105 | Ga0157369_10002082 | Ga0157369_1000208220 | 307 |
| 425 | 3300013296 | Ga0157374_10041536 | Ga0157374_100415362 | 307 |
| 426 | 3300013296 | Ga0157374_10169426 | Ga0157374_101694262 | 307 |
| 427 | 3300013306 | Ga0163162_10278559 | Ga0163162_102785592 | 307 |
| 428 | 3300013306 | Ga0163162_10298191 | Ga0163162_102981912 | 307 |
| 429 | 3300013308 | Ga0157375_10011892 | Ga0157375_100118923 | 307 |
| 430 | 3300013308 | Ga0157375_10104814 | Ga0157375_101048143 | 307 |
| 431 | 3300013308 | Ga0157375_10139104 | Ga0157375_101391043 | 307 |
| 432 | 3300014325 | Ga0163163_10002764 | Ga0163163_100027643 | 307 |
| 433 | 3300014326 | Ga0157380_10197827 | Ga0157380_101978272 | 307 |
| 434 | 3300014497 | Ga0182008_10010913 | Ga0182008_100109133 | 307 |
| 435 | 3300014745 | Ga0157377_10223409 | Ga0157377_102234091 | 307 |
| 436 | 3300014968 | Ga0157379_10000632 | Ga0157379_100006327 | 307 |
| 437 | 3300014968 | Ga0157379_10016152 | Ga0157379_100161522 | 307 |
| 438 | 3300014968 | Ga0157379_10022399 | Ga0157379_100223993 | 307 |
| 439 | 3300014968 | Ga0157379_10049410 | Ga0157379_100494104 | 307 |
| 440 | 3300014969 | Ga0157376_10037068 | Ga0157376_100370684 | 307 |
| 441 | 3300014969 | Ga0157376_10432903 | Ga0157376_104329032 | 307 |
| 442 | 3300017792 | Ga0163161_10000092 | Ga0163161_1000009237 | 307 |
| 443 | 3300017792 | Ga0163161_10025313 | Ga0163161_100253132 | 307 |
| 444 | 3300017792 | Ga0163161_10068971 | Ga0163161_100689712 | 307 |
| 445 | 3300025258 | Ga0209129_1003474 | Ga0209129_10034742 | 307 |
| 446 | 3300025291 | Ga0209675_1006447 | Ga0209675_10064473 | 307 |
| 447 | 3300025292 | Ga0209676_1000301 | Ga0209676_100030175 | 307 |
| 448 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073167 | 307 |
| 449 | 3300025294 | Ga0209025_1000248 | Ga0209025_1000248108 | 307 |
| 450 | 3300025298 | Ga0209050_1012636 | Ga0209050_10126363 | 307 |
| 451 | 3300025303 | Ga0209051_1000541 | Ga0209051_100054120 | 307 |
| 452 | 3300025304 | Ga0209257_1007991 | Ga0209257_10079912 | 307 |
| 453 | 3300025893 | Ga0207682_10006348 | Ga0207682_100063482 | 307 |
| 454 | 3300025899 | Ga0207642_10033539 | Ga0207642_100335392 | 307 |
| 455 | 3300025901 | Ga0207688_10008823 | Ga0207688_100088234 | 307 |
| 456 | 3300025903 | Ga0207680_10009114 | Ga0207680_100091142 | 307 |
| 457 | 3300025903 | Ga0207680_10052435 | Ga0207680_100524353 | 307 |
| 458 | 3300025905 | Ga0207685_10073673 | Ga0207685_100736732 | 307 |
| 459 | 3300025907 | Ga0207645_10008037 | Ga0207645_100080373 | 307 |
| 460 | 3300025907 | Ga0207645_10010765 | Ga0207645_100107652 | 307 |
| 461 | 3300025907 | Ga0207645_10020197 | Ga0207645_100201974 | 307 |
| 462 | 3300025907 | Ga0207645_10035730 | Ga0207645_100357302 | 307 |
| 463 | 3300025907 | Ga0207645_10101313 | Ga0207645_101013132 | 307 |
| 464 | 3300025909 | Ga0207705_10166050 | Ga0207705_101660502 | 307 |
| 465 | 3300025917 | Ga0207660_10021106 | Ga0207660_100211063 | 307 |
| 466 | 3300025918 | Ga0207662_10061311 | Ga0207662_100613112 | 307 |
| 467 | 3300025919 | Ga0207657_10029882 | Ga0207657_100298824 | 307 |
| 468 | 3300025919 | Ga0207657_10116342 | Ga0207657_101163422 | 307 |
| 469 | 3300025921 | Ga0207652_10016058 | Ga0207652_100160583 | 307 |
| 470 | 3300025923 | Ga0207681_10004767 | Ga0207681_100047677 | 307 |
| 471 | 3300025925 | Ga0207650_10001000 | Ga0207650_1000100020 | 307 |
| 472 | 3300025925 | Ga0207650_10242427 | Ga0207650_102424271 | 307 |
| 473 | 3300025926 | Ga0207659_10001048 | Ga0207659_100010488 | 307 |
| 474 | 3300025926 | Ga0207659_10013986 | Ga0207659_100139862 | 307 |
| 475 | 3300025926 | Ga0207659_10179240 | Ga0207659_101792402 | 307 |
| 476 | 3300025926 | Ga0207659_10201677 | Ga0207659_102016771 | 307 |
| 477 | 3300025927 | Ga0207687_10124244 | Ga0207687_101242442 | 307 |
| 478 | 3300025931 | Ga0207644_10029760 | Ga0207644_100297602 | 307 |
| 479 | 3300025931 | Ga0207644_10051632 | Ga0207644_100516321 | 307 |
| 480 | 3300025931 | Ga0207644_10069994 | Ga0207644_100699942 | 307 |
| 481 | 3300025931 | Ga0207644_10140871 | Ga0207644_101408712 | 307 |
| 482 | 3300025932 | Ga0207690_10056869 | Ga0207690_100568693 | 307 |
| 483 | 3300025933 | Ga0207706_10006805 | Ga0207706_100068052 | 307 |
| 484 | 3300025933 | Ga0207706_10063411 | Ga0207706_100634112 | 307 |
| 485 | 3300025934 | Ga0207686_10244319 | Ga0207686_102443191 | 307 |
| 486 | 3300025935 | Ga0207709_10000467 | Ga0207709_1000046723 | 307 |
| 487 | 3300025935 | Ga0207709_10030408 | Ga0207709_100304083 | 307 |
| 488 | 3300025936 | Ga0207670_10050995 | Ga0207670_100509952 | 307 |
| 489 | 3300025936 | Ga0207670_10105529 | Ga0207670_101055292 | 307 |
| 490 | 3300025937 | Ga0207669_10324598 | Ga0207669_103245982 | 307 |
| 491 | 3300025938 | Ga0207704_10131606 | Ga0207704_101316062 | 307 |
| 492 | 3300025940 | Ga0207691_10001568 | Ga0207691_1000156818 | 307 |
| 493 | 3300025940 | Ga0207691_10003901 | Ga0207691_100039016 | 307 |
| 494 | 3300025940 | Ga0207691_10010473 | Ga0207691_100104734 | 307 |
| 495 | 3300025940 | Ga0207691_10021378 | Ga0207691_100213784 | 307 |
| 496 | 3300025940 | Ga0207691_10032483 | Ga0207691_100324835 | 307 |
| 497 | 3300025940 | Ga0207691_10241385 | Ga0207691_102413852 | 307 |
| 498 | 3300025942 | Ga0207689_10001729 | Ga0207689_1000172929 | 307 |
| 499 | 3300025942 | Ga0207689_10083637 | Ga0207689_100836372 | 307 |
| 500 | 3300025949 | Ga0207667_10022513 | Ga0207667_100225134 | 307 |
| 501 | 3300025949 | Ga0207667_10365390 | Ga0207667_103653901 | 307 |
| 502 | 3300025960 | Ga0207651_10001581 | Ga0207651_100015817 | 307 |
| 503 | 3300025960 | Ga0207651_10039672 | Ga0207651_100396723 | 307 |
| 504 | 3300025961 | Ga0207712_10004089 | Ga0207712_100040893 | 307 |
| 505 | 3300025972 | Ga0207668_10136427 | Ga0207668_101364271 | 307 |
| 506 | 3300025972 | Ga0207668_10277727 | Ga0207668_102777272 | 307 |
| 507 | 3300025986 | Ga0207658_10007808 | Ga0207658_100078083 | 307 |
| 508 | 3300025986 | Ga0207658_10009704 | Ga0207658_100097042 | 307 |
| 509 | 3300025986 | Ga0207658_10121953 | Ga0207658_101219532 | 307 |
| 510 | 3300026023 | Ga0207677_10010787 | Ga0207677_100107873 | 307 |
| 511 | 3300026023 | Ga0207677_10389108 | Ga0207677_103891082 | 307 |
| 512 | 3300026023 | Ga0207677_10395500 | Ga0207677_103955002 | 307 |
| 513 | 3300026035 | Ga0207703_10004561 | Ga0207703_100045619 | 307 |
| 514 | 3300026035 | Ga0207703_10005803 | Ga0207703_100058033 | 307 |
| 515 | 3300026035 | Ga0207703_10021193 | Ga0207703_100211933 | 307 |
| 516 | 3300026035 | Ga0207703_10060645 | Ga0207703_100606455 | 307 |
| 517 | 3300026041 | Ga0207639_10024775 | Ga0207639_100247752 | 307 |
| 518 | 3300026088 | Ga0207641_10006097 | Ga0207641_100060973 | 307 |
| 519 | 3300026088 | Ga0207641_10134804 | Ga0207641_101348042 | 307 |
| 520 | 3300026089 | Ga0207648_10016997 | Ga0207648_100169973 | 307 |
| 521 | 3300026089 | Ga0207648_10047268 | Ga0207648_100472684 | 307 |
| 522 | 3300026089 | Ga0207648_10322513 | Ga0207648_103225132 | 307 |
| 523 | 3300026095 | Ga0207676_10003710 | Ga0207676_100037104 | 307 |
| 524 | 3300026095 | Ga0207676_10101835 | Ga0207676_101018352 | 307 |
| 525 | 3300026095 | Ga0207676_10193792 | Ga0207676_101937922 | 307 |
| 526 | 3300026116 | Ga0207674_10086723 | Ga0207674_100867231 | 307 |
| 527 | 3300026118 | Ga0207675_100000267 | Ga0207675_10000026720 | 307 |
| 528 | 3300026118 | Ga0207675_100004220 | Ga0207675_1000042209 | 307 |
| 529 | 3300026121 | Ga0207683_10010011 | Ga0207683_100100112 | 307 |
| 530 | 3300026121 | Ga0207683_10024674 | Ga0207683_100246743 | 307 |
| 531 | 3300026142 | Ga0207698_10025696 | Ga0207698_100256962 | 307 |
| 532 | 3300026142 | Ga0207698_10067865 | Ga0207698_100678652 | 307 |
| 533 | 3300026142 | Ga0207698_10084910 | Ga0207698_100849102 | 307 |
| 534 | 3300028380 | Ga0268265_10064051 | Ga0268265_100640512 | 307 |
| 535 | 3300028381 | Ga0268264_10011894 | Ga0268264_100118944 | 307 |
| 536 | 3300028381 | Ga0268264_10029646 | Ga0268264_100296463 | 307 |
| 537 | 3300028381 | Ga0268264_10049503 | Ga0268264_100495034 | 307 |
| 538 | 3300028381 | Ga0268264_10077404 | Ga0268264_100774042 | 307 |
| 539 | 3300031548 | Ga0307408_100019166 | Ga0307408_1000191662 | 307 |
| 540 | 3300031548 | Ga0307408_100151922 | Ga0307408_1001519222 | 307 |
| 541 | 3300031731 | Ga0307405_10001548 | Ga0307405_100015485 | 307 |
| 542 | 3300031731 | Ga0307405_10016399 | Ga0307405_100163993 | 307 |
| 543 | 3300031731 | Ga0307405_10030887 | Ga0307405_100308872 | 307 |
| 544 | 3300031901 | Ga0307406_10006772 | Ga0307406_100067722 | 307 |
| 545 | 3300031901 | Ga0307406_10011607 | Ga0307406_100116072 | 307 |
| 546 | 3300031903 | Ga0307407_10058052 | Ga0307407_100580521 | 307 |
| 547 | 3300031911 | Ga0307412_10004436 | Ga0307412_100044362 | 307 |
| 548 | 3300032002 | Ga0307416_100015973 | Ga0307416_1000159735 | 307 |
| 549 | 3300032002 | Ga0307416_100025154 | Ga0307416_1000251542 | 307 |
| 550 | 3300032126 | Ga0307415_100088614 | Ga0307415_1000886142 | 307 |
| 551 | 3300035089 | Ga0373944_0029210 | Ga0373944_0029210_584_1516 | 307 |
| 552 | 3300035092 | Ga0373952_0018043 | Ga0373952_0018043_483_1415 | 307 |
| 553 | 3300035118 | Ga0373954_0112820 | Ga0373954_0112820_369_1301 | 307 |
| 554 | 3300035121 | Ga0373960_0048206 | Ga0373960_0048206_53_985 | 307 |
| 555 | 3300035171 | Ga0373946_0138848 | Ga0373946_0138848_169_1101 | 307 |
| 556 | 3300035691 | Ga0373931_0011667 | Ga0373931_0011667_2584_3516 | 307 |
| 557 | 3300037068 | Ga0373925_0029026 | Ga0373925_0029026_2466_3398 | 307 |
| 558 | 3300037068 | Ga0373925_0041133 | Ga0373925_0041133_483_1415 | 307 |
| 559 | 3300042007 | Ga0439449_0005452 | Ga0439449_0005452_1142_2086 | 307 |
| 560 | 3300044901 | Ga0466960_0017758 | Ga0466960_0017758_796_1740 | 307 |
| 561 | 3300045051 | Ga0451576_0222141 | Ga0451576_0222141_42_974 | 307 |
| 562 | 3300046453 | Ga0495627_012887 | Ga0495627_012887_1535_2479 | 307 |
| 563 | 3300046460 | Ga0495638_0004803 | Ga0495638_0004803_4538_5461 | 307 |
| 564 | 3300046513 | Ga0495616_0010436 | Ga0495616_0010436_3208_4131 | 307 |
| 565 | 3300046515 | Ga0495620_0016240 | Ga0495620_0016240_1250_2194 | 307 |
| 566 | 3300046518 | Ga0495631_0002314 | Ga0495631_0002314_6358_7281 | 307 |
| 567 | 3300046520 | Ga0495637_0020297 | Ga0495637_0020297_824_1747 | 307 |
| 568 | 3300046543 | Ga0495645_0117420 | Ga0495645_0117420_899_1831 | 307 |
| 569 | 3300046543 | Ga0495645_0121745 | Ga0495645_0121745_207_1139 | 307 |
| 570 | 3300046558 | Ga0495633_0046232 | Ga0495633_0046232_444_1376 | 307 |
| 571 | 3300046616 | Ga0495668_0053320 | Ga0495668_0053320_40_984 | 307 |
| 572 | 3300046660 | Ga0495625_0007255 | Ga0495625_0007255_8374_9297 | 307 |
| 573 | 3300046681 | Ga0495647_0085558 | Ga0495647_0085558_192_1124 | 307 |
| 574 | 3300046683 | Ga0495658_0030507 | Ga0495658_0030507_1043_1975 | 307 |
| 575 | 3300046683 | Ga0495658_0188615 | Ga0495658_0188615_151_1083 | 307 |
| 576 | 3300046692 | Ga0495671_0006863 | Ga0495671_0006863_1652_2596 | 307 |
| 577 | 3300048903 | Ga0496100_0021838 | Ga0496100_0021838_1000_1932 | 307 |
| 578 | 3300048905 | Ga0496102_0072865 | Ga0496102_0072865_508_1440 | 307 |
| 579 | 3300048907 | Ga0496104_0143768 | Ga0496104_0143768_1219_2151 | 307 |
| 580 | 3300048908 | Ga0496105_0204956 | Ga0496105_0204956_159_1091 | 307 |
| 581 | 3300048909 | Ga0496106_0178465 | Ga0496106_0178465_225_1157 | 307 |
| 582 | 3300048910 | Ga0496107_0007111 | Ga0496107_0007111_5720_6652 | 307 |
| 583 | 3300048911 | Ga0496108_0168300 | Ga0496108_0168300_738_1670 | 307 |
| 584 | 3300048911 | Ga0496108_0186215 | Ga0496108_0186215_614_1546 | 307 |
| 585 | 3300048912 | Ga0496109_0556093 | Ga0496109_0556093_32_964 | 307 |
| 586 | 3300048914 | Ga0496111_0281641 | Ga0496111_0281641_248_1180 | 307 |
| 587 | 3300048917 | Ga0496114_0060927 | Ga0496114_0060927_1799_2731 | 307 |
| 588 | 3300048917 | Ga0496114_0071290 | Ga0496114_0071290_1687_2619 | 307 |
| 589 | 3300048919 | Ga0496116_0085384 | Ga0496116_0085384_244_1188 | 307 |
| 590 | 3300048920 | Ga0496117_0009933 | Ga0496117_0009933_3023_3967 | 307 |
| 591 | 3300048924 | Ga0496121_0088726 | Ga0496121_0088726_998_1921 | 307 |
| 592 | 3300048924 | Ga0496121_0106814 | Ga0496121_0106814_225_1148 | 307 |
| 593 | 3300050489 | nmdc:mga03683_2335_c1 | nmdc:mga03683_2335_c1_1551_2498 | 307 |
| 594 | 3300053077 | Ga0495601_0059381 | Ga0495601_0059381_227_1159 | 307 |
| 595 | 3300053079 | Ga0500610_0007456 | Ga0500610_0007456_1602_2546 | 307 |
| 596 | 3300053079 | Ga0500610_0021950 | Ga0500610_0021950_329_1273 | 307 |
| 597 | 3300053108 | Ga0500562_009817 | Ga0500562_009817_818_1741 | 307 |
| 598 | 3300053117 | Ga0500593_001561 | Ga0500593_001561_3228_4172 | 307 |
| 599 | 3300053118 | Ga0500594_0001099 | Ga0500594_0001099_2078_3001 | 307 |
| 600 | 3300053121 | Ga0500607_004625 | Ga0500607_004625_6528_7472 | 307 |
| 601 | 3300053121 | Ga0500607_051948 | Ga0500607_051948_1150_2163 | 307 |
| 602 | 3300053134 | Ga0500658_0000986 | Ga0500658_0000986_6712_7635 | 307 |
| 603 | 3300053136 | Ga0500559_0012541 | Ga0500559_0012541_2007_2930 | 307 |
| 604 | 3300053139 | Ga0500568_0004310 | Ga0500568_0004310_3641_4564 | 307 |
| 605 | 3300053153 | Ga0500616_0032665 | Ga0500616_0032665_51_974 | 307 |
| 606 | 3300053158 | Ga0500627_0001689 | Ga0500627_0001689_1861_2805 | 307 |
| 607 | 3300053161 | Ga0500634_0014262 | Ga0500634_0014262_1075_2019 | 307 |
| 608 | 3300001979 | JGI24740J21852_10047029 | JGI24740J21852_100470292 | 310 |
| 609 | 3300002773 | JGI25152J39213_1002976 | JGI25152J39213_10029767 | 310 |
| 610 | 3300002774 | JGI25150J39212_1001199 | JGI25150J39212_10011995 | 310 |
| 611 | 3300002987 | JGI25159J45721_1004050 | JGI25159J45721_10040502 | 310 |
| 612 | 3300003187 | JGI25151J46595_10006242 | JGI25151J46595_100062427 | 310 |
| 613 | 3300003215 | JGI25153J46596_10005241 | JGI25153J46596_100052418 | 310 |
| 614 | 3300003354 | JGI25160J50197_1005994 | JGI25160J50197_10059945 | 310 |
| 615 | 3300003374 | JGI25161J50226_1002303 | JGI25161J50226_10023032 | 310 |
| 616 | 3300003761 | Ga0055535_1002054 | Ga0055535_10020546 | 310 |
| 617 | 3300003762 | Ga0055542_1000039 | Ga0055542_100003935 | 310 |
| 618 | 3300003771 | Ga0055526_1008769 | Ga0055526_10087695 | 310 |
| 619 | 3300003773 | Ga0055537_1003324 | Ga0055537_10033245 | 310 |
| 620 | 3300003775 | Ga0055524_1006686 | Ga0055524_10066865 | 310 |
| 621 | 3300003784 | Ga0055534_1003471 | Ga0055534_10034712 | 310 |
| 622 | 3300003790 | Ga0055528_1007145 | Ga0055528_10071455 | 310 |
| 623 | 3300003792 | Ga0055540_1011347 | Ga0055540_10113472 | 310 |
| 624 | 3300003794 | Ga0055531_10037724 | Ga0055531_100377242 | 310 |
| 625 | 3300004625 | Ga0055543_1002488 | Ga0055543_10024887 | 310 |
| 626 | 3300005262 | Ga0065165_1006562 | Ga0065165_10065622 | 310 |
| 627 | 3300009093 | Ga0105240_10470388 | Ga0105240_104703882 | 310 |
| 628 | 3300013104 | Ga0157370_10296440 | Ga0157370_102964402 | 310 |
| 629 | 3300025208 | Ga0209436_102759 | Ga0209436_1027595 | 310 |
| 630 | 3300025228 | Ga0209672_100930 | Ga0209672_10093015 | 310 |
| 631 | 3300025229 | Ga0209147_101551 | Ga0209147_1015515 | 310 |
| 632 | 3300025242 | Ga0209258_100099 | Ga0209258_100099178 | 310 |
| 633 | 3300025245 | Ga0207425_1000365 | Ga0207425_100036527 | 310 |
| 634 | 3300025254 | Ga0209148_1000103 | Ga0209148_1000103178 | 310 |
| 635 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007418 | 310 |
| 636 | 3300025258 | Ga0209129_1002036 | Ga0209129_10020366 | 310 |
| 637 | 3300025263 | Ga0209565_1000199 | Ga0209565_100019955 | 310 |
| 638 | 3300025273 | Ga0209673_1000304 | Ga0209673_100030424 | 310 |
| 639 | 3300025284 | Ga0209130_1000321 | Ga0209130_100032139 | 310 |
| 640 | 3300025291 | Ga0209675_1000298 | Ga0209675_100029825 | 310 |
| 641 | 3300025294 | Ga0209025_1001298 | Ga0209025_100129810 | 310 |
| 642 | 3300025295 | Ga0209564_1000603 | Ga0209564_100060339 | 310 |
| 643 | 3300025297 | Ga0209758_1000025 | Ga0209758_1000025108 | 310 |
| 644 | 3300025299 | Ga0209256_1000050 | Ga0209256_1000050174 | 310 |
| 645 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001529 | 310 |
| 646 | 3300025304 | Ga0209257_1004309 | Ga0209257_10043096 | 310 |
| 647 | 3300025981 | Ga0207640_10147026 | Ga0207640_101470262 | 310 |
| 648 | 3300026041 | Ga0207639_10018046 | Ga0207639_100180465 | 310 |
| 649 | 3300048920 | Ga0496117_0188537 | Ga0496117_0188537_44_976 | 310 |
| 650 | 3300048921 | Ga0496118_0142612 | Ga0496118_0142612_202_1134 | 310 |
| 651 | 3300048926 | Ga0496123_0147016 | Ga0496123_0147016_77_1009 | 310 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3njd-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase from mycobacterium smegmatis | 0.9298 | 3 | 285 |
| 3njb-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase from mycobacterium smegmatis, iodide soak | 0.9291 | 3 | 285 |
| 3t3w-assembly1.cif.gz_B | crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile | 0.9273 | 6 | 259 |
| 3ome-assembly1.cif.gz_E | crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis | 0.9269 | 4 | 259 |
| 4k29-assembly1.cif.gz_A | crystal structure of an enoyl-coa hydratase/isomerase from xanthobacter autotrophicus py2 | 0.9226 | 3 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07179_3_289_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9333 | 1 | 285 | 3.90.226.10 |
| 3njdB00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9298 | 3 | 285 | 3.90.226.10 |
| 3omeC00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9262 | 2 | 259 | 3.90.226.10 |
| 5z7rC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9072 | 2 | 223 | 3.90.226.10 |
| 5z7rC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9029 | 2 | 223 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V3WGM1-F1-model_v4 | Enoyl-CoA hydratase | 0.9855 | 101 | 285 |
GO:0006631
|
| AF-A0A7C7PEJ1-F1-model_v4 | Enoyl-CoA hydratase | 0.9815 | 143 | 285 |
|
| AF-A0A814XMD0-F1-model_v4 | Enoyl-CoA hydratase | 0.9779 | 3 | 286 |
|
| AF-A0A368E8Z7-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9768 | 4 | 286 |
GO:0004300
|
| AF-A0A651GWD9-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9744 | 4 | 275 |
GO:0004300
GO:0006631 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar