F472576

General Info

Members Datasets Scaffolds Average Seq Length
651 380 621 301

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100024607|Ga0068868_1000246074
Length 313
Sequence VLAGSQSRRVDRTVNCVAAERGGGTRDDGRMTTFATLTYEVRDAKAYVTLNRPDRLNAIDDVMPGEIRTAVEQANADDAVRVIVVQGSGRAFCAGYDLKRFAEGDAGDRWRQPSGLAWDPVRDYREMRRNTDDFFTLWRSLKPTIAKVHGHAVAGGSDIALSCDLLVIADDARIGYPPARVWGCPTTAMWVYRLGAERAKRMLLTGDTIDGATACAWGLAVESVPAGELDVAVERLADRIAGVPINQLVMQKLLINQAYDNMGLQGTQLLATLFDGIARHSPEGNWFKELAESQGFHAAVEWRDSGRPIPDGI

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221683 Variovorax sp. Root473 Isolate Unclassified
7 2818991446 Variovorax sp. 1180 Isolate Unclassified
8 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
9 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
10 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
11 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
12 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
13 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
14 2885198086 Variovorax sp. 679 Isolate Unclassified
15 2885211737 Variovorax sp. 553 Isolate Unclassified
16 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
17 2899924645 Variovorax sp. 369 Isolate Unclassified
18 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
19 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
20 2922554459 Rhodococcus sp. 66b Isolate Unclassified
21 2928037797 Variovorax sp. 1126 Isolate Unclassified
22 2928044640 Variovorax sp. 1128 Isolate Unclassified
23 2928051484 Variovorax sp. 1133 Isolate Unclassified
24 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
25 2928070936 Variovorax gossypii 1167 Isolate Unclassified
26 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
27 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
28 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
29 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
30 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
65 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
77 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
78 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
79 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
83 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
227 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
228 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
229 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
235 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
236 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
245 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
264 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
265 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
266 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
267 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
268 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
269 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
270 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
271 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
275 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
276 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
277 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
283 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
284 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
285 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
295 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
360 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
361 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
364 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
372 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
373 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
374 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
375 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
376 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.93
Metatranscriptomes 0.46
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.67
Nodule 0.31
Rhizoplane 3.23
Rhizosphere 76.19
Stem 0
Stem Tuber 0.15
Unclassified 4.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10047029 3300001979 Bacteria 1262
2 JGI24737J22298_10018106 3300001990 Bacteria 2262
3 JGI25152J39213_1002976 3300002773 Bacteria 6022
4 JGI25150J39212_1001199 3300002774 Bacteria 7683
5 JGI25159J45721_1004050 3300002987 Bacteria 4981
6 JGI25151J46595_10001227 3300003187 Bacteria 18335
7 JGI25151J46595_10006242 3300003187 Bacteria 6022
8 JGI25151J46595_10011114 3300003187 Bacteria 4150
9 JGI25153J46596_10004165 3300003215 Bacteria 7853
10 JGI25153J46596_10005241 3300003215 Bacteria 6821
11 JGI25160J50197_1005994 3300003354 Bacteria 4981
12 JGI25161J50226_1002303 3300003374 Bacteria 4977
13 JGI25161J50226_1003843 3300003374 Bacteria 3300
14 Ga0055535_1002054 3300003761 Bacteria 8096
15 Ga0055542_1000039 3300003762 Bacteria 215126
16 Ga0055526_1008757 3300003771 Bacteria 4987
17 Ga0055526_1008769 3300003771 Bacteria 4981
18 Ga0055537_1003324 3300003773 Bacteria 4981
19 Ga0055537_1003336 3300003773 Bacteria 4967
20 Ga0055524_1006672 3300003775 Bacteria 4987
21 Ga0055524_1006686 3300003775 Bacteria 4981
22 Ga0055536_1000670 3300003781 Bacteria 23038
23 Ga0055536_1001491 3300003781 Bacteria 14069
24 Ga0055534_1003471 3300003784 Bacteria 4944
25 Ga0055528_1007145 3300003790 Bacteria 4981
26 Ga0055530_10001248 3300003791 Bacteria 19381
27 Ga0055540_1001683 3300003792 Bacteria 12753
28 Ga0055540_1005912 3300003792 Bacteria 4996
29 Ga0055540_1011347 3300003792 Bacteria 2881
30 Ga0055531_10009364 3300003794 Bacteria 5013
31 Ga0055531_10037724 3300003794 Bacteria 1464
32 Ga0055543_1002488 3300004625 Bacteria 6060
33 Ga0055543_1004991 3300004625 Bacteria 3474
34 Ga0065165_1006562 3300005262 Bacteria 6060
35 Ga0070676_10003481 3300005328 Bacteria 8208
36 Ga0070676_10010313 3300005328 Bacteria 5067
37 Ga0070676_10025317 3300005328 Bacteria 3353
38 Ga0070676_10116437 3300005328 Bacteria 1671
39 Ga0070683_100047257 3300005329 Bacteria 3977
40 Ga0070683_100130673 3300005329 Bacteria 2376
41 Ga0070683_100277773 3300005329 Bacteria 1593
42 Ga0070690_100006594 3300005330 Bacteria 6597
43 Ga0070670_100002708 3300005331 Bacteria 14639
44 Ga0070677_10007702 3300005333 Bacteria 3605
45 Ga0070677_10119918 3300005333 Bacteria 1186
46 Ga0068869_100005465 3300005334 Bacteria 7996
47 Ga0068869_100045407 3300005334 Bacteria 3163
48 Ga0070666_10007580 3300005335 Bacteria 6696
49 Ga0070666_10030719 3300005335 Bacteria 3541
50 Ga0070680_100000009 3300005336 Bacteria 98360
51 Ga0070680_100015422 3300005336 Bacteria 5990
52 Ga0070680_100022322 3300005336 Bacteria 5040
53 Ga0070680_100092404 3300005336 Bacteria 2506
54 Ga0070682_100283970 3300005337 Bacteria 1208
55 Ga0068868_100002833 3300005338 Bacteria 12010
56 Ga0068868_100024607 3300005338 Bacteria 4571
57 Ga0068868_100071676 3300005338 Bacteria 2763
58 Ga0068868_100095757 3300005338 Bacteria 2396
59 Ga0068868_100312955 3300005338 Bacteria 1336
60 Ga0070660_100072749 3300005339 Bacteria 2687
61 Ga0070689_100039129 3300005340 Bacteria 3630
62 Ga0070689_100176808 3300005340 Bacteria 1732
63 Ga0070661_100049360 3300005344 Bacteria 3080
64 Ga0070661_100049907 3300005344 Bacteria 3063
65 Ga0070668_100002516 3300005347 Bacteria 13492
66 Ga0070668_100078720 3300005347 Bacteria 2579
67 Ga0070669_100034279 3300005353 Bacteria 3675
68 Ga0070669_100054039 3300005353 Bacteria 2941
69 Ga0070675_100004849 3300005354 Bacteria 10264
70 Ga0070675_100012003 3300005354 Bacteria 6791
71 Ga0070675_100020095 3300005354 Bacteria 5327
72 Ga0070675_100028486 3300005354 Bacteria 4495
73 Ga0070671_100000530 3300005355 Bacteria 26763
74 Ga0070671_100019096 3300005355 Bacteria 5574
75 Ga0070671_100045228 3300005355 Bacteria 3660
76 Ga0070671_100091130 3300005355 Bacteria 2553
77 Ga0070674_100003872 3300005356 Bacteria 8470
78 Ga0070674_100166337 3300005356 Bacteria 1678
79 Ga0070674_100243781 3300005356 Bacteria 1408
80 Ga0070673_100026718 3300005364 Bacteria 4268
81 Ga0070688_100135288 3300005365 Bacteria 1668
82 Ga0070659_100000066 3300005366 Bacteria 82349
83 Ga0070659_100029864 3300005366 Bacteria 4215
84 Ga0070667_100020395 3300005367 Bacteria 5502
85 Ga0070667_100386551 3300005367 Bacteria 1272
86 Ga0070667_100599019 3300005367 Bacteria 1015
87 Ga0070705_100028816 3300005440 Bacteria 3045
88 Ga0070694_100034823 3300005444 Bacteria 3324
89 Ga0070708_100166281 3300005445 Bacteria 2058
90 Ga0070663_100000535 3300005455 Bacteria 20127
91 Ga0070663_100115290 3300005455 Bacteria 2024
92 Ga0070678_100019865 3300005456 Bacteria 4393
93 Ga0070678_100027619 3300005456 Bacteria 3856
94 Ga0070678_100076727 3300005456 Bacteria 2518
95 Ga0070678_100180785 3300005456 Bacteria 1726
96 Ga0070662_100010338 3300005457 Bacteria 6119
97 Ga0070662_100071999 3300005457 Bacteria 2551
98 Ga0070662_100076339 3300005457 Bacteria 2483
99 Ga0070681_10000031 3300005458 Bacteria 102366
100 Ga0070681_10043409 3300005458 Bacteria 4505
101 Ga0070681_10078643 3300005458 Bacteria 3255
102 Ga0068867_100003229 3300005459 Bacteria 11492
103 Ga0068867_100022478 3300005459 Bacteria 4510
104 Ga0068867_100057412 3300005459 Bacteria 2883
105 Ga0068867_100134125 3300005459 Bacteria 1928
106 Ga0070706_100453917 3300005467 Bacteria 1193
107 Ga0070679_100000136 3300005530 Bacteria 59466
108 Ga0070679_100015728 3300005530 Bacteria 7277
109 Ga0070679_100096870 3300005530 Bacteria 2938
110 Ga0070679_100146798 3300005530 Bacteria 2336
111 Ga0070684_100106530 3300005535 Bacteria 2510
112 Ga0070684_100254132 3300005535 Bacteria 1606
113 Ga0068853_100006453 3300005539 Bacteria 9326
114 Ga0070672_100003316 3300005543 Bacteria 10423
115 Ga0070672_100036024 3300005543 Bacteria 3766
116 Ga0070686_100232709 3300005544 Bacteria 1338
117 Ga0070695_100007952 3300005545 Bacteria 6280
118 Ga0070696_100085924 3300005546 Bacteria 2233
119 Ga0070665_100311598 3300005548 Bacteria 1578
120 Ga0070665_100338893 3300005548 Bacteria 1508
121 Ga0070704_100017973 3300005549 Bacteria 4510
122 Ga0070704_100074742 3300005549 Bacteria 2473
123 Ga0068857_100108772 3300005577 Bacteria 2491
124 Ga0068854_100056458 3300005578 Bacteria 2830
125 Ga0068854_100209536 3300005578 Bacteria 1537
126 Ga0068854_100318303 3300005578 Bacteria 1264
127 Ga0068856_100024311 3300005614 Bacteria 5895
128 Ga0070702_100116456 3300005615 Bacteria 1666
129 Ga0068852_100015916 3300005616 Bacteria 5851
130 Ga0068852_100085186 3300005616 Bacteria 2815
131 Ga0068852_100193068 3300005616 Bacteria 1922
132 Ga0068859_100003584 3300005617 Bacteria 15817
133 Ga0068864_100250749 3300005618 Bacteria 1643
134 Ga0068864_100266262 3300005618 Bacteria 1595
135 Ga0068866_10027317 3300005718 Bacteria 2705
136 Ga0068866_10246009 3300005718 Bacteria 1092
137 Ga0068861_100017373 3300005719 Bacteria 5106
138 Ga0068861_100255398 3300005719 Bacteria 1498
139 Ga0068851_10028238 3300005834 Bacteria 2771
140 Ga0068851_10052516 3300005834 Bacteria 2072
141 Ga0068863_100002273 3300005841 Bacteria 19085
142 Ga0068863_100237828 3300005841 Bacteria 1758
143 Ga0068858_100002102 3300005842 Bacteria 20214
144 Ga0068858_100034403 3300005842 Bacteria 4700
145 Ga0068858_100035047 3300005842 Bacteria 4655
146 Ga0068858_100046962 3300005842 Bacteria 4003
147 Ga0068860_100007803 3300005843 Bacteria 10688
148 Ga0068860_100009984 3300005843 Bacteria 9410
149 Ga0068860_100052671 3300005843 Bacteria 3870
150 Ga0068860_100151427 3300005843 Bacteria 2234
151 Ga0068862_100045821 3300005844 Bacteria 3732
152 Ga0068862_100108186 3300005844 Bacteria 2438
153 Ga0068862_100448788 3300005844 Bacteria 1215
154 Ga0075365_10263373 3300006038 Bacteria 1212
155 Ga0075363_100004625 3300006048 Bacteria 6047
156 Ga0075363_100150853 3300006048 Bacteria 1312
157 Ga0075362_10004754 3300006177 Bacteria 4905
158 Ga0097621_100073590 3300006237 Bacteria 2829
159 Ga0097621_100087007 3300006237 Bacteria 2609
160 Ga0075370_10010827 3300006353 Bacteria 4780
161 Ga0075370_10020076 3300006353 Bacteria 3646
162 Ga0075370_10025322 3300006353 Bacteria 3281
163 Ga0068871_100018082 3300006358 Bacteria 5350
164 Ga0068871_100221663 3300006358 Bacteria 1639
165 Ga0068871_100301480 3300006358 Bacteria 1407
166 Ga0075428_100525101 3300006844 Bacteria 1266
167 Ga0075430_100000447 3300006846 Bacteria 30766
168 Ga0068865_100008047 3300006881 Bacteria 6509
169 Ga0068865_100099960 3300006881 Bacteria 2122
170 Ga0075436_100207955 3300006914 Bacteria 1387
171 Ga0097620_100003584 3300006931 Bacteria 15817
172 Ga0105240_10470388 3300009093 Bacteria 1403
173 Ga0111539_10461697 3300009094 Bacteria 1479
174 Ga0105245_10000228 3300009098 Bacteria 53451
175 Ga0105245_10346418 3300009098 Bacteria 1471
176 Ga0105243_10002282 3300009148 Bacteria 16080
177 Ga0105243_10017318 3300009148 Bacteria 5448
178 Ga0105243_10321804 3300009148 Bacteria 1410
179 Ga0105243_10768085 3300009148 Bacteria 947
180 Ga0105241_10090870 3300009174 Bacteria 2408
181 Ga0105242_10276887 3300009176 Bacteria 1522
182 Ga0105248_10020017 3300009177 Bacteria 7409
183 Ga0105248_10311823 3300009177 Bacteria 1772
184 Ga0105248_10472930 3300009177 Bacteria 1413
185 Ga0105237_10005983 3300009545 Bacteria 13627
186 Ga0105237_10432764 3300009545 Bacteria 1321
187 Ga0105238_10524415 3300009551 Bacteria 1187
188 Ga0105249_10013202 3300009553 Bacteria 7289
189 Ga0105249_10135664 3300009553 Bacteria 2354
190 Ga0105249_10609062 3300009553 Bacteria 1147
191 Ga0105246_10119168 3300011119 Bacteria 1952
192 Ga0105246_10125982 3300011119 Bacteria 1905
193 Ga0105246_10453131 3300011119 Bacteria 1079
194 Ga0157373_10047343 3300013100 Bacteria 3067
195 Ga0157371_10217466 3300013102 Bacteria 1372
196 Ga0157370_10019746 3300013104 Bacteria 6746
197 Ga0157370_10296440 3300013104 Bacteria 1493
198 Ga0157370_10475861 3300013104 Bacteria 1148
199 Ga0157369_10001727 3300013105 Bacteria 26551
200 Ga0157369_10002082 3300013105 Bacteria 24188
201 Ga0157369_10016310 3300013105 Bacteria 8361
202 Ga0157369_10016713 3300013105 Bacteria 8247
203 Ga0157369_10017016 3300013105 Bacteria 8171
204 Ga0157369_10177250 3300013105 Bacteria 2244
205 Ga0157374_10041536 3300013296 Bacteria 4239
206 Ga0157374_10169426 3300013296 Bacteria 2129
207 Ga0163162_10278559 3300013306 Bacteria 1804
208 Ga0163162_10298191 3300013306 Bacteria 1744
209 Ga0157375_10011892 3300013308 Bacteria 7700
210 Ga0157375_10104814 3300013308 Bacteria 2917
211 Ga0157375_10139104 3300013308 Bacteria 2554
212 Ga0163163_10002764 3300014325 Bacteria 14808
213 Ga0157380_10069612 3300014326 Bacteria 2840
214 Ga0157380_10197827 3300014326 Bacteria 1781
215 Ga0157380_10354837 3300014326 Bacteria 1374
216 Ga0182008_10010913 3300014497 Bacteria 4846
217 Ga0157377_10223409 3300014745 Bacteria 1207
218 Ga0157379_10000632 3300014968 Bacteria 28339
219 Ga0157379_10016152 3300014968 Bacteria 6566
220 Ga0157379_10022399 3300014968 Bacteria 5596
221 Ga0157379_10049410 3300014968 Bacteria 3756
222 Ga0157376_10037068 3300014969 Bacteria 3954
223 Ga0157376_10131724 3300014969 Bacteria 2232
224 Ga0157376_10142798 3300014969 Bacteria 2150
225 Ga0157376_10432903 3300014969 Bacteria 1279
226 Ga0163161_10000092 3300017792 Bacteria 90636
227 Ga0163161_10025313 3300017792 Bacteria 4199
228 Ga0163161_10068971 3300017792 Bacteria 2584
229 Ga0206354_10170213 3300020081 Bacteria 1208
230 Ga0206353_10699119 3300020082 Bacteria 9885
231 Ga0206353_11294257 3300020082 Bacteria 3571
232 Ga0213873_10026812 3300021358 Bacteria 1402
233 Ga0213874_10046544 3300021377 Bacteria 1317
234 Ga0213876_10016071 3300021384 Bacteria 3958
235 Ga0209436_101782 3300025208 Bacteria 7033
236 Ga0209436_102759 3300025208 Bacteria 5027
237 Ga0209672_100930 3300025228 Bacteria 13214
238 Ga0209147_101551 3300025229 Bacteria 7874
239 Ga0209258_100099 3300025242 Bacteria 214924
240 Ga0207425_1000365 3300025245 Bacteria 31393
241 Ga0207425_1007215 3300025245 Bacteria 2956
242 Ga0209148_1000103 3300025254 Bacteria 215356
243 Ga0209129_1000007 3300025258 Bacteria 771325
244 Ga0209129_1002036 3300025258 Bacteria 10457
245 Ga0209129_1003152 3300025258 Bacteria 7388
246 Ga0209129_1003474 3300025258 Bacteria 6824
247 Ga0209565_1000199 3300025263 Bacteria 71613
248 Ga0209565_1001616 3300025263 Bacteria 9524
249 Ga0209673_1000128 3300025273 Bacteria 164482
250 Ga0209673_1000304 3300025273 Bacteria 91151
251 Ga0209130_1000321 3300025284 Bacteria 56239
252 Ga0209130_1002727 3300025284 Bacteria 8368
253 Ga0209675_1000298 3300025291 Bacteria 45731
254 Ga0209675_1006447 3300025291 Bacteria 4699
255 Ga0209675_1007353 3300025291 Bacteria 4236
256 Ga0209676_1000122 3300025292 Bacteria 195510
257 Ga0209676_1000301 3300025292 Bacteria 99952
258 Ga0209025_1000073 3300025294 Bacteria 282133
259 Ga0209025_1000248 3300025294 Bacteria 126818
260 Ga0209025_1001298 3300025294 Bacteria 34116
261 Ga0209025_1011593 3300025294 Bacteria 5783
262 Ga0209564_1000360 3300025295 Bacteria 84454
263 Ga0209564_1000603 3300025295 Bacteria 56168
264 Ga0209758_1000025 3300025297 Bacteria 586687
265 Ga0209758_1015133 3300025297 Bacteria 4025
266 Ga0209050_1000002 3300025298 Bacteria 1792849
267 Ga0209050_1012636 3300025298 Bacteria 3847
268 Ga0209256_1000050 3300025299 Bacteria 308622
269 Ga0209256_1000063 3300025299 Bacteria 252716
270 Ga0207426_1000001 3300025302 Bacteria 1341301
271 Ga0207426_1000028 3300025302 Bacteria 483955
272 Ga0209051_1000002 3300025303 Bacteria 1631846
273 Ga0209051_1000541 3300025303 Bacteria 46579
274 Ga0209257_1000002 3300025304 Bacteria 1767052
275 Ga0209257_1004309 3300025304 Bacteria 11181
276 Ga0209257_1007991 3300025304 Bacteria 6179
277 Ga0207682_10006348 3300025893 Bacteria 4771
278 Ga0207682_10026133 3300025893 Bacteria 2319
279 Ga0207642_10033539 3300025899 Bacteria 2173
280 Ga0207642_10169894 3300025899 Bacteria 1179
281 Ga0207688_10008823 3300025901 Bacteria 5487
282 Ga0207680_10009114 3300025903 Bacteria 4907
283 Ga0207680_10052435 3300025903 Bacteria 2444
284 Ga0207685_10073673 3300025905 Bacteria 1392
285 Ga0207645_10008037 3300025907 Bacteria 7399
286 Ga0207645_10010765 3300025907 Bacteria 6270
287 Ga0207645_10020197 3300025907 Bacteria 4362
288 Ga0207645_10035730 3300025907 Bacteria 3190
289 Ga0207645_10101313 3300025907 Bacteria 1858
290 Ga0207643_10023982 3300025908 Bacteria 3366
291 Ga0207705_10166050 3300025909 Bacteria 1660
292 Ga0207684_10104147 3300025910 Bacteria 2426
293 Ga0207707_10000074 3300025912 Bacteria 102367
294 Ga0207707_10036567 3300025912 Bacteria 4292
295 Ga0207707_10094367 3300025912 Bacteria 2614
296 Ga0207671_10065160 3300025914 Bacteria 2709
297 Ga0207660_10000153 3300025917 Bacteria 42603
298 Ga0207660_10018152 3300025917 Bacteria 4685
299 Ga0207660_10021106 3300025917 Bacteria 4377
300 Ga0207660_10043166 3300025917 Bacteria 3168
301 Ga0207662_10061311 3300025918 Bacteria 2258
302 Ga0207662_10100450 3300025918 Bacteria 1792
303 Ga0207657_10029882 3300025919 Bacteria 4954
304 Ga0207657_10063815 3300025919 Bacteria 3147
305 Ga0207657_10080297 3300025919 Bacteria 2742
306 Ga0207657_10116342 3300025919 Bacteria 2203
307 Ga0207649_10014381 3300025920 Bacteria 4429
308 Ga0207652_10000374 3300025921 Bacteria 46565
309 Ga0207652_10016058 3300025921 Bacteria 6105
310 Ga0207652_10027027 3300025921 Bacteria 4781
311 Ga0207652_10104509 3300025921 Bacteria 2505
312 Ga0207652_10110766 3300025921 Bacteria 2434
313 Ga0207681_10004767 3300025923 Bacteria 8349
314 Ga0207650_10001000 3300025925 Bacteria 21248
315 Ga0207650_10242427 3300025925 Bacteria 1457
316 Ga0207659_10001048 3300025926 Bacteria 16382
317 Ga0207659_10013986 3300025926 Bacteria 5164
318 Ga0207659_10179240 3300025926 Bacteria 1677
319 Ga0207659_10201677 3300025926 Bacteria 1589
320 Ga0207687_10124244 3300025927 Bacteria 1935
321 Ga0207644_10029760 3300025931 Bacteria 3790
322 Ga0207644_10051632 3300025931 Bacteria 2952
323 Ga0207644_10069994 3300025931 Bacteria 2563
324 Ga0207644_10140871 3300025931 Bacteria 1857
325 Ga0207690_10002600 3300025932 Bacteria 10890
326 Ga0207690_10056869 3300025932 Bacteria 2641
327 Ga0207690_10075646 3300025932 Bacteria 2335
328 Ga0207706_10006805 3300025933 Bacteria 10571
329 Ga0207706_10063411 3300025933 Bacteria 3254
330 Ga0207686_10244319 3300025934 Bacteria 1308
331 Ga0207709_10000467 3300025935 Bacteria 37277
332 Ga0207709_10030408 3300025935 Bacteria 3141
333 Ga0207709_10311153 3300025935 Bacteria 1175
334 Ga0207670_10050995 3300025936 Bacteria 2776
335 Ga0207670_10105529 3300025936 Bacteria 2020
336 Ga0207669_10324598 3300025937 Bacteria 1179
337 Ga0207704_10131606 3300025938 Bacteria 1733
338 Ga0207691_10001568 3300025940 Bacteria 22703
339 Ga0207691_10003901 3300025940 Bacteria 14484
340 Ga0207691_10010473 3300025940 Bacteria 8894
341 Ga0207691_10021378 3300025940 Bacteria 6111
342 Ga0207691_10032483 3300025940 Bacteria 4865
343 Ga0207691_10241385 3300025940 Bacteria 1562
344 Ga0207689_10001729 3300025942 Bacteria 20638
345 Ga0207689_10083637 3300025942 Bacteria 2624
346 Ga0207661_10156567 3300025944 Bacteria 1974
347 Ga0207661_10210083 3300025944 Bacteria 1715
348 Ga0207661_10310517 3300025944 Bacteria 1415
349 Ga0207667_10022513 3300025949 Bacteria 6958
350 Ga0207667_10365390 3300025949 Bacteria 1471
351 Ga0207667_10733715 3300025949 Bacteria 988
352 Ga0207651_10001581 3300025960 Bacteria 10423
353 Ga0207651_10039672 3300025960 Bacteria 3107
354 Ga0207712_10004089 3300025961 Bacteria 9205
355 Ga0207712_10517239 3300025961 Bacteria 1022
356 Ga0207668_10136427 3300025972 Bacteria 1880
357 Ga0207668_10277727 3300025972 Bacteria 1372
358 Ga0207640_10147026 3300025981 Bacteria 1726
359 Ga0207658_10007808 3300025986 Bacteria 7286
360 Ga0207658_10009704 3300025986 Bacteria 6535
361 Ga0207658_10063285 3300025986 Bacteria 2772
362 Ga0207658_10121953 3300025986 Bacteria 2080
363 Ga0207658_10122474 3300025986 Bacteria 2076
364 Ga0207658_10157885 3300025986 Bacteria 1856
365 Ga0207677_10010787 3300026023 Bacteria 5181
366 Ga0207677_10389108 3300026023 Bacteria 1179
367 Ga0207677_10395500 3300026023 Bacteria 1170
368 Ga0207703_10004561 3300026035 Bacteria 11359
369 Ga0207703_10005803 3300026035 Bacteria 9893
370 Ga0207703_10021193 3300026035 Bacteria 5087
371 Ga0207703_10060645 3300026035 Bacteria 3094
372 Ga0207639_10018046 3300026041 Bacteria 5007
373 Ga0207639_10024775 3300026041 Bacteria 4347
374 Ga0207639_10140573 3300026041 Bacteria 2011
375 Ga0207678_10004423 3300026067 Bacteria 12642
376 Ga0207708_10077147 3300026075 Bacteria 2557
377 Ga0207708_10253286 3300026075 Bacteria 1419
378 Ga0207702_10296478 3300026078 Bacteria 1533
379 Ga0207641_10006097 3300026088 Bacteria 10204
380 Ga0207641_10134804 3300026088 Bacteria 2221
381 Ga0207648_10016997 3300026089 Bacteria 6630
382 Ga0207648_10047268 3300026089 Bacteria 3773
383 Ga0207648_10322513 3300026089 Bacteria 1388
384 Ga0207676_10003710 3300026095 Bacteria 10799
385 Ga0207676_10101835 3300026095 Bacteria 2382
386 Ga0207676_10193792 3300026095 Bacteria 1790
387 Ga0207676_10450712 3300026095 Bacteria 1213
388 Ga0207674_10086723 3300026116 Bacteria 3124
389 Ga0207675_100000267 3300026118 Bacteria 49570
390 Ga0207675_100004220 3300026118 Bacteria 13908
391 Ga0207683_10010011 3300026121 Bacteria 8092
392 Ga0207683_10024674 3300026121 Bacteria 5180
393 Ga0207698_10025696 3300026142 Bacteria 4153
394 Ga0207698_10067865 3300026142 Bacteria 2814
395 Ga0207698_10084910 3300026142 Bacteria 2568
396 Ga0268265_10064051 3300028380 Bacteria 2831
397 Ga0268264_10011894 3300028381 Bacteria 7170
398 Ga0268264_10029646 3300028381 Bacteria 4483
399 Ga0268264_10049503 3300028381 Bacteria 3496
400 Ga0268264_10077404 3300028381 Bacteria 2833
401 Ga0265338_10010034 3300028800 Bacteria 11193
402 Ga0314311_1042102 3300030733 Bacteria 3096
403 Ga0265339_10007383 3300031249 Bacteria 7111
404 Ga0265327_10000454 3300031251 Bacteria 73503
405 Ga0307509_10029262 3300031507 Bacteria 6116
406 Ga0307408_100019166 3300031548 Bacteria 4604
407 Ga0307408_100133633 3300031548 Bacteria 1938
408 Ga0307408_100151922 3300031548 Bacteria 1829
409 Ga0307408_100338299 3300031548 Bacteria 1273
410 Ga0316575_10009769 3300031665 Bacteria 3517
411 Ga0316579_10001451 3300031691 Bacteria 8614
412 Ga0316576_10012856 3300031727 Bacteria 5540
413 Ga0316576_10013736 3300031727 Bacteria 5392
414 Ga0316576_10021252 3300031727 Bacteria 4485
415 Ga0316576_10093814 3300031727 Bacteria 2238
416 Ga0316578_10029456 3300031728 Bacteria 3116
417 Ga0307405_10001548 3300031731 Bacteria 9747
418 Ga0307405_10016399 3300031731 Bacteria 4040
419 Ga0307405_10030887 3300031731 Bacteria 3146
420 Ga0316577_10096657 3300031733 Bacteria 1654
421 Ga0307413_10136986 3300031824 Bacteria 1685
422 Ga0307410_10365100 3300031852 Bacteria 1157
423 Ga0326468_10001530 3300031889 Bacteria 1993
424 Ga0307406_10006772 3300031901 Bacteria 6337
425 Ga0307406_10011607 3300031901 Bacteria 5004
426 Ga0307407_10048774 3300031903 Bacteria 2412
427 Ga0307407_10058052 3300031903 Bacteria 2248
428 Ga0307412_10004436 3300031911 Bacteria 7817
429 Ga0307412_10200455 3300031911 Bacteria 1515
430 Ga0307409_100145075 3300031995 Bacteria 2051
431 Ga0307416_100015973 3300032002 Bacteria 5202
432 Ga0307416_100025154 3300032002 Bacteria 4360
433 Ga0307414_10025136 3300032004 Bacteria 3809
434 Ga0307414_10123218 3300032004 Bacteria 1997
435 Ga0307415_100088614 3300032126 Bacteria 2233
436 Ga0307415_100365718 3300032126 Bacteria 1219
437 Ga0373948_0021459 3300034817 Bacteria 1237
438 Ga0373944_0029210 3300035089 Bacteria 1647
439 Ga0373952_0018043 3300035092 Bacteria 1456
440 Ga0373936_0014025 3300035113 Bacteria 3061
441 Ga0373939_0121418 3300035114 Bacteria 922
442 Ga0373954_0112820 3300035118 Bacteria 1316
443 Ga0373960_0048206 3300035121 Bacteria 1256
444 Ga0373946_0138848 3300035171 Bacteria 1125
445 Ga0316574_0014170 3300035398 Bacteria 4599
446 Ga0316574_0033536 3300035398 Bacteria 3125
447 Ga0316574_0189575 3300035398 Bacteria 1322
448 Ga0373931_0011667 3300035691 Bacteria 4246
449 Ga0373931_0034917 3300035691 Bacteria 2612
450 Ga0373935_0001145 3300035692 Bacteria 14506
451 Ga0373927_0010784 3300035695 Bacteria 6088
452 Ga0316582_0005798 3300036647 Bacteria 6411
453 Ga0316584_0009071 3300036712 Bacteria 6886
454 Ga0316584_0063908 3300036712 Bacteria 2756
455 Ga0373925_0029026 3300037068 Bacteria 4057
456 Ga0373925_0041133 3300037068 Bacteria 3425
457 Ga0395900_0553086 3300037418 Bacteria 1095
458 Ga0395898_0191714 3300037466 Bacteria 1953
459 Ga0316581_0007718 3300037588 Bacteria 2899
460 Ga0395901_0224895 3300038443 Bacteria 1961
461 Ga0395901_0358059 3300038443 Bacteria 1505
462 Ga0436365_0672943 3300039437 Bacteria 3233
463 Ga0436362_0012354 3300039453 Bacteria 2863
464 Ga0436362_0612717 3300039453 Bacteria 1571
465 Ga0436362_1282224 3300039453 Bacteria 1226
466 Ga0439436_0002232 3300041404 Bacteria 5791
467 Ga0439447_011250 3300041407 Bacteria 2621
468 Ga0439466_0001685 3300041411 Bacteria 8628
469 Ga0439465_0000168 3300041413 Bacteria 16705
470 Ga0451841_1206030 3300041498 Bacteria 969
471 Ga0439431_0001575 3300041997 Bacteria 5052
472 Ga0439433_0000126 3300041999 Bacteria 11123
473 Ga0439442_001795 3300042002 Bacteria 4198
474 Ga0439445_0000357 3300042004 Bacteria 9073
475 Ga0439432_000800 3300042006 Bacteria 11745
476 Ga0439449_0004822 3300042007 Bacteria 5201
477 Ga0439449_0005452 3300042007 Bacteria 4874
478 Ga0439452_001221 3300042010 Bacteria 10955
479 Ga0439457_001416 3300042014 Bacteria 7214
480 Ga0439462_0016850 3300042015 Bacteria 1891
481 Ga0439446_0105955 3300042156 Bacteria 893
482 Ga0439434_0002102 3300042435 Bacteria 5762
483 Ga0466969_0053138 3300044656 Bacteria 1989
484 Ga0466965_0005041 3300044683 Bacteria 5919
485 Ga0466965_0020083 3300044683 Bacteria 3209
486 Ga0466966_0056859 3300044684 Bacteria 2474
487 Ga0466966_0092495 3300044684 Bacteria 1876
488 Ga0466961_0003906 3300044693 Bacteria 9319
489 Ga0466961_0103209 3300044693 Bacteria 1795
490 Ga0466961_0242267 3300044693 Bacteria 1108
491 Ga0466963_0007892 3300044694 Bacteria 6371
492 Ga0466963_0035271 3300044694 Bacteria 3258
493 Ga0466964_0070617 3300044706 Bacteria 1476
494 Ga0453684_0091919 3300044712 Bacteria 3743
495 Ga0466957_0003797 3300044842 Bacteria 8350
496 Ga0466960_0017758 3300044901 Bacteria 3109
497 Ga0466959_0063858 3300045049 Bacteria 2673
498 Ga0466959_0127340 3300045049 Bacteria 1807
499 Ga0466959_0149345 3300045049 Bacteria 1648
500 Ga0466959_0188251 3300045049 Bacteria 1441
501 Ga0451576_0222141 3300045051 Bacteria 1972
502 Ga0451576_0269665 3300045051 Bacteria 1779
503 Ga0466958_0012609 3300045836 Bacteria 4790
504 Ga0466958_0129014 3300045836 Bacteria 1587
505 Ga0466958_0176831 3300045836 Bacteria 1353
506 Ga0466967_0000635 3300045976 Bacteria 17623
507 Ga0466967_0230988 3300045976 Bacteria 1761
508 Ga0495627_012887 3300046453 Bacteria 2952
509 Ga0495638_0004803 3300046460 Bacteria 10181
510 Ga0495616_0010436 3300046513 Bacteria 5376
511 Ga0495620_0016240 3300046515 Bacteria 3742
512 Ga0495620_0080398 3300046515 Bacteria 1319
513 Ga0495631_0002314 3300046518 Bacteria 10853
514 Ga0495637_0020297 3300046520 Bacteria 3059
515 Ga0495645_0117420 3300046543 Bacteria 1877
516 Ga0495645_0121745 3300046543 Bacteria 1836
517 Ga0495633_0046232 3300046558 Bacteria 2060
518 Ga0495668_0001182 3300046616 Bacteria 26545
519 Ga0495668_0053320 3300046616 Bacteria 2236
520 Ga0495625_0007255 3300046660 Bacteria 9695
521 Ga0495588_0173408 3300046674 Bacteria 1140
522 Ga0495657_0182702 3300046675 Bacteria 1286
523 Ga0495647_0085558 3300046681 Bacteria 1285
524 Ga0495658_0030507 3300046683 Bacteria 2928
525 Ga0495658_0188615 3300046683 Bacteria 1281
526 Ga0495671_0006863 3300046692 Bacteria 6538
527 Ga0496100_0021838 3300048903 Bacteria 3863
528 Ga0496102_0072865 3300048905 Bacteria 3157
529 Ga0496104_0143768 3300048907 Bacteria 2291
530 Ga0496105_0204956 3300048908 Bacteria 1609
531 Ga0496106_0178465 3300048909 Bacteria 1685
532 Ga0496107_0007111 3300048910 Bacteria 7710
533 Ga0496108_0027297 3300048911 Bacteria 4713
534 Ga0496108_0168300 3300048911 Bacteria 1895
535 Ga0496108_0186215 3300048911 Bacteria 1798
536 Ga0496109_0556093 3300048912 Bacteria 1082
537 Ga0496110_0082418 3300048913 Bacteria 2869
538 Ga0496110_0100467 3300048913 Bacteria 2593
539 Ga0496111_0281641 3300048914 Bacteria 1233
540 Ga0496112_0225210 3300048915 Bacteria 1831
541 Ga0496114_0021232 3300048917 Bacteria 5281
542 Ga0496114_0060927 3300048917 Bacteria 3155
543 Ga0496114_0071290 3300048917 Bacteria 2920
544 Ga0496115_0094996 3300048918 Bacteria 2440
545 Ga0496116_0085384 3300048919 Bacteria 1940
546 Ga0496117_0009933 3300048920 Bacteria 8755
547 Ga0496117_0188537 3300048920 Bacteria 1177
548 Ga0496118_0142612 3300048921 Bacteria 1515
549 Ga0496121_0088726 3300048924 Bacteria 2423
550 Ga0496121_0106814 3300048924 Bacteria 2145
551 Ga0496123_0147016 3300048926 Bacteria 1278
552 Ga0496125_0067493 3300048928 Bacteria 2817
553 Ga0501032_0240561 3300049569 Bacteria 1176
554 Ga0501034_0256035 3300049571 Bacteria 1694
555 Ga0501036_0024906 3300049572 Bacteria 5047
556 Ga0501036_0170730 3300049572 Bacteria 1832
557 Ga0501037_0031283 3300049573 Bacteria 3929
558 Ga0501038_0005179 3300049574 Bacteria 12129
559 Ga0501038_0064269 3300049574 Bacteria 3130
560 Ga0501038_0087216 3300049574 Bacteria 2621
561 Ga0501040_0004492 3300049576 Bacteria 9063
562 Ga0501041_0092128 3300049577 Bacteria 1871
563 Ga0501042_0007629 3300049578 Bacteria 7098
564 Ga0501043_0016462 3300049579 Bacteria 5795
565 Ga0501047_0029519 3300049581 Bacteria 5287
566 Ga0501047_0089437 3300049581 Bacteria 2956
567 Ga0501047_0467436 3300049581 Bacteria 1090
568 Ga0501048_0019506 3300049582 Bacteria 4974
569 Ga0501067_0151799 3300049583 Bacteria 1291
570 Ga0501068_0072848 3300049584 Bacteria 2098
571 Ga0501069_0000817 3300049585 Bacteria 14685
572 Ga0501070_0000942 3300049586 Bacteria 26254
573 Ga0501071_0117819 3300049587 Bacteria 1967
574 Ga0501072_0002619 3300049588 Bacteria 13479
575 Ga0501073_0005506 3300049589 Bacteria 9483
576 Ga0501074_0019230 3300049590 Bacteria 4960
577 Ga0501074_0029733 3300049590 Bacteria 3958
578 Ga0501075_0004267 3300049591 Bacteria 9657
579 Ga0501076_0000042 3300049592 Bacteria 62280
580 Ga0501076_0022052 3300049592 Bacteria 4891
581 Ga0501079_0069947 3300049741 Bacteria 2709
582 Ga0501079_0094589 3300049741 Bacteria 2315
583 Ga0501080_0002559 3300049742 Bacteria 15922
584 Ga0501080_0025973 3300049742 Bacteria 5441
585 Ga0501081_0003144 3300049743 Bacteria 10497
586 Ga0501083_0000608 3300049744 Bacteria 23082
587 Ga0501035_0038546 3300049822 Bacteria 4327
588 Ga0501044_0028234 3300049823 Bacteria 5923
589 Ga0501044_0140066 3300049823 Bacteria 2408
590 nmdc:mga03683_2335_c1 3300050489 Bacteria 5873
591 nmdc:mga0yw44_311356_c1 3300050492 Bacteria 1056
592 nmdc:mga07m45_14518_c1 3300050496 Bacteria 3841
593 nmdc:mga05p37_787528_c1 3300050507 Bacteria 1042
594 nmdc:mga0qj67_11224_c1 3300050509 Bacteria 6709
595 nmdc:mga08y16_304068_c1 3300050511 Bacteria 1643
596 nmdc:mga0rr50_141226_c1 3300050513 Bacteria 1937
597 Ga0495601_0059381 3300053077 Bacteria 2425
598 Ga0500610_0007456 3300053079 Bacteria 4688
599 Ga0500610_0021950 3300053079 Bacteria 3140
600 Ga0495619_0273352 3300053085 Bacteria 1171
601 Ga0500644_0015557 3300053088 Bacteria 2173
602 Ga0500562_009817 3300053108 Bacteria 2420
603 Ga0500593_001561 3300053117 Bacteria 8242
604 Ga0500594_0001099 3300053118 Bacteria 5799
605 Ga0500595_016138 3300053119 Bacteria 2787
606 Ga0500607_004625 3300053121 Bacteria 9372
607 Ga0500607_051948 3300053121 Bacteria 2178
608 Ga0500658_0000986 3300053134 Bacteria 11626
609 Ga0500559_0012541 3300053136 Bacteria 3598
610 Ga0500568_0004310 3300053139 Bacteria 7633
611 Ga0500577_0007908 3300053142 Bacteria 3003
612 Ga0500616_0032665 3300053153 Bacteria 2844
613 Ga0500620_068079 3300053155 Bacteria 1222
614 Ga0500627_0001689 3300053158 Bacteria 6248
615 Ga0500634_0014262 3300053161 Bacteria 4192
616 Ga0501084_0003722 3300054114 Bacteria 12378
617 Ga0501084_0004424 3300054114 Bacteria 11466
618 Ga0501082_0006831 3300060353 Bacteria 9864
619 Ga0501082_0122034 3300060353 Bacteria 2259
620 Ga0466962_0022392 3300061719 Bacteria 3036
621 Ga0530510_0002153 3300061734 Bacteria 13523

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_1282224 Ga0436362_1282224_94_894 242
2 3300021358 Ga0213873_10026812 Ga0213873_100268122 257
3 3300021384 Ga0213876_10016071 Ga0213876_100160712 260
4 3300039437 Ga0436365_0672943 Ga0436365_0672943_2142_2972 260
5 3300039453 Ga0436362_0012354 Ga0436362_0012354_1452_2282 260
6 3300035113 Ga0373936_0014025 Ga0373936_0014025_1788_2621 267
7 3300035692 Ga0373935_0001145 Ga0373935_0001145_8552_9385 267
8 3300035695 Ga0373927_0010784 Ga0373927_0010784_1776_2609 267
9 iso_pu_bacteria 2876808645 2876813612 269
10 iso_pu_bacteria 2879110137 2879117458 269
11 3300031727 Ga0316576_10093814 Ga0316576_100938142 270
12 3300035398 Ga0316574_0014170 Ga0316574_0014170_2536_3432 270
13 3300025935 Ga0207709_10311153 Ga0207709_103111532 271
14 3300026075 Ga0207708_10253286 Ga0207708_102532862 271
15 3300048918 Ga0496115_0094996 Ga0496115_0094996_1592_2419 272
16 3300031548 Ga0307408_100338299 Ga0307408_1003382991 273
17 3300044683 Ga0466965_0005041 Ga0466965_0005041_1920_2819 274
18 3300003215 JGI25153J46596_10004165 JGI25153J46596_100041659 275
19 3300009094 Ga0111539_10461697 Ga0111539_104616972 275
20 3300011119 Ga0105246_10453131 Ga0105246_104531312 275
21 3300035398 Ga0316574_0189575 Ga0316574_0189575_196_1047 275
22 3300048913 Ga0496110_0082418 Ga0496110_0082418_1830_2660 275
23 3300049822 Ga0501035_0038546 Ga0501035_0038546_3204_4061 275
24 3300050511 nmdc:mga08y16_304068_c1 nmdc:mga08y16_304068_c1_286_1116 275
25 3300049581 Ga0501047_0029519 Ga0501047_0029519_1364_2224 276
26 3300005718 Ga0068866_10246009 Ga0068866_102460092 277
27 3300031251 Ga0265327_10000454 Ga0265327_1000045416 277
28 3300009098 Ga0105245_10000228 Ga0105245_1000022811 278
29 3300009177 Ga0105248_10311823 Ga0105248_103118232 278
30 3300009545 Ga0105237_10005983 Ga0105237_1000598312 278
31 3300013105 Ga0157369_10016310 Ga0157369_100163105 278
32 3300014969 Ga0157376_10131724 Ga0157376_101317242 278
33 3300025914 Ga0207671_10065160 Ga0207671_100651602 278
34 3300026095 Ga0207676_10450712 Ga0207676_104507122 278
35 3300045976 Ga0466967_0230988 Ga0466967_0230988_799_1641 278
36 3300005338 Ga0068868_100024607 Ga0068868_1000246074 279
37 3300005366 Ga0070659_100000066 Ga0070659_10000006685 279
38 3300006844 Ga0075428_100525101 Ga0075428_1005251012 279
39 3300013105 Ga0157369_10001727 Ga0157369_100017279 279
40 3300025932 Ga0207690_10002600 Ga0207690_100026004 279
41 3300028800 Ga0265338_10010034 Ga0265338_100100349 279
42 3300031507 Ga0307509_10029262 Ga0307509_100292627 279
43 3300039453 Ga0436362_0612717 Ga0436362_0612717_382_1233 279
44 3300049572 Ga0501036_0170730 Ga0501036_0170730_719_1561 279
45 3300049574 Ga0501038_0087216 Ga0501038_0087216_140_982 279
46 3300049576 Ga0501040_0004492 Ga0501040_0004492_3512_4354 279
47 3300049577 Ga0501041_0092128 Ga0501041_0092128_296_1138 279
48 3300049578 Ga0501042_0007629 Ga0501042_0007629_963_1805 279
49 3300049583 Ga0501067_0151799 Ga0501067_0151799_91_939 279
50 3300049584 Ga0501068_0072848 Ga0501068_0072848_565_1413 279
51 3300049585 Ga0501069_0000817 Ga0501069_0000817_10465_11313 279
52 3300049586 Ga0501070_0000942 Ga0501070_0000942_14362_15210 279
53 3300049587 Ga0501071_0117819 Ga0501071_0117819_1086_1928 279
54 3300049588 Ga0501072_0002619 Ga0501072_0002619_1566_2408 279
55 3300049589 Ga0501073_0005506 Ga0501073_0005506_4981_5829 279
56 3300049590 Ga0501074_0029733 Ga0501074_0029733_2728_3576 279
57 3300049591 Ga0501075_0004267 Ga0501075_0004267_4164_5006 279
58 3300049592 Ga0501076_0000042 Ga0501076_0000042_4002_4844 279
59 3300049592 Ga0501076_0022052 Ga0501076_0022052_1132_1974 279
60 3300049741 Ga0501079_0069947 Ga0501079_0069947_1275_2123 279
61 3300049741 Ga0501079_0094589 Ga0501079_0094589_1125_1967 279
62 3300049742 Ga0501080_0002559 Ga0501080_0002559_13656_14498 279
63 3300049742 Ga0501080_0025973 Ga0501080_0025973_2284_3132 279
64 3300049743 Ga0501081_0003144 Ga0501081_0003144_3850_4692 279
65 3300049744 Ga0501083_0000608 Ga0501083_0000608_11756_12604 279
66 3300054114 Ga0501084_0003722 Ga0501084_0003722_3899_4741 279
67 3300054114 Ga0501084_0004424 Ga0501084_0004424_4280_5128 279
68 3300060353 Ga0501082_0006831 Ga0501082_0006831_7137_7979 279
69 3300060353 Ga0501082_0122034 Ga0501082_0122034_1049_1897 279
70 3300061734 Ga0530510_0002153 Ga0530510_0002153_4652_5494 279
71 iso_pu_bacteria 2870782633 2870787837 279
72 3300005336 Ga0070680_100000009 Ga0070680_10000000965 280
73 3300005445 Ga0070708_100166281 Ga0070708_1001662812 280
74 3300005458 Ga0070681_10000031 Ga0070681_1000003168 280
75 3300005467 Ga0070706_100453917 Ga0070706_1004539171 280
76 3300005530 Ga0070679_100000136 Ga0070679_10000013622 280
77 3300025910 Ga0207684_10104147 Ga0207684_101041473 280
78 3300025912 Ga0207707_10000074 Ga0207707_1000007468 280
79 3300025917 Ga0207660_10000153 Ga0207660_1000015337 280
80 3300025921 Ga0207652_10000374 Ga0207652_1000037423 280
81 3300025944 Ga0207661_10210083 Ga0207661_102100833 280
82 3300025986 Ga0207658_10122474 Ga0207658_101224742 280
83 3300031665 Ga0316575_10009769 Ga0316575_100097691 280
84 3300031691 Ga0316579_10001451 Ga0316579_100014513 280
85 3300036647 Ga0316582_0005798 Ga0316582_0005798_5057_5902 280
86 3300037418 Ga0395900_0553086 Ga0395900_0553086_68_916 280
87 3300037588 Ga0316581_0007718 Ga0316581_0007718_1788_2633 280
88 3300042156 Ga0439446_0105955 Ga0439446_0105955_25_870 280
89 3300049571 Ga0501034_0256035 Ga0501034_0256035_95_976 280
90 3300009148 Ga0105243_10768085 Ga0105243_107680851 281
91 3300044656 Ga0466969_0053138 Ga0466969_0053138_848_1711 281
92 3300044684 Ga0466966_0092495 Ga0466966_0092495_816_1679 281
93 3300044693 Ga0466961_0003906 Ga0466961_0003906_4145_5005 281
94 3300045049 Ga0466959_0188251 Ga0466959_0188251_180_1043 281
95 3300005336 Ga0070680_100022322 Ga0070680_1000223225 282
96 3300005336 Ga0070680_100092404 Ga0070680_1000924042 282
97 3300005339 Ga0070660_100072749 Ga0070660_1000727493 282
98 3300005366 Ga0070659_100029864 Ga0070659_1000298642 282
99 3300005367 Ga0070667_100599019 Ga0070667_1005990191 282
100 3300005440 Ga0070705_100028816 Ga0070705_1000288161 282
101 3300005444 Ga0070694_100034823 Ga0070694_1000348233 282
102 3300005458 Ga0070681_10078643 Ga0070681_100786434 282
103 3300005530 Ga0070679_100015728 Ga0070679_1000157284 282
104 3300005545 Ga0070695_100007952 Ga0070695_1000079527 282
105 3300005546 Ga0070696_100085924 Ga0070696_1000859242 282
106 3300005548 Ga0070665_100338893 Ga0070665_1003388932 282
107 3300005549 Ga0070704_100074742 Ga0070704_1000747423 282
108 3300009553 Ga0105249_10135664 Ga0105249_101356642 282
109 3300021377 Ga0213874_10046544 Ga0213874_100465442 282
110 3300025917 Ga0207660_10018152 Ga0207660_100181523 282
111 3300025917 Ga0207660_10043166 Ga0207660_100431663 282
112 3300025919 Ga0207657_10063815 Ga0207657_100638152 282
113 3300025921 Ga0207652_10027027 Ga0207652_100270273 282
114 3300025921 Ga0207652_10104509 Ga0207652_101045092 282
115 3300025932 Ga0207690_10075646 Ga0207690_100756462 282
116 3300025961 Ga0207712_10517239 Ga0207712_105172391 282
117 3300025986 Ga0207658_10157885 Ga0207658_101578852 282
118 3300044706 Ga0466964_0070617 Ga0466964_0070617_185_1039 282
119 3300045976 Ga0466967_0000635 Ga0466967_0000635_14337_15191 282
120 iso_pu_bacteria 2899370129 2899370603 282
121 3300005530 Ga0070679_100146798 Ga0070679_1001467981 283
122 3300011119 Ga0105246_10119168 Ga0105246_101191682 283
123 3300025949 Ga0207667_10733715 Ga0207667_107337151 283
124 3300034817 Ga0373948_0021459 Ga0373948_0021459_281_1141 283
125 3300035691 Ga0373931_0034917 Ga0373931_0034917_262_1122 283
126 3300044693 Ga0466961_0103209 Ga0466961_0103209_893_1750 283
127 3300045049 Ga0466959_0149345 Ga0466959_0149345_412_1269 283
128 3300006048 Ga0075363_100150853 Ga0075363_1001508531 284
129 3300006914 Ga0075436_100207955 Ga0075436_1002079552 284
130 3300009176 Ga0105242_10276887 Ga0105242_102768872 284
131 3300013105 Ga0157369_10017016 Ga0157369_100170164 284
132 3300014969 Ga0157376_10142798 Ga0157376_101427981 284
133 3300046616 Ga0495668_0001182 Ga0495668_0001182_368_1249 284
134 3300048911 Ga0496108_0027297 Ga0496108_0027297_1678_2556 284
135 3300005329 Ga0070683_100277773 Ga0070683_1002777732 285
136 3300005367 Ga0070667_100386551 Ga0070667_1003865512 285
137 3300005530 Ga0070679_100096870 Ga0070679_1000968703 285
138 3300013105 Ga0157369_10177250 Ga0157369_101772503 285
139 3300020081 Ga0206354_10170213 Ga0206354_101702132 285
140 3300020082 Ga0206353_10699119 Ga0206353_106991197 285
141 3300025912 Ga0207707_10036567 Ga0207707_100365673 285
142 3300025921 Ga0207652_10110766 Ga0207652_101107663 285
143 3300025944 Ga0207661_10156567 Ga0207661_101565672 285
144 3300025986 Ga0207658_10063285 Ga0207658_100632852 285
145 3300031548 Ga0307408_100133633 Ga0307408_1001336333 285
146 3300031824 Ga0307413_10136986 Ga0307413_101369863 285
147 3300031852 Ga0307410_10365100 Ga0307410_103651001 285
148 3300031903 Ga0307407_10048774 Ga0307407_100487742 285
149 3300031911 Ga0307412_10200455 Ga0307412_102004552 285
150 3300031995 Ga0307409_100145075 Ga0307409_1001450752 285
151 3300032004 Ga0307414_10025136 Ga0307414_100251365 285
152 3300032004 Ga0307414_10123218 Ga0307414_101232181 285
153 3300032126 Ga0307415_100365718 Ga0307415_1003657181 285
154 3300038443 Ga0395901_0358059 Ga0395901_0358059_474_1337 285
155 3300041498 Ga0451841_1206030 Ga0451841_1206030_26_901 285
156 3300053155 Ga0500620_068079 Ga0500620_068079_16_891 285
157 iso_pu_bacteria 3002998708 3003002380 285
158 3300005455 Ga0070663_100000535 Ga0070663_10000053510 286
159 3300026067 Ga0207678_10004423 Ga0207678_1000442311 286
160 3300030733 Ga0314311_1042102 Ga0314311_10421022 286
161 3300031889 Ga0326468_10001530 Ga0326468_100015302 286
162 3300046674 Ga0495588_0173408 Ga0495588_0173408_21_881 286
163 3300046675 Ga0495657_0182702 Ga0495657_0182702_38_907 286
164 3300048913 Ga0496110_0100467 Ga0496110_0100467_1239_2108 286
165 3300048915 Ga0496112_0225210 Ga0496112_0225210_343_1212 286
166 3300048917 Ga0496114_0021232 Ga0496114_0021232_580_1449 286
167 3300049569 Ga0501032_0240561 Ga0501032_0240561_83_952 286
168 3300049572 Ga0501036_0024906 Ga0501036_0024906_3008_3877 286
169 3300049573 Ga0501037_0031283 Ga0501037_0031283_2869_3738 286
170 3300049574 Ga0501038_0005179 Ga0501038_0005179_10245_11114 286
171 3300049574 Ga0501038_0064269 Ga0501038_0064269_549_1418 286
172 3300049579 Ga0501043_0016462 Ga0501043_0016462_2849_3718 286
173 3300049581 Ga0501047_0089437 Ga0501047_0089437_1306_2175 286
174 3300049581 Ga0501047_0467436 Ga0501047_0467436_35_904 286
175 3300049582 Ga0501048_0019506 Ga0501048_0019506_411_1280 286
176 3300049590 Ga0501074_0019230 Ga0501074_0019230_2931_3800 286
177 3300049823 Ga0501044_0028234 Ga0501044_0028234_86_955 286
178 3300049823 Ga0501044_0140066 Ga0501044_0140066_812_1681 286
179 3300053085 Ga0495619_0273352 Ga0495619_0273352_267_1136 286
180 3300053088 Ga0500644_0015557 Ga0500644_0015557_1016_1882 286
181 3300053142 Ga0500577_0007908 Ga0500577_0007908_1713_2579 286
182 iso_pu_bacteria 2904535858 2904536865 286
183 iso_pu_bacteria 2922554459 2922555299 286
184 3300005329 Ga0070683_100047257 Ga0070683_1000472575 287
185 3300005535 Ga0070684_100106530 Ga0070684_1001065302 287
186 3300020082 Ga0206353_11294257 Ga0206353_112942572 287
187 3300026075 Ga0207708_10077147 Ga0207708_100771473 287
188 3300053119 Ga0500595_016138 Ga0500595_016138_1786_2694 287
189 iso_pu_bacteria 2565956761 2566993774 287
190 3300001990 JGI24737J22298_10018106 JGI24737J22298_100181062 289
191 3300005719 Ga0068861_100255398 Ga0068861_1002553982 289
192 3300014326 Ga0157380_10069612 Ga0157380_100696123 289
193 3300025899 Ga0207642_10169894 Ga0207642_101698942 289
194 3300031727 Ga0316576_10012856 Ga0316576_100128565 289
195 3300031727 Ga0316576_10013736 Ga0316576_100137366 289
196 3300031727 Ga0316576_10021252 Ga0316576_100212523 289
197 3300031728 Ga0316578_10029456 Ga0316578_100294562 289
198 3300031733 Ga0316577_10096657 Ga0316577_100966572 289
199 3300035398 Ga0316574_0033536 Ga0316574_0033536_775_1674 289
200 3300036712 Ga0316584_0009071 Ga0316584_0009071_2762_3658 289
201 3300036712 Ga0316584_0063908 Ga0316584_0063908_850_1749 289
202 3300044694 Ga0466963_0035271 Ga0466963_0035271_563_1444 289
203 3300045836 Ga0466958_0176831 Ga0466958_0176831_430_1311 289
204 3300046515 Ga0495620_0080398 Ga0495620_0080398_228_1106 289
205 3300005549 Ga0070704_100017973 Ga0070704_1000179734 290
206 3300006038 Ga0075365_10263373 Ga0075365_102633731 290
207 3300006048 Ga0075363_100004625 Ga0075363_1000046257 290
208 3300006353 Ga0075370_10020076 Ga0075370_100200762 290
209 3300035114 Ga0373939_0121418 Ga0373939_0121418_20_907 290
210 3300044683 Ga0466965_0020083 Ga0466965_0020083_523_1431 290
211 3300044684 Ga0466966_0056859 Ga0466966_0056859_1446_2354 290
212 3300044693 Ga0466961_0242267 Ga0466961_0242267_114_992 290
213 3300044694 Ga0466963_0007892 Ga0466963_0007892_270_1178 290
214 3300044712 Ga0453684_0091919 Ga0453684_0091919_103_1005 290
215 3300044842 Ga0466957_0003797 Ga0466957_0003797_3795_4703 290
216 3300045049 Ga0466959_0063858 Ga0466959_0063858_883_1791 290
217 3300045051 Ga0451576_0269665 Ga0451576_0269665_540_1442 290
218 3300045836 Ga0466958_0012609 Ga0466958_0012609_138_1046 290
219 3300045836 Ga0466958_0129014 Ga0466958_0129014_635_1513 290
220 3300048928 Ga0496125_0067493 Ga0496125_0067493_1135_2016 290
221 3300050492 nmdc:mga0yw44_311356_c1 nmdc:mga0yw44_311356_c1_134_1015 290
222 3300050496 nmdc:mga07m45_14518_c1 nmdc:mga07m45_14518_c1_2095_2976 290
223 3300050513 nmdc:mga0rr50_141226_c1 nmdc:mga0rr50_141226_c1_383_1270 290
224 3300061719 Ga0466962_0022392 Ga0466962_0022392_315_1223 290
225 3300025919 Ga0207657_10080297 Ga0207657_100802975 291
226 3300006846 Ga0075430_100000447 Ga0075430_1000004471 292
227 3300037466 Ga0395898_0191714 Ga0395898_0191714_245_1132 292
228 3300038443 Ga0395901_0224895 Ga0395901_0224895_429_1316 292
229 3300050507 nmdc:mga05p37_787528_c1 nmdc:mga05p37_787528_c1_115_1032 292
230 3300050509 nmdc:mga0qj67_11224_c1 nmdc:mga0qj67_11224_c1_5610_6497 292
231 3300045049 Ga0466959_0127340 Ga0466959_0127340_331_1221 293
232 3300003781 Ga0055536_1001491 Ga0055536_100149115 297
233 3300003791 Ga0055530_10001248 Ga0055530_1000124816 297
234 3300003792 Ga0055540_1005912 Ga0055540_10059125 297
235 3300003794 Ga0055531_10009364 Ga0055531_100093642 297
236 3300025292 Ga0209676_1000122 Ga0209676_100012299 297
237 3300025298 Ga0209050_1000002 Ga0209050_10000021670 297
238 3300025303 Ga0209051_1000002 Ga0209051_10000021440 297
239 3300025304 Ga0209257_1000002 Ga0209257_10000021581 297
240 3300031249 Ga0265339_10007383 Ga0265339_100073833 297
241 3300003374 JGI25161J50226_1003843 JGI25161J50226_10038434 298
242 3300003771 Ga0055526_1008757 Ga0055526_10087575 298
243 3300003773 Ga0055537_1003336 Ga0055537_10033362 298
244 3300003775 Ga0055524_1006672 Ga0055524_10066725 298
245 3300004625 Ga0055543_1004991 Ga0055543_10049913 298
246 3300006353 Ga0075370_10025322 Ga0075370_100253224 298
247 3300025208 Ga0209436_101782 Ga0209436_1017825 298
248 3300025245 Ga0207425_1007215 Ga0207425_10072152 298
249 3300025258 Ga0209129_1003152 Ga0209129_10031523 298
250 3300025263 Ga0209565_1001616 Ga0209565_10016165 298
251 3300025273 Ga0209673_1000128 Ga0209673_1000128140 298
252 3300025284 Ga0209130_1002727 Ga0209130_10027277 298
253 3300025291 Ga0209675_1007353 Ga0209675_10073532 298
254 3300025294 Ga0209025_1011593 Ga0209025_10115933 298
255 3300025295 Ga0209564_1000360 Ga0209564_100036070 298
256 3300025297 Ga0209758_1015133 Ga0209758_10151333 298
257 3300025299 Ga0209256_1000063 Ga0209256_1000063134 298
258 3300025302 Ga0207426_1000028 Ga0207426_1000028352 298
259 3300042435 Ga0439434_0002102 Ga0439434_0002102_1790_2710 300
260 iso_pu_bacteria 2885192300 2885192435 300
261 3300005578 Ga0068854_100318303 Ga0068854_1003183032 301
262 3300014326 Ga0157380_10354837 Ga0157380_103548372 301
263 3300025893 Ga0207682_10026133 Ga0207682_100261332 301
264 3300025908 Ga0207643_10023982 Ga0207643_100239822 301
265 iso_pu_bacteria 2599185214 2599623619 303
266 iso_pu_bacteria 2599185226 2599671762 303
267 iso_pu_bacteria 2599185227 2599681225 303
268 iso_pu_bacteria 2599185229 2599693372 303
269 iso_pu_bacteria 2643221683 2644468136 303
270 iso_pu_bacteria 2885198086 2885204420 303
271 iso_pu_bacteria 2885211737 2885218073 303
272 iso_pu_bacteria 2904541872 2904548124 303
273 iso_pu_bacteria 2928070936 2928071762 303
274 iso_pu_bacteria 2928084124 2928084289 303
275 iso_pu_bacteria 2929160207 2929163054 303
276 iso_pu_bacteria 2945909444 2945911564 303
277 iso_pu_bacteria 2945984333 2945986098 303
278 3300025918 Ga0207662_10100450 Ga0207662_101004502 304
279 3300041404 Ga0439436_0002232 Ga0439436_0002232_2033_2968 304
280 3300041407 Ga0439447_011250 Ga0439447_011250_498_1433 304
281 3300041411 Ga0439466_0001685 Ga0439466_0001685_5421_6356 304
282 3300041413 Ga0439465_0000168 Ga0439465_0000168_7652_8587 304
283 3300041997 Ga0439431_0001575 Ga0439431_0001575_3058_3993 304
284 3300041999 Ga0439433_0000126 Ga0439433_0000126_1301_2236 304
285 3300042002 Ga0439442_001795 Ga0439442_001795_10_945 304
286 3300042004 Ga0439445_0000357 Ga0439445_0000357_7130_8065 304
287 3300042006 Ga0439432_000800 Ga0439432_000800_2811_3746 304
288 3300042007 Ga0439449_0004822 Ga0439449_0004822_3996_4931 304
289 3300042010 Ga0439452_001221 Ga0439452_001221_3799_4734 304
290 3300042014 Ga0439457_001416 Ga0439457_001416_4425_5360 304
291 3300042015 Ga0439462_0016850 Ga0439462_0016850_319_1254 304
292 3300005329 Ga0070683_100130673 Ga0070683_1001306733 306
293 3300005344 Ga0070661_100049907 Ga0070661_1000499074 306
294 3300005535 Ga0070684_100254132 Ga0070684_1002541322 306
295 3300005614 Ga0068856_100024311 Ga0068856_1000243114 306
296 3300013100 Ga0157373_10047343 Ga0157373_100473434 306
297 3300013105 Ga0157369_10016713 Ga0157369_1001671311 306
298 3300025912 Ga0207707_10094367 Ga0207707_100943673 306
299 3300025920 Ga0207649_10014381 Ga0207649_100143812 306
300 3300025944 Ga0207661_10310517 Ga0207661_103105172 306
301 3300026041 Ga0207639_10140573 Ga0207639_101405732 306
302 3300026078 Ga0207702_10296478 Ga0207702_102964781 306
303 iso_pu_bacteria 2818991446 2819597175 306
304 iso_pu_bacteria 2831265667 2831266301 306
305 iso_pu_bacteria 2838054893 2838057587 306
306 iso_pu_bacteria 2899924645 2899924679 306
307 iso_pu_bacteria 2928037797 2928039194 306
308 iso_pu_bacteria 2928044640 2928045201 306
309 iso_pu_bacteria 2928051484 2928053006 306
310 iso_pu_bacteria 2928064002 2928064323 306
311 3300003187 JGI25151J46595_10001227 JGI25151J46595_1000122717 307
312 3300003187 JGI25151J46595_10011114 JGI25151J46595_100111144 307
313 3300003781 Ga0055536_1000670 Ga0055536_10006703 307
314 3300003792 Ga0055540_1001683 Ga0055540_10016835 307
315 3300005328 Ga0070676_10003481 Ga0070676_100034813 307
316 3300005328 Ga0070676_10010313 Ga0070676_100103133 307
317 3300005328 Ga0070676_10025317 Ga0070676_100253173 307
318 3300005328 Ga0070676_10116437 Ga0070676_101164371 307
319 3300005330 Ga0070690_100006594 Ga0070690_1000065945 307
320 3300005331 Ga0070670_100002708 Ga0070670_10000270811 307
321 3300005333 Ga0070677_10007702 Ga0070677_100077024 307
322 3300005333 Ga0070677_10119918 Ga0070677_101199182 307
323 3300005334 Ga0068869_100005465 Ga0068869_1000054654 307
324 3300005334 Ga0068869_100045407 Ga0068869_1000454073 307
325 3300005335 Ga0070666_10007580 Ga0070666_100075803 307
326 3300005335 Ga0070666_10030719 Ga0070666_100307192 307
327 3300005336 Ga0070680_100015422 Ga0070680_1000154229 307
328 3300005337 Ga0070682_100283970 Ga0070682_1002839701 307
329 3300005338 Ga0068868_100002833 Ga0068868_1000028332 307
330 3300005338 Ga0068868_100071676 Ga0068868_1000716762 307
331 3300005338 Ga0068868_100095757 Ga0068868_1000957572 307
332 3300005338 Ga0068868_100312955 Ga0068868_1003129551 307
333 3300005340 Ga0070689_100039129 Ga0070689_1000391292 307
334 3300005340 Ga0070689_100176808 Ga0070689_1001768082 307
335 3300005344 Ga0070661_100049360 Ga0070661_1000493603 307
336 3300005347 Ga0070668_100002516 Ga0070668_1000025165 307
337 3300005347 Ga0070668_100078720 Ga0070668_1000787201 307
338 3300005353 Ga0070669_100034279 Ga0070669_1000342792 307
339 3300005353 Ga0070669_100054039 Ga0070669_1000540393 307
340 3300005354 Ga0070675_100004849 Ga0070675_1000048492 307
341 3300005354 Ga0070675_100012003 Ga0070675_1000120033 307
342 3300005354 Ga0070675_100020095 Ga0070675_1000200954 307
343 3300005354 Ga0070675_100028486 Ga0070675_1000284864 307
344 3300005355 Ga0070671_100000530 Ga0070671_10000053015 307
345 3300005355 Ga0070671_100019096 Ga0070671_1000190964 307
346 3300005355 Ga0070671_100045228 Ga0070671_1000452284 307
347 3300005355 Ga0070671_100091130 Ga0070671_1000911302 307
348 3300005356 Ga0070674_100003872 Ga0070674_1000038722 307
349 3300005356 Ga0070674_100166337 Ga0070674_1001663371 307
350 3300005356 Ga0070674_100243781 Ga0070674_1002437812 307
351 3300005364 Ga0070673_100026718 Ga0070673_1000267182 307
352 3300005365 Ga0070688_100135288 Ga0070688_1001352882 307
353 3300005367 Ga0070667_100020395 Ga0070667_1000203953 307
354 3300005455 Ga0070663_100115290 Ga0070663_1001152902 307
355 3300005456 Ga0070678_100019865 Ga0070678_1000198653 307
356 3300005456 Ga0070678_100027619 Ga0070678_1000276191 307
357 3300005456 Ga0070678_100076727 Ga0070678_1000767272 307
358 3300005456 Ga0070678_100180785 Ga0070678_1001807852 307
359 3300005457 Ga0070662_100010338 Ga0070662_1000103384 307
360 3300005457 Ga0070662_100071999 Ga0070662_1000719993 307
361 3300005457 Ga0070662_100076339 Ga0070662_1000763391 307
362 3300005458 Ga0070681_10043409 Ga0070681_100434094 307
363 3300005459 Ga0068867_100003229 Ga0068867_1000032298 307
364 3300005459 Ga0068867_100022478 Ga0068867_1000224782 307
365 3300005459 Ga0068867_100057412 Ga0068867_1000574122 307
366 3300005459 Ga0068867_100134125 Ga0068867_1001341252 307
367 3300005539 Ga0068853_100006453 Ga0068853_1000064536 307
368 3300005543 Ga0070672_100003316 Ga0070672_1000033166 307
369 3300005543 Ga0070672_100036024 Ga0070672_1000360244 307
370 3300005544 Ga0070686_100232709 Ga0070686_1002327091 307
371 3300005548 Ga0070665_100311598 Ga0070665_1003115982 307
372 3300005577 Ga0068857_100108772 Ga0068857_1001087721 307
373 3300005578 Ga0068854_100056458 Ga0068854_1000564582 307
374 3300005578 Ga0068854_100209536 Ga0068854_1002095361 307
375 3300005615 Ga0070702_100116456 Ga0070702_1001164562 307
376 3300005616 Ga0068852_100015916 Ga0068852_1000159165 307
377 3300005616 Ga0068852_100085186 Ga0068852_1000851862 307
378 3300005616 Ga0068852_100193068 Ga0068852_1001930682 307
379 3300005617 Ga0068859_100003584 Ga0068859_1000035849 307
380 3300005618 Ga0068864_100250749 Ga0068864_1002507492 307
381 3300005618 Ga0068864_100266262 Ga0068864_1002662622 307
382 3300005718 Ga0068866_10027317 Ga0068866_100273172 307
383 3300005719 Ga0068861_100017373 Ga0068861_1000173733 307
384 3300005834 Ga0068851_10028238 Ga0068851_100282383 307
385 3300005834 Ga0068851_10052516 Ga0068851_100525162 307
386 3300005841 Ga0068863_100002273 Ga0068863_10000227314 307
387 3300005841 Ga0068863_100237828 Ga0068863_1002378282 307
388 3300005842 Ga0068858_100002102 Ga0068858_1000021024 307
389 3300005842 Ga0068858_100034403 Ga0068858_1000344034 307
390 3300005842 Ga0068858_100035047 Ga0068858_1000350472 307
391 3300005842 Ga0068858_100046962 Ga0068858_1000469622 307
392 3300005843 Ga0068860_100007803 Ga0068860_1000078037 307
393 3300005843 Ga0068860_100009984 Ga0068860_1000099846 307
394 3300005843 Ga0068860_100052671 Ga0068860_1000526712 307
395 3300005843 Ga0068860_100151427 Ga0068860_1001514272 307
396 3300005844 Ga0068862_100045821 Ga0068862_1000458212 307
397 3300005844 Ga0068862_100108186 Ga0068862_1001081862 307
398 3300005844 Ga0068862_100448788 Ga0068862_1004487882 307
399 3300006177 Ga0075362_10004754 Ga0075362_100047544 307
400 3300006237 Ga0097621_100073590 Ga0097621_1000735903 307
401 3300006237 Ga0097621_100087007 Ga0097621_1000870072 307
402 3300006353 Ga0075370_10010827 Ga0075370_100108272 307
403 3300006358 Ga0068871_100018082 Ga0068871_1000180822 307
404 3300006358 Ga0068871_100221663 Ga0068871_1002216632 307
405 3300006358 Ga0068871_100301480 Ga0068871_1003014802 307
406 3300006881 Ga0068865_100008047 Ga0068865_1000080473 307
407 3300006881 Ga0068865_100099960 Ga0068865_1000999602 307
408 3300006931 Ga0097620_100003584 Ga0097620_1000035849 307
409 3300009098 Ga0105245_10346418 Ga0105245_103464182 307
410 3300009148 Ga0105243_10002282 Ga0105243_1000228215 307
411 3300009148 Ga0105243_10017318 Ga0105243_100173183 307
412 3300009148 Ga0105243_10321804 Ga0105243_103218042 307
413 3300009174 Ga0105241_10090870 Ga0105241_100908702 307
414 3300009177 Ga0105248_10020017 Ga0105248_100200174 307
415 3300009177 Ga0105248_10472930 Ga0105248_104729301 307
416 3300009545 Ga0105237_10432764 Ga0105237_104327642 307
417 3300009551 Ga0105238_10524415 Ga0105238_105244151 307
418 3300009553 Ga0105249_10013202 Ga0105249_100132023 307
419 3300009553 Ga0105249_10609062 Ga0105249_106090622 307
420 3300011119 Ga0105246_10125982 Ga0105246_101259821 307
421 3300013102 Ga0157371_10217466 Ga0157371_102174662 307
422 3300013104 Ga0157370_10019746 Ga0157370_100197463 307
423 3300013104 Ga0157370_10475861 Ga0157370_104758611 307
424 3300013105 Ga0157369_10002082 Ga0157369_1000208220 307
425 3300013296 Ga0157374_10041536 Ga0157374_100415362 307
426 3300013296 Ga0157374_10169426 Ga0157374_101694262 307
427 3300013306 Ga0163162_10278559 Ga0163162_102785592 307
428 3300013306 Ga0163162_10298191 Ga0163162_102981912 307
429 3300013308 Ga0157375_10011892 Ga0157375_100118923 307
430 3300013308 Ga0157375_10104814 Ga0157375_101048143 307
431 3300013308 Ga0157375_10139104 Ga0157375_101391043 307
432 3300014325 Ga0163163_10002764 Ga0163163_100027643 307
433 3300014326 Ga0157380_10197827 Ga0157380_101978272 307
434 3300014497 Ga0182008_10010913 Ga0182008_100109133 307
435 3300014745 Ga0157377_10223409 Ga0157377_102234091 307
436 3300014968 Ga0157379_10000632 Ga0157379_100006327 307
437 3300014968 Ga0157379_10016152 Ga0157379_100161522 307
438 3300014968 Ga0157379_10022399 Ga0157379_100223993 307
439 3300014968 Ga0157379_10049410 Ga0157379_100494104 307
440 3300014969 Ga0157376_10037068 Ga0157376_100370684 307
441 3300014969 Ga0157376_10432903 Ga0157376_104329032 307
442 3300017792 Ga0163161_10000092 Ga0163161_1000009237 307
443 3300017792 Ga0163161_10025313 Ga0163161_100253132 307
444 3300017792 Ga0163161_10068971 Ga0163161_100689712 307
445 3300025258 Ga0209129_1003474 Ga0209129_10034742 307
446 3300025291 Ga0209675_1006447 Ga0209675_10064473 307
447 3300025292 Ga0209676_1000301 Ga0209676_100030175 307
448 3300025294 Ga0209025_1000073 Ga0209025_1000073167 307
449 3300025294 Ga0209025_1000248 Ga0209025_1000248108 307
450 3300025298 Ga0209050_1012636 Ga0209050_10126363 307
451 3300025303 Ga0209051_1000541 Ga0209051_100054120 307
452 3300025304 Ga0209257_1007991 Ga0209257_10079912 307
453 3300025893 Ga0207682_10006348 Ga0207682_100063482 307
454 3300025899 Ga0207642_10033539 Ga0207642_100335392 307
455 3300025901 Ga0207688_10008823 Ga0207688_100088234 307
456 3300025903 Ga0207680_10009114 Ga0207680_100091142 307
457 3300025903 Ga0207680_10052435 Ga0207680_100524353 307
458 3300025905 Ga0207685_10073673 Ga0207685_100736732 307
459 3300025907 Ga0207645_10008037 Ga0207645_100080373 307
460 3300025907 Ga0207645_10010765 Ga0207645_100107652 307
461 3300025907 Ga0207645_10020197 Ga0207645_100201974 307
462 3300025907 Ga0207645_10035730 Ga0207645_100357302 307
463 3300025907 Ga0207645_10101313 Ga0207645_101013132 307
464 3300025909 Ga0207705_10166050 Ga0207705_101660502 307
465 3300025917 Ga0207660_10021106 Ga0207660_100211063 307
466 3300025918 Ga0207662_10061311 Ga0207662_100613112 307
467 3300025919 Ga0207657_10029882 Ga0207657_100298824 307
468 3300025919 Ga0207657_10116342 Ga0207657_101163422 307
469 3300025921 Ga0207652_10016058 Ga0207652_100160583 307
470 3300025923 Ga0207681_10004767 Ga0207681_100047677 307
471 3300025925 Ga0207650_10001000 Ga0207650_1000100020 307
472 3300025925 Ga0207650_10242427 Ga0207650_102424271 307
473 3300025926 Ga0207659_10001048 Ga0207659_100010488 307
474 3300025926 Ga0207659_10013986 Ga0207659_100139862 307
475 3300025926 Ga0207659_10179240 Ga0207659_101792402 307
476 3300025926 Ga0207659_10201677 Ga0207659_102016771 307
477 3300025927 Ga0207687_10124244 Ga0207687_101242442 307
478 3300025931 Ga0207644_10029760 Ga0207644_100297602 307
479 3300025931 Ga0207644_10051632 Ga0207644_100516321 307
480 3300025931 Ga0207644_10069994 Ga0207644_100699942 307
481 3300025931 Ga0207644_10140871 Ga0207644_101408712 307
482 3300025932 Ga0207690_10056869 Ga0207690_100568693 307
483 3300025933 Ga0207706_10006805 Ga0207706_100068052 307
484 3300025933 Ga0207706_10063411 Ga0207706_100634112 307
485 3300025934 Ga0207686_10244319 Ga0207686_102443191 307
486 3300025935 Ga0207709_10000467 Ga0207709_1000046723 307
487 3300025935 Ga0207709_10030408 Ga0207709_100304083 307
488 3300025936 Ga0207670_10050995 Ga0207670_100509952 307
489 3300025936 Ga0207670_10105529 Ga0207670_101055292 307
490 3300025937 Ga0207669_10324598 Ga0207669_103245982 307
491 3300025938 Ga0207704_10131606 Ga0207704_101316062 307
492 3300025940 Ga0207691_10001568 Ga0207691_1000156818 307
493 3300025940 Ga0207691_10003901 Ga0207691_100039016 307
494 3300025940 Ga0207691_10010473 Ga0207691_100104734 307
495 3300025940 Ga0207691_10021378 Ga0207691_100213784 307
496 3300025940 Ga0207691_10032483 Ga0207691_100324835 307
497 3300025940 Ga0207691_10241385 Ga0207691_102413852 307
498 3300025942 Ga0207689_10001729 Ga0207689_1000172929 307
499 3300025942 Ga0207689_10083637 Ga0207689_100836372 307
500 3300025949 Ga0207667_10022513 Ga0207667_100225134 307
501 3300025949 Ga0207667_10365390 Ga0207667_103653901 307
502 3300025960 Ga0207651_10001581 Ga0207651_100015817 307
503 3300025960 Ga0207651_10039672 Ga0207651_100396723 307
504 3300025961 Ga0207712_10004089 Ga0207712_100040893 307
505 3300025972 Ga0207668_10136427 Ga0207668_101364271 307
506 3300025972 Ga0207668_10277727 Ga0207668_102777272 307
507 3300025986 Ga0207658_10007808 Ga0207658_100078083 307
508 3300025986 Ga0207658_10009704 Ga0207658_100097042 307
509 3300025986 Ga0207658_10121953 Ga0207658_101219532 307
510 3300026023 Ga0207677_10010787 Ga0207677_100107873 307
511 3300026023 Ga0207677_10389108 Ga0207677_103891082 307
512 3300026023 Ga0207677_10395500 Ga0207677_103955002 307
513 3300026035 Ga0207703_10004561 Ga0207703_100045619 307
514 3300026035 Ga0207703_10005803 Ga0207703_100058033 307
515 3300026035 Ga0207703_10021193 Ga0207703_100211933 307
516 3300026035 Ga0207703_10060645 Ga0207703_100606455 307
517 3300026041 Ga0207639_10024775 Ga0207639_100247752 307
518 3300026088 Ga0207641_10006097 Ga0207641_100060973 307
519 3300026088 Ga0207641_10134804 Ga0207641_101348042 307
520 3300026089 Ga0207648_10016997 Ga0207648_100169973 307
521 3300026089 Ga0207648_10047268 Ga0207648_100472684 307
522 3300026089 Ga0207648_10322513 Ga0207648_103225132 307
523 3300026095 Ga0207676_10003710 Ga0207676_100037104 307
524 3300026095 Ga0207676_10101835 Ga0207676_101018352 307
525 3300026095 Ga0207676_10193792 Ga0207676_101937922 307
526 3300026116 Ga0207674_10086723 Ga0207674_100867231 307
527 3300026118 Ga0207675_100000267 Ga0207675_10000026720 307
528 3300026118 Ga0207675_100004220 Ga0207675_1000042209 307
529 3300026121 Ga0207683_10010011 Ga0207683_100100112 307
530 3300026121 Ga0207683_10024674 Ga0207683_100246743 307
531 3300026142 Ga0207698_10025696 Ga0207698_100256962 307
532 3300026142 Ga0207698_10067865 Ga0207698_100678652 307
533 3300026142 Ga0207698_10084910 Ga0207698_100849102 307
534 3300028380 Ga0268265_10064051 Ga0268265_100640512 307
535 3300028381 Ga0268264_10011894 Ga0268264_100118944 307
536 3300028381 Ga0268264_10029646 Ga0268264_100296463 307
537 3300028381 Ga0268264_10049503 Ga0268264_100495034 307
538 3300028381 Ga0268264_10077404 Ga0268264_100774042 307
539 3300031548 Ga0307408_100019166 Ga0307408_1000191662 307
540 3300031548 Ga0307408_100151922 Ga0307408_1001519222 307
541 3300031731 Ga0307405_10001548 Ga0307405_100015485 307
542 3300031731 Ga0307405_10016399 Ga0307405_100163993 307
543 3300031731 Ga0307405_10030887 Ga0307405_100308872 307
544 3300031901 Ga0307406_10006772 Ga0307406_100067722 307
545 3300031901 Ga0307406_10011607 Ga0307406_100116072 307
546 3300031903 Ga0307407_10058052 Ga0307407_100580521 307
547 3300031911 Ga0307412_10004436 Ga0307412_100044362 307
548 3300032002 Ga0307416_100015973 Ga0307416_1000159735 307
549 3300032002 Ga0307416_100025154 Ga0307416_1000251542 307
550 3300032126 Ga0307415_100088614 Ga0307415_1000886142 307
551 3300035089 Ga0373944_0029210 Ga0373944_0029210_584_1516 307
552 3300035092 Ga0373952_0018043 Ga0373952_0018043_483_1415 307
553 3300035118 Ga0373954_0112820 Ga0373954_0112820_369_1301 307
554 3300035121 Ga0373960_0048206 Ga0373960_0048206_53_985 307
555 3300035171 Ga0373946_0138848 Ga0373946_0138848_169_1101 307
556 3300035691 Ga0373931_0011667 Ga0373931_0011667_2584_3516 307
557 3300037068 Ga0373925_0029026 Ga0373925_0029026_2466_3398 307
558 3300037068 Ga0373925_0041133 Ga0373925_0041133_483_1415 307
559 3300042007 Ga0439449_0005452 Ga0439449_0005452_1142_2086 307
560 3300044901 Ga0466960_0017758 Ga0466960_0017758_796_1740 307
561 3300045051 Ga0451576_0222141 Ga0451576_0222141_42_974 307
562 3300046453 Ga0495627_012887 Ga0495627_012887_1535_2479 307
563 3300046460 Ga0495638_0004803 Ga0495638_0004803_4538_5461 307
564 3300046513 Ga0495616_0010436 Ga0495616_0010436_3208_4131 307
565 3300046515 Ga0495620_0016240 Ga0495620_0016240_1250_2194 307
566 3300046518 Ga0495631_0002314 Ga0495631_0002314_6358_7281 307
567 3300046520 Ga0495637_0020297 Ga0495637_0020297_824_1747 307
568 3300046543 Ga0495645_0117420 Ga0495645_0117420_899_1831 307
569 3300046543 Ga0495645_0121745 Ga0495645_0121745_207_1139 307
570 3300046558 Ga0495633_0046232 Ga0495633_0046232_444_1376 307
571 3300046616 Ga0495668_0053320 Ga0495668_0053320_40_984 307
572 3300046660 Ga0495625_0007255 Ga0495625_0007255_8374_9297 307
573 3300046681 Ga0495647_0085558 Ga0495647_0085558_192_1124 307
574 3300046683 Ga0495658_0030507 Ga0495658_0030507_1043_1975 307
575 3300046683 Ga0495658_0188615 Ga0495658_0188615_151_1083 307
576 3300046692 Ga0495671_0006863 Ga0495671_0006863_1652_2596 307
577 3300048903 Ga0496100_0021838 Ga0496100_0021838_1000_1932 307
578 3300048905 Ga0496102_0072865 Ga0496102_0072865_508_1440 307
579 3300048907 Ga0496104_0143768 Ga0496104_0143768_1219_2151 307
580 3300048908 Ga0496105_0204956 Ga0496105_0204956_159_1091 307
581 3300048909 Ga0496106_0178465 Ga0496106_0178465_225_1157 307
582 3300048910 Ga0496107_0007111 Ga0496107_0007111_5720_6652 307
583 3300048911 Ga0496108_0168300 Ga0496108_0168300_738_1670 307
584 3300048911 Ga0496108_0186215 Ga0496108_0186215_614_1546 307
585 3300048912 Ga0496109_0556093 Ga0496109_0556093_32_964 307
586 3300048914 Ga0496111_0281641 Ga0496111_0281641_248_1180 307
587 3300048917 Ga0496114_0060927 Ga0496114_0060927_1799_2731 307
588 3300048917 Ga0496114_0071290 Ga0496114_0071290_1687_2619 307
589 3300048919 Ga0496116_0085384 Ga0496116_0085384_244_1188 307
590 3300048920 Ga0496117_0009933 Ga0496117_0009933_3023_3967 307
591 3300048924 Ga0496121_0088726 Ga0496121_0088726_998_1921 307
592 3300048924 Ga0496121_0106814 Ga0496121_0106814_225_1148 307
593 3300050489 nmdc:mga03683_2335_c1 nmdc:mga03683_2335_c1_1551_2498 307
594 3300053077 Ga0495601_0059381 Ga0495601_0059381_227_1159 307
595 3300053079 Ga0500610_0007456 Ga0500610_0007456_1602_2546 307
596 3300053079 Ga0500610_0021950 Ga0500610_0021950_329_1273 307
597 3300053108 Ga0500562_009817 Ga0500562_009817_818_1741 307
598 3300053117 Ga0500593_001561 Ga0500593_001561_3228_4172 307
599 3300053118 Ga0500594_0001099 Ga0500594_0001099_2078_3001 307
600 3300053121 Ga0500607_004625 Ga0500607_004625_6528_7472 307
601 3300053121 Ga0500607_051948 Ga0500607_051948_1150_2163 307
602 3300053134 Ga0500658_0000986 Ga0500658_0000986_6712_7635 307
603 3300053136 Ga0500559_0012541 Ga0500559_0012541_2007_2930 307
604 3300053139 Ga0500568_0004310 Ga0500568_0004310_3641_4564 307
605 3300053153 Ga0500616_0032665 Ga0500616_0032665_51_974 307
606 3300053158 Ga0500627_0001689 Ga0500627_0001689_1861_2805 307
607 3300053161 Ga0500634_0014262 Ga0500634_0014262_1075_2019 307
608 3300001979 JGI24740J21852_10047029 JGI24740J21852_100470292 310
609 3300002773 JGI25152J39213_1002976 JGI25152J39213_10029767 310
610 3300002774 JGI25150J39212_1001199 JGI25150J39212_10011995 310
611 3300002987 JGI25159J45721_1004050 JGI25159J45721_10040502 310
612 3300003187 JGI25151J46595_10006242 JGI25151J46595_100062427 310
613 3300003215 JGI25153J46596_10005241 JGI25153J46596_100052418 310
614 3300003354 JGI25160J50197_1005994 JGI25160J50197_10059945 310
615 3300003374 JGI25161J50226_1002303 JGI25161J50226_10023032 310
616 3300003761 Ga0055535_1002054 Ga0055535_10020546 310
617 3300003762 Ga0055542_1000039 Ga0055542_100003935 310
618 3300003771 Ga0055526_1008769 Ga0055526_10087695 310
619 3300003773 Ga0055537_1003324 Ga0055537_10033245 310
620 3300003775 Ga0055524_1006686 Ga0055524_10066865 310
621 3300003784 Ga0055534_1003471 Ga0055534_10034712 310
622 3300003790 Ga0055528_1007145 Ga0055528_10071455 310
623 3300003792 Ga0055540_1011347 Ga0055540_10113472 310
624 3300003794 Ga0055531_10037724 Ga0055531_100377242 310
625 3300004625 Ga0055543_1002488 Ga0055543_10024887 310
626 3300005262 Ga0065165_1006562 Ga0065165_10065622 310
627 3300009093 Ga0105240_10470388 Ga0105240_104703882 310
628 3300013104 Ga0157370_10296440 Ga0157370_102964402 310
629 3300025208 Ga0209436_102759 Ga0209436_1027595 310
630 3300025228 Ga0209672_100930 Ga0209672_10093015 310
631 3300025229 Ga0209147_101551 Ga0209147_1015515 310
632 3300025242 Ga0209258_100099 Ga0209258_100099178 310
633 3300025245 Ga0207425_1000365 Ga0207425_100036527 310
634 3300025254 Ga0209148_1000103 Ga0209148_1000103178 310
635 3300025258 Ga0209129_1000007 Ga0209129_1000007418 310
636 3300025258 Ga0209129_1002036 Ga0209129_10020366 310
637 3300025263 Ga0209565_1000199 Ga0209565_100019955 310
638 3300025273 Ga0209673_1000304 Ga0209673_100030424 310
639 3300025284 Ga0209130_1000321 Ga0209130_100032139 310
640 3300025291 Ga0209675_1000298 Ga0209675_100029825 310
641 3300025294 Ga0209025_1001298 Ga0209025_100129810 310
642 3300025295 Ga0209564_1000603 Ga0209564_100060339 310
643 3300025297 Ga0209758_1000025 Ga0209758_1000025108 310
644 3300025299 Ga0209256_1000050 Ga0209256_1000050174 310
645 3300025302 Ga0207426_1000001 Ga0207426_1000001529 310
646 3300025304 Ga0209257_1004309 Ga0209257_10043096 310
647 3300025981 Ga0207640_10147026 Ga0207640_101470262 310
648 3300026041 Ga0207639_10018046 Ga0207639_100180465 310
649 3300048920 Ga0496117_0188537 Ga0496117_0188537_44_976 310
650 3300048921 Ga0496118_0142612 Ga0496118_0142612_202_1134 310
651 3300048926 Ga0496123_0147016 Ga0496123_0147016_77_1009 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

40

289

0.86

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

45

282

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3njd-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase from mycobacterium smegmatis 0.9298 3 285
3njb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase from mycobacterium smegmatis, iodide soak 0.9291 3 285
3t3w-assembly1.cif.gz_B crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile 0.9273 6 259
3ome-assembly1.cif.gz_E crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis 0.9269 4 259
4k29-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase/isomerase from xanthobacter autotrophicus py2 0.9226 3 289
ID Description Score Start End Superfamily
af_O07179_3_289_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9333 1 285 3.90.226.10
3njdB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9298 3 285 3.90.226.10
3omeC00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9262 2 259 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9072 2 223 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9029 2 223 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1V3WGM1-F1-model_v4 Enoyl-CoA hydratase 0.9855 101 285 GO:0006631
AF-A0A7C7PEJ1-F1-model_v4 Enoyl-CoA hydratase 0.9815 143 285
AF-A0A814XMD0-F1-model_v4 Enoyl-CoA hydratase 0.9779 3 286
AF-A0A368E8Z7-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9768 4 286 GO:0004300
AF-A0A651GWD9-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9744 4 275 GO:0004300
GO:0006631

Feature Viewer

pLDDT pTM Quality
91.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map