F472602

General Info

Members Datasets Scaffolds Average Seq Length
651 351 1302 216

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10577259|Ga0207661_105772592
Length 230
Sequence VKTDVFSFAPFAEEVMSKLKISSFSISIDGFGAGPAQSLENPLGLGGTQLHEWAFATRTFQRMFGNEGGETGTDDDFAARGFENIGAWIMGRNMFGPVRGPWPDETWKGWWGNNPPYHTPVFVLSHHPRAPIVMEGGTTFEFVTAGIHAALEKATAAAQGRDIRLGGGVATIREYLQAGLVDEMHLAISPAILGSGEHLLGGIDLVKLGFRCTEHAATPKATHVILTRKR

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
277 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
278 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
344 2643221556 Massilia sp. Root1485 Isolate Unclassified
345 2643221684 Massilia sp. Root133 Isolate Unclassified
346 2738541337 Pelomonas sp. BT06 Isolate Unclassified
347 2791355260 Rhizobium sp. L9 Isolate Nodule
348 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
349 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
350 2904424332 Duganella sp. 1411 Isolate Rhizosphere
351 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0.15
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0.15
Rhizoplane 3.99
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10577259 3300025944 Bacteria 1031
2 JGI25406J46586_10001197 3300003203 Bacteria 12210
3 rootL2_10027771 3300003322 Bacteria 7634
4 rootL2_10054306 3300003322 Bacteria 5137
5 rootL2_10091597 3300003322 Bacteria 1602
6 rootH1_10055722 3300003323 Bacteria 3585
7 Ga0065165_1002492 3300005262 Bacteria 15437
8 Ga0065165_1013808 3300005262 Bacteria 3181
9 Ga0065712_10134503 3300005290 Bacteria 1512
10 Ga0065707_10040339 3300005295 Bacteria 904
11 Ga0070658_10024394 3300005327 Bacteria 4851
12 Ga0070676_10008198 3300005328 Bacteria 5622
13 Ga0070676_10009376 3300005328 Bacteria 5290
14 Ga0070690_100127247 3300005330 Bacteria 1716
15 Ga0070690_100626752 3300005330 Bacteria 819
16 Ga0070670_100094777 3300005331 Bacteria 2567
17 Ga0070677_10158214 3300005333 Bacteria 1061
18 Ga0068869_100003195 3300005334 Bacteria 10012
19 Ga0068869_100016813 3300005334 Bacteria 4942
20 Ga0070666_10008823 3300005335 Bacteria 6268
21 Ga0070680_100281145 3300005336 Bacteria 1410
22 Ga0070660_100015927 3300005339 Bacteria 5444
23 Ga0070689_100472999 3300005340 Bacteria 1069
24 Ga0070687_100045346 3300005343 Bacteria 2245
25 Ga0070661_100002899 3300005344 Bacteria 11811
26 Ga0070661_100244263 3300005344 Bacteria 1383
27 Ga0070668_100000574 3300005347 Bacteria 24639
28 Ga0070668_100088445 3300005347 Bacteria 2439
29 Ga0070668_100108246 3300005347 Bacteria 2210
30 Ga0070669_100000765 3300005353 Bacteria 23385
31 Ga0070669_100002931 3300005353 Bacteria 12296
32 Ga0070669_100314309 3300005353 Bacteria 1264
33 Ga0070675_100002140 3300005354 Bacteria 14611
34 Ga0070675_100049796 3300005354 Bacteria 3439
35 Ga0070675_100098419 3300005354 Bacteria 2460
36 Ga0070671_100362960 3300005355 Bacteria 1237
37 Ga0070671_100431307 3300005355 Bacteria 1129
38 Ga0070674_100011152 3300005356 Bacteria 5459
39 Ga0070673_100050730 3300005364 Bacteria 3245
40 Ga0070673_100054587 3300005364 Bacteria 3143
41 Ga0070673_100189764 3300005364 Bacteria 1764
42 Ga0070673_100283758 3300005364 Bacteria 1453
43 Ga0070673_100290054 3300005364 Bacteria 1437
44 Ga0070688_100069415 3300005365 Bacteria 2250
45 Ga0070659_100043712 3300005366 Bacteria 3504
46 Ga0070659_100098610 3300005366 Bacteria 2350
47 Ga0070667_100007739 3300005367 Bacteria 8908
48 Ga0070667_100112647 3300005367 Bacteria 2360
49 Ga0070713_100077183 3300005436 Bacteria 2831
50 Ga0070701_10030817 3300005438 Bacteria 2657
51 Ga0070700_100006109 3300005441 Bacteria 6417
52 Ga0070700_100452926 3300005441 Unclassified 977
53 Ga0070694_100605285 3300005444 Bacteria 883
54 Ga0070708_100239078 3300005445 Bacteria 1705
55 Ga0070663_100046491 3300005455 Bacteria 3071
56 Ga0070663_100074650 3300005455 Bacteria 2476
57 Ga0070678_100015798 3300005456 Bacteria 4808
58 Ga0070678_100093070 3300005456 Bacteria 2317
59 Ga0070678_100314383 3300005456 Bacteria 1335
60 Ga0070678_100540255 3300005456 Bacteria 1033
61 Ga0070662_100000783 3300005457 Bacteria 19529
62 Ga0070662_100003414 3300005457 Bacteria 9901
63 Ga0070662_100114029 3300005457 Bacteria 2063
64 Ga0068867_100005514 3300005459 Bacteria 8955
65 Ga0070685_10006909 3300005466 Bacteria 5793
66 Ga0070685_10273431 3300005466 Bacteria 1128
67 Ga0070707_100154998 3300005468 Bacteria 2232
68 Ga0070699_100020444 3300005518 Bacteria 5709
69 Ga0070699_100344869 3300005518 Bacteria 1341
70 Ga0070684_100013866 3300005535 Bacteria 6511
71 Ga0070684_100112329 3300005535 Bacteria 2444
72 Ga0068853_100005136 3300005539 Bacteria 10235
73 Ga0070672_100005134 3300005543 Bacteria 8642
74 Ga0070672_100079864 3300005543 Bacteria 2619
75 Ga0070672_100133928 3300005543 Bacteria 2039
76 Ga0070672_100175199 3300005543 Bacteria 1785
77 Ga0070686_100452398 3300005544 Unclassified 987
78 Ga0070665_100461152 3300005548 Bacteria 1281
79 Ga0068855_100008710 3300005563 Bacteria 12265
80 Ga0068855_100047031 3300005563 Bacteria 5099
81 Ga0070664_100001492 3300005564 Bacteria 18638
82 Ga0070664_100213965 3300005564 Bacteria 1723
83 Ga0070664_100657232 3300005564 Bacteria 974
84 Ga0068857_100000223 3300005577 Bacteria 37628
85 Ga0068857_100016081 3300005577 Bacteria 6555
86 Ga0068856_100000233 3300005614 Bacteria 60306
87 Ga0070702_100497747 3300005615 Bacteria 894
88 Ga0068852_100001585 3300005616 Bacteria 15462
89 Ga0068852_100003813 3300005616 Bacteria 10582
90 Ga0068852_100008232 3300005616 Bacteria 7665
91 Ga0068852_100051386 3300005616 Bacteria 3537
92 Ga0068852_100055860 3300005616 Bacteria 3409
93 Ga0068852_100287673 3300005616 Bacteria 1586
94 Ga0068852_100293144 3300005616 Bacteria 1572
95 Ga0068859_100104541 3300005617 Bacteria 2891
96 Ga0068859_100275730 3300005617 Bacteria 1774
97 Ga0068864_100134405 3300005618 Bacteria 2225
98 Ga0068864_100428668 3300005618 Bacteria 1261
99 Ga0068864_101357713 3300005618 Bacteria 712
100 Ga0068866_10002119 3300005718 Bacteria 8255
101 Ga0068861_100001729 3300005719 Bacteria 14004
102 Ga0068861_100004658 3300005719 Bacteria 9211
103 Ga0068861_100053641 3300005719 Bacteria 3068
104 Ga0068851_10015869 3300005834 Bacteria 3595
105 Ga0068851_10042740 3300005834 Bacteria 2282
106 Ga0068870_10268516 3300005840 Bacteria 1065
107 Ga0068863_100001215 3300005841 Bacteria 25740
108 Ga0068863_100012982 3300005841 Bacteria 8033
109 Ga0068863_100018013 3300005841 Bacteria 6761
110 Ga0068863_100041920 3300005841 Bacteria 4350
111 Ga0068863_100555689 3300005841 Bacteria 1134
112 Ga0068858_100011059 3300005842 Bacteria 8532
113 Ga0068858_100594133 3300005842 Unclassified 1073
114 Ga0068860_100009850 3300005843 Bacteria 9480
115 Ga0068860_100434683 3300005843 Bacteria 1303
116 Ga0068862_100007098 3300005844 Bacteria 9305
117 Ga0068862_100020474 3300005844 Bacteria 5526
118 Ga0081540_1010528 3300005983 Bacteria 6250
119 Ga0081540_1011231 3300005983 Bacteria 6003
120 Ga0081539_10002106 3300005985 Bacteria 29503
121 Ga0081539_10017714 3300005985 Bacteria 4985
122 Ga0075364_10007757 3300006051 Bacteria 6392
123 Ga0075366_10014006 3300006195 Bacteria 4574
124 Ga0075366_10094432 3300006195 Bacteria 1793
125 Ga0075366_10360109 3300006195 Bacteria 893
126 Ga0097621_100233119 3300006237 Bacteria 1607
127 Ga0075370_10105980 3300006353 Bacteria 1629
128 Ga0075430_100009271 3300006846 Bacteria 8317
129 Ga0075431_100006662 3300006847 Bacteria 11473
130 Ga0075433_10136374 3300006852 Bacteria 2181
131 Ga0075433_10478595 3300006852 Bacteria 1097
132 Ga0075429_100820861 3300006880 Bacteria 814
133 Ga0068865_100003044 3300006881 Bacteria 10022
134 Ga0068865_100086587 3300006881 Bacteria 2262
135 Ga0097620_100104540 3300006931 Bacteria 2891
136 Ga0097620_100275734 3300006931 Bacteria 1774
137 Ga0105244_10194078 3300009036 Bacteria 959
138 Ga0105240_10033636 3300009093 Bacteria 6619
139 Ga0105240_10343586 3300009093 Bacteria 1695
140 Ga0105240_10697331 3300009093 Bacteria 1109
141 Ga0111539_10004167 3300009094 Bacteria 18959
142 Ga0105245_10087074 3300009098 Bacteria 2866
143 Ga0105245_11171294 3300009098 Bacteria 816
144 Ga0114129_10244340 3300009147 Bacteria 2412
145 Ga0105243_10015973 3300009148 Bacteria 5677
146 Ga0105243_10033833 3300009148 Bacteria 3953
147 Ga0105243_11065297 3300009148 Bacteria 815
148 Ga0105242_10076586 3300009176 Bacteria 2789
149 Ga0105242_10378330 3300009176 Bacteria 1315
150 Ga0105248_10027004 3300009177 Bacteria 6386
151 Ga0105248_10294006 3300009177 Bacteria 1829
152 Ga0105248_10477784 3300009177 Bacteria 1405
153 Ga0105249_10013028 3300009553 Bacteria 7338
154 Ga0099796_10020039 3300010159 Bacteria 2038
155 Ga0157373_10336949 3300013100 Bacteria 1074
156 Ga0157371_10054470 3300013102 Bacteria 2841
157 Ga0157369_10386620 3300013105 Bacteria 1452
158 Ga0157374_10012857 3300013296 Bacteria 7291
159 Ga0157374_10032897 3300013296 Bacteria 4726
160 Ga0157378_11117195 3300013297 Bacteria 826
161 Ga0163162_10000769 3300013306 Bacteria 29806
162 Ga0163162_10009068 3300013306 Bacteria 9673
163 Ga0157372_10267770 3300013307 Bacteria 1985
164 Ga0157372_10654979 3300013307 Bacteria 1223
165 Ga0157375_10004451 3300013308 Bacteria 12165
166 Ga0157375_10010853 3300013308 Bacteria 8029
167 Ga0157375_10098672 3300013308 Bacteria 2998
168 Ga0163163_10004692 3300014325 Bacteria 11702
169 Ga0163163_10311894 3300014325 Bacteria 1626
170 Ga0157380_10004895 3300014326 Bacteria 9332
171 Ga0157380_10020507 3300014326 Bacteria 4940
172 Ga0157380_10064490 3300014326 Bacteria 2941
173 Ga0157380_11087100 3300014326 Bacteria 838
174 Ga0182008_10099300 3300014497 Bacteria 1438
175 Ga0157377_10243610 3300014745 Bacteria 1162
176 Ga0157379_10042066 3300014968 Bacteria 4078
177 Ga0157379_10224998 3300014968 Bacteria 1700
178 Ga0183362_10002 3300015683 Bacteria 1432711
179 Ga0163161_10002372 3300017792 Bacteria 13495
180 Ga0163161_10094713 3300017792 Bacteria 2214
181 Ga0163161_10158155 3300017792 Bacteria 1726
182 Ga0206353_10927837 3300020082 Bacteria 2108
183 Ga0209564_1024324 3300025295 Bacteria 2073
184 Ga0207697_10039525 3300025315 Bacteria 1935
185 Ga0207697_10110172 3300025315 Bacteria 1178
186 Ga0207656_10090576 3300025321 Bacteria 1388
187 Ga0207682_10081342 3300025893 Bacteria 1389
188 Ga0207642_10027248 3300025899 Bacteria 2337
189 Ga0207688_10427838 3300025901 Bacteria 823
190 Ga0207647_10025339 3300025904 Bacteria 3899
191 Ga0207645_10001466 3300025907 Bacteria 19278
192 Ga0207645_10004020 3300025907 Bacteria 10965
193 Ga0207643_10247080 3300025908 Bacteria 1098
194 Ga0207705_10006844 3300025909 Bacteria 8424
195 Ga0207705_10008375 3300025909 Bacteria 7550
196 Ga0207707_10360714 3300025912 Bacteria 1251
197 Ga0207707_10802301 3300025912 Bacteria 784
198 Ga0207695_10106857 3300025913 Bacteria 2784
199 Ga0207663_10347038 3300025916 Bacteria 1123
200 Ga0207660_10246050 3300025917 Bacteria 1410
201 Ga0207662_10019987 3300025918 Bacteria 3817
202 Ga0207662_10049144 3300025918 Bacteria 2501
203 Ga0207657_10007757 3300025919 Bacteria 10960
204 Ga0207657_10021906 3300025919 Bacteria 6001
205 Ga0207657_10132680 3300025919 Bacteria 2040
206 Ga0207649_10004404 3300025920 Bacteria 7640
207 Ga0207652_10207532 3300025921 Bacteria 1763
208 Ga0207652_10847863 3300025921 Bacteria 809
209 Ga0207681_10000340 3300025923 Bacteria 33613
210 Ga0207681_10060318 3300025923 Bacteria 2603
211 Ga0207650_10056224 3300025925 Bacteria 2923
212 Ga0207659_10011262 3300025926 Bacteria 5646
213 Ga0207659_10089935 3300025926 Bacteria 2290
214 Ga0207687_10065552 3300025927 Bacteria 2579
215 Ga0207687_10075001 3300025927 Bacteria 2426
216 Ga0207700_10101063 3300025928 Bacteria 2300
217 Ga0207644_10144510 3300025931 Bacteria 1835
218 Ga0207690_10554807 3300025932 Bacteria 934
219 Ga0207690_10594783 3300025932 Bacteria 902
220 Ga0207706_10002793 3300025933 Bacteria 16963
221 Ga0207706_10025515 3300025933 Bacteria 5295
222 Ga0207706_10068785 3300025933 Bacteria 3115
223 Ga0207686_10003830 3300025934 Bacteria 8067
224 Ga0207686_10038506 3300025934 Bacteria 2894
225 Ga0207709_10078676 3300025935 Bacteria 2118
226 Ga0207709_10142024 3300025935 Bacteria 1651
227 Ga0207670_10144375 3300025936 Bacteria 1758
228 Ga0207669_10005760 3300025937 Bacteria 5594
229 Ga0207704_10003619 3300025938 Bacteria 7016
230 Ga0207704_10067479 3300025938 Bacteria 2250
231 Ga0207704_10162713 3300025938 Bacteria 1590
232 Ga0207691_10000481 3300025940 Bacteria 39553
233 Ga0207691_10044292 3300025940 Bacteria 4097
234 Ga0207691_10085217 3300025940 Bacteria 2836
235 Ga0207691_10260662 3300025940 Bacteria 1494
236 Ga0207711_10013198 3300025941 Bacteria 6863
237 Ga0207711_10259372 3300025941 Bacteria 1597
238 Ga0207689_10002255 3300025942 Bacteria 18068
239 Ga0207689_10027062 3300025942 Bacteria 4800
240 Ga0207661_10102718 3300025944 Bacteria 2404
241 Ga0207679_10008470 3300025945 Bacteria 6550
242 Ga0207679_10044727 3300025945 Bacteria 3197
243 Ga0207679_10706342 3300025945 Bacteria 915
244 Ga0207712_10003827 3300025961 Bacteria 9501
245 Ga0207712_10007809 3300025961 Bacteria 6762
246 Ga0207668_10008601 3300025972 Bacteria 6093
247 Ga0207668_10239362 3300025972 Bacteria 1467
248 Ga0207668_10645974 3300025972 Bacteria 926
249 Ga0207658_10000756 3300025986 Bacteria 27753
250 Ga0207677_10041185 3300026023 Bacteria 3052
251 Ga0207703_10001349 3300026035 Bacteria 22464
252 Ga0207639_10259996 3300026041 Bacteria 1518
253 Ga0207639_10386896 3300026041 Bacteria 1257
254 Ga0207678_10036525 3300026067 Bacteria 4276
255 Ga0207678_10169207 3300026067 Bacteria 1866
256 Ga0207678_10285260 3300026067 Bacteria 1418
257 Ga0207708_10002372 3300026075 Bacteria 13837
258 Ga0207708_10641043 3300026075 Bacteria 903
259 Ga0207702_10000577 3300026078 Bacteria 40792
260 Ga0207702_11166354 3300026078 Bacteria 764
261 Ga0207641_10005453 3300026088 Bacteria 10853
262 Ga0207641_10009111 3300026088 Bacteria 8198
263 Ga0207641_10011616 3300026088 Bacteria 7231
264 Ga0207641_10110562 3300026088 Bacteria 2435
265 Ga0207648_10002846 3300026089 Bacteria 18315
266 Ga0207648_10176800 3300026089 Bacteria 1888
267 Ga0207676_10049440 3300026095 Bacteria 3271
268 Ga0207676_10208514 3300026095 Bacteria 1732
269 Ga0207676_10348940 3300026095 Bacteria 1368
270 Ga0207676_10364508 3300026095 Bacteria 1340
271 Ga0207674_10000571 3300026116 Bacteria 48350
272 Ga0207674_10010814 3300026116 Bacteria 10290
273 Ga0207675_100000450 3300026118 Bacteria 39881
274 Ga0207675_100003938 3300026118 Bacteria 14411
275 Ga0207675_100518626 3300026118 Bacteria 1188
276 Ga0207683_10035993 3300026121 Bacteria 4308
277 Ga0207683_10116160 3300026121 Bacteria 2399
278 Ga0207683_10207273 3300026121 Bacteria 1783
279 Ga0207683_10392242 3300026121 Bacteria 1277
280 Ga0207698_10000978 3300026142 Bacteria 16625
281 Ga0207698_10005678 3300026142 Bacteria 7726
282 Ga0207698_10019541 3300026142 Bacteria 4641
283 Ga0268265_10014242 3300028380 Bacteria 5417
284 Ga0268265_10072385 3300028380 Bacteria 2688
285 Ga0268264_10011337 3300028381 Bacteria 7365
286 Ga0268264_10125645 3300028381 Bacteria 2266
287 Ga0265319_1003521 3300028563 Bacteria 8133
288 Ga0265319_1006243 3300028563 Bacteria 5547
289 Ga0265334_10126410 3300028573 Bacteria 912
290 Ga0265318_10000412 3300028577 Bacteria 33039
291 Ga0307515_10000043 3300028794 Bacteria 304612
292 Ga0307515_10089387 3300028794 Bacteria 3879
293 Ga0265338_10151912 3300028800 Bacteria 1798
294 Ga0265330_10000345 3300031235 Bacteria 33039
295 Ga0265330_10000624 3300031235 Bacteria 22852
296 Ga0265332_10000406 3300031238 Bacteria 31160
297 Ga0265332_10000614 3300031238 Bacteria 23207
298 Ga0265332_10120583 3300031238 Bacteria 1102
299 Ga0265328_10004041 3300031239 Bacteria 6420
300 Ga0265320_10000433 3300031240 Bacteria 33039
301 Ga0265320_10001865 3300031240 Bacteria 14925
302 Ga0265320_10013162 3300031240 Bacteria 4769
303 Ga0265325_10047554 3300031241 Bacteria 2220
304 Ga0265329_10007656 3300031242 Bacteria 4157
305 Ga0265331_10000573 3300031250 Bacteria 33039
306 Ga0265331_10001570 3300031250 Bacteria 16712
307 Ga0265316_10005925 3300031344 Bacteria 11769
308 Ga0265316_10029349 3300031344 Bacteria 4524
309 Ga0265313_10000755 3300031595 Bacteria 33039
310 Ga0265313_10002098 3300031595 Bacteria 17772
311 Ga0265313_10036387 3300031595 Bacteria 2471
312 Ga0307508_10000096 3300031616 Bacteria 103730
313 Ga0316579_10185865 3300031691 Bacteria 1005
314 Ga0265314_10001005 3300031711 Bacteria 33039
315 Ga0265314_10001934 3300031711 Bacteria 22116
316 Ga0265314_10015645 3300031711 Bacteria 6014
317 Ga0265342_10002483 3300031712 Bacteria 15893
318 Ga0265342_10010321 3300031712 Bacteria 6494
319 Ga0316578_10217856 3300031728 Bacteria 1148
320 Ga0307405_10746366 3300031731 Bacteria 815
321 Ga0307413_10225434 3300031824 Bacteria 1372
322 Ga0307413_10308756 3300031824 Bacteria 1203
323 Ga0307406_10375483 3300031901 Bacteria 1119
324 Ga0307406_10466191 3300031901 Bacteria 1017
325 Ga0307407_10147327 3300031903 Bacteria 1526
326 Ga0307412_10448459 3300031911 Bacteria 1062
327 Ga0307412_10690586 3300031911 Bacteria 875
328 Ga0307409_100215933 3300031995 Bacteria 1728
329 Ga0307409_100279673 3300031995 Unclassified 1542
330 Ga0307416_100219733 3300032002 Bacteria 1821
331 Ga0307416_100342597 3300032002 Bacteria 1508
332 Ga0307416_101131994 3300032002 Bacteria 888
333 Ga0307414_10491420 3300032004 Bacteria 1084
334 Ga0307411_10260085 3300032005 Bacteria 1370
335 Ga0307411_10278969 3300032005 Bacteria 1329
336 Ga0307411_10498596 3300032005 Bacteria 1029
337 Ga0307415_100347096 3300032126 Bacteria 1248
338 Ga0373939_0249952 3300035114 Bacteria 690
339 Ga0373956_0122156 3300035119 Bacteria 1217
340 Ga0373955_0005149 3300035172 Bacteria 5848
341 Ga0373935_0045836 3300035692 Bacteria 2760
342 Ga0373925_0237970 3300037068 Bacteria 1457
343 Ga0395899_0022522 3300037312 Bacteria 4775
344 Ga0395899_0029567 3300037312 Bacteria 4121
345 Ga0395899_0367839 3300037312 Bacteria 958
346 Ga0395900_0002740 3300037418 Bacteria 19253
347 Ga0395900_0032713 3300037418 Bacteria 5348
348 Ga0395900_0062721 3300037418 Bacteria 3820
349 Ga0395900_0482881 3300037418 Bacteria 1191
350 Ga0395898_0083998 3300037466 Bacteria 3069
351 Ga0395898_0109850 3300037466 Bacteria 2643
352 Ga0395905_0014949 3300037471 Bacteria 7404
353 Ga0395905_0057275 3300037471 Bacteria 3646
354 Ga0395905_0111218 3300037471 Bacteria 2572
355 Ga0395901_0002267 3300038443 Bacteria 19632
356 Ga0395901_0130418 3300038443 Bacteria 2641
357 Ga0395901_0336351 3300038443 Bacteria 1560
358 Ga0395901_0969797 3300038443 Bacteria 828
359 Ga0436361_0106978 3300039447 Bacteria 9029
360 Ga0436361_0561101 3300039447 Bacteria 4247
361 Ga0451797_0421985 3300041453 Bacteria 1092
362 Ga0451800_0732284 3300041459 Bacteria 816
363 Ga0451807_0601123 3300041486 Bacteria 831
364 Ga0439448_0029711 3300042005 Bacteria 1731
365 Ga0439435_0096948 3300042436 Bacteria 902
366 Ga0451577_0199955 3300042876 Bacteria 1804
367 Ga0466969_0042599 3300044656 Bacteria 2265
368 Ga0466972_0000929 3300044658 Bacteria 14095
369 Ga0453683_0003988 3300044673 Bacteria 10673
370 Ga0453683_0266213 3300044673 Bacteria 1094
371 Ga0466965_0006307 3300044683 Bacteria 5373
372 Ga0466965_0006393 3300044683 Bacteria 5347
373 Ga0466966_0059651 3300044684 Bacteria 2409
374 Ga0466966_0114587 3300044684 Bacteria 1660
375 Ga0466966_0378601 3300044684 Bacteria 850
376 Ga0466961_0013520 3300044693 Bacteria 5226
377 Ga0466961_0371731 3300044693 Bacteria 869
378 Ga0466964_0001168 3300044706 Bacteria 8877
379 Ga0466964_0047079 3300044706 Bacteria 1759
380 Ga0453684_0022196 3300044712 Bacteria 9433
381 Ga0466971_0053378 3300044719 Bacteria 1821
382 Ga0466971_0175691 3300044719 Bacteria 1006
383 Ga0466970_0159370 3300044765 Bacteria 1248
384 Ga0466957_0000301 3300044842 Bacteria 24184
385 Ga0466957_0029441 3300044842 Bacteria 3274
386 Ga0466957_0147278 3300044842 Bacteria 1520
387 Ga0466957_0176358 3300044842 Bacteria 1394
388 Ga0466957_0229855 3300044842 Bacteria 1228
389 Ga0466957_0711135 3300044842 Bacteria 709
390 Ga0466960_0113618 3300044901 Bacteria 1410
391 Ga0466959_0029619 3300045049 Bacteria 4056
392 Ga0466959_0033854 3300045049 Bacteria 3779
393 Ga0466959_0107663 3300045049 Bacteria 1992
394 Ga0466959_0162681 3300045049 Bacteria 1568
395 Ga0451576_0016907 3300045051 Bacteria 8034
396 Ga0466958_0270156 3300045836 Bacteria 1089
397 Ga0466967_0442515 3300045976 Bacteria 1269
398 Ga0495617_000055 3300046452 Bacteria 102065
399 Ga0495627_000123 3300046453 Bacteria 94862
400 Ga0495590_0005483 3300046457 Bacteria 5028
401 Ga0495590_0166937 3300046457 Bacteria 801
402 Ga0495629_0016433 3300046459 Bacteria 5313
403 Ga0495638_0010532 3300046460 Bacteria 6407
404 Ga0495653_0004577 3300046463 Bacteria 11177
405 Ga0495653_0046362 3300046463 Bacteria 3366
406 Ga0495580_0022065 3300046472 Bacteria 4691
407 Ga0495582_0087705 3300046473 Bacteria 1732
408 Ga0495582_0127194 3300046473 Bacteria 1438
409 Ga0495605_0000035 3300046474 Bacteria 208069
410 Ga0495605_0000295 3300046474 Bacteria 54687
411 Ga0495584_0000269 3300046491 Bacteria 36879
412 Ga0495584_0005974 3300046491 Bacteria 6412
413 Ga0495584_0090251 3300046491 Bacteria 1545
414 Ga0495584_0263438 3300046491 Bacteria 876
415 Ga0495585_0001645 3300046492 Bacteria 17084
416 Ga0495585_0017999 3300046492 Bacteria 4076
417 Ga0495585_0034628 3300046492 Bacteria 2855
418 Ga0495585_0037463 3300046492 Bacteria 2731
419 Ga0495585_0043338 3300046492 Bacteria 2517
420 Ga0495585_0070487 3300046492 Bacteria 1906
421 Ga0495585_0156323 3300046492 Bacteria 1186
422 Ga0495594_0138356 3300046499 Bacteria 1380
423 Ga0495596_0007503 3300046500 Bacteria 4917
424 Ga0495596_0017215 3300046500 Bacteria 2996
425 Ga0495596_0022359 3300046500 Bacteria 2575
426 Ga0495596_0029961 3300046500 Bacteria 2180
427 Ga0495596_0064843 3300046500 Bacteria 1421
428 Ga0495607_0001166 3300046501 Bacteria 23766
429 Ga0495607_0003986 3300046501 Bacteria 11098
430 Ga0495607_0012237 3300046501 Bacteria 5671
431 Ga0495607_0088538 3300046501 Bacteria 1682
432 Ga0495607_0116750 3300046501 Bacteria 1407
433 Ga0495583_0000903 3300046506 Bacteria 35338
434 Ga0495583_0001133 3300046506 Bacteria 29196
435 Ga0495606_0002110 3300046507 Bacteria 24150
436 Ga0495606_0006889 3300046507 Bacteria 10351
437 Ga0495606_0009787 3300046507 Bacteria 8055
438 Ga0495606_0047018 3300046507 Bacteria 2848
439 Ga0495616_0011495 3300046513 Bacteria 5068
440 Ga0495616_0043694 3300046513 Bacteria 2276
441 Ga0495628_0197955 3300046516 Bacteria 1515
442 Ga0495630_0137322 3300046517 Bacteria 1858
443 Ga0495631_0006475 3300046518 Bacteria 6041
444 Ga0495631_0009245 3300046518 Bacteria 4931
445 Ga0495631_0055530 3300046518 Bacteria 1725
446 Ga0495631_0286979 3300046518 Bacteria 700
447 Ga0495631_0290905 3300046518 Bacteria 695
448 Ga0495632_0000236 3300046519 Bacteria 55200
449 Ga0495632_0010207 3300046519 Bacteria 5580
450 Ga0495632_0218884 3300046519 Bacteria 861
451 Ga0495643_0004661 3300046522 Bacteria 9523
452 Ga0495643_0005473 3300046522 Bacteria 8587
453 Ga0495643_0023090 3300046522 Bacteria 3540
454 Ga0495644_0015854 3300046523 Bacteria 2887
455 Ga0495644_0039529 3300046523 Bacteria 1778
456 Ga0495648_0000527 3300046524 Bacteria 41184
457 Ga0495663_0005202 3300046525 Bacteria 3622
458 Ga0495666_0060180 3300046526 Bacteria 1815
459 Ga0495666_0076299 3300046526 Bacteria 1588
460 Ga0495666_0241371 3300046526 Bacteria 824
461 Ga0495642_0000005 3300046528 Bacteria 176726
462 Ga0495642_0000174 3300046528 Bacteria 37880
463 Ga0495642_0007222 3300046528 Bacteria 4263
464 Ga0495642_0059570 3300046528 Bacteria 1582
465 Ga0495652_0007357 3300046529 Bacteria 10153
466 Ga0495665_0002419 3300046531 Bacteria 10086
467 Ga0495665_0160109 3300046531 Bacteria 1173
468 Ga0495586_0053153 3300046535 Bacteria 2194
469 Ga0495586_0101643 3300046535 Bacteria 1595
470 Ga0495587_0012772 3300046536 Bacteria 5283
471 Ga0495587_0047504 3300046536 Bacteria 2544
472 Ga0495587_0298236 3300046536 Unclassified 902
473 Ga0495621_0094562 3300046539 Bacteria 1130
474 Ga0495597_0000456 3300046542 Bacteria 34898
475 Ga0495597_0011359 3300046542 Bacteria 4320
476 Ga0495597_0031190 3300046542 Bacteria 2427
477 Ga0495597_0147443 3300046542 Bacteria 967
478 Ga0495622_0033222 3300046557 Bacteria 2409
479 Ga0495622_0039083 3300046557 Bacteria 2209
480 Ga0495622_0074292 3300046557 Bacteria 1568
481 Ga0495622_0093130 3300046557 Bacteria 1383
482 Ga0495633_0013034 3300046558 Bacteria 4397
483 Ga0495633_0068025 3300046558 Bacteria 1663
484 Ga0495633_0073545 3300046558 Bacteria 1593
485 Ga0495633_0152118 3300046558 Bacteria 1068
486 Ga0495633_0265541 3300046558 Bacteria 782
487 Ga0495656_0014217 3300046615 Bacteria 2980
488 Ga0495656_0067639 3300046615 Bacteria 1577
489 Ga0495668_0003850 3300046616 Bacteria 10985
490 Ga0495668_0004835 3300046616 Bacteria 9371
491 Ga0495611_0005156 3300046648 Bacteria 5600
492 Ga0495611_0005581 3300046648 Bacteria 5367
493 Ga0495611_0075600 3300046648 Bacteria 1543
494 Ga0495625_0046978 3300046660 Bacteria 3113
495 Ga0495635_0453283 3300046663 Bacteria 848
496 Ga0495661_0001403 3300046665 Bacteria 20212
497 Ga0495661_0002211 3300046665 Bacteria 15176
498 Ga0495661_0003246 3300046665 Bacteria 12115
499 Ga0495661_0015341 3300046665 Bacteria 5114
500 Ga0495661_0018291 3300046665 Bacteria 4612
501 Ga0495661_0029067 3300046665 Bacteria 3531
502 Ga0495661_0042329 3300046665 Bacteria 2808
503 Ga0495661_0053722 3300046665 Bacteria 2421
504 Ga0495661_0166614 3300046665 Bacteria 1178
505 Ga0495588_0000174 3300046674 Bacteria 81329
506 Ga0495588_0027385 3300046674 Bacteria 2848
507 Ga0495588_0034367 3300046674 Bacteria 2565
508 Ga0495588_0178136 3300046674 Bacteria 1123
509 Ga0495623_0013243 3300046679 Bacteria 5349
510 Ga0495623_0021712 3300046679 Bacteria 4146
511 Ga0495623_0069013 3300046679 Bacteria 2203
512 Ga0495669_0010777 3300046684 Bacteria 3869
513 Ga0495669_0172800 3300046684 Bacteria 1028
514 Ga0495670_0010488 3300046691 Bacteria 4552
515 Ga0495670_0190866 3300046691 Bacteria 1083
516 Ga0495671_0000294 3300046692 Bacteria 41764
517 Ga0495671_0044757 3300046692 Bacteria 2218
518 Ga0495649_0255050 3300046694 Bacteria 900
519 Ga0495589_0000161 3300046794 Bacteria 62057
520 Ga0495589_0002183 3300046794 Bacteria 11015
521 Ga0495589_0061727 3300046794 Bacteria 1839
522 Ga0495589_0181485 3300046794 Bacteria 998
523 Ga0495600_0218517 3300046809 Bacteria 1219
524 Ga0495600_0239498 3300046809 Bacteria 1156
525 Ga0495660_0000157 3300046810 Bacteria 73772
526 Ga0495660_0007122 3300046810 Bacteria 6589
527 Ga0495660_0022472 3300046810 Bacteria 3602
528 Ga0495660_0072648 3300046810 Bacteria 1821
529 Ga0495581_0070697 3300047315 Bacteria 2019
530 Ga0495581_0155345 3300047315 Bacteria 1337
531 Ga0495604_0013177 3300047317 Bacteria 6583
532 Ga0495604_0027495 3300047317 Bacteria 4523
533 Ga0495636_0001470 3300047318 Bacteria 8916
534 Ga0495636_0159480 3300047318 Unclassified 1016
535 Ga0495674_0317131 3300047319 Bacteria 1271
536 Ga0495672_0001930 3300047320 Bacteria 19604
537 Ga0495672_0099452 3300047320 Bacteria 1581
538 Ga0495676_0078378 3300047321 Bacteria 2516
539 Ga0495680_0247980 3300047322 Bacteria 1263
540 Ga0495683_0018703 3300047323 Bacteria 3580
541 Ga0495683_0024581 3300047323 Bacteria 3091
542 Ga0495683_0048730 3300047323 Bacteria 2123
543 Ga0495687_000215 3300047443 Bacteria 82752
544 Ga0495687_000298 3300047443 Bacteria 65591
545 Ga0495675_0002719 3300047444 Bacteria 10601
546 Ga0495677_0000109 3300047445 Bacteria 41192
547 Ga0495677_0002072 3300047445 Bacteria 7988
548 Ga0495677_0013665 3300047445 Bacteria 2955
549 Ga0495677_0056799 3300047445 Bacteria 1446
550 Ga0495679_007882 3300047446 Bacteria 4386
551 Ga0495685_137303 3300047447 Unclassified 797
552 Ga0495673_0000003 3300047469 Bacteria 1491337
553 Ga0495681_0020236 3300047470 Bacteria 3614
554 Ga0495681_0020485 3300047470 Bacteria 3588
555 Ga0495681_0053813 3300047470 Bacteria 1883
556 Ga0495686_0000142 3300047472 Bacteria 143655
557 Ga0495686_0006640 3300047472 Bacteria 8812
558 Ga0495686_0086030 3300047472 Bacteria 1913
559 Ga0495593_0033938 3300047673 Bacteria 2777
560 Ga0495602_0126083 3300048088 Bacteria 2051
561 Ga0495614_0098752 3300048089 Bacteria 1275
562 Ga0495626_0000016 3300048091 Bacteria 232214
563 Ga0495626_0013785 3300048091 Bacteria 4192
564 Ga0496101_0281329 3300048904 Bacteria 1300
565 Ga0496101_0362972 3300048904 Bacteria 1139
566 Ga0496102_0000173 3300048905 Bacteria 87737
567 Ga0496102_0002646 3300048905 Bacteria 15218
568 Ga0496102_0478709 3300048905 Bacteria 1166
569 Ga0496103_0000131 3300048906 Bacteria 79787
570 Ga0496103_0016801 3300048906 Bacteria 4370
571 Ga0496104_0037026 3300048907 Bacteria 4563
572 Ga0496105_0001020 3300048908 Bacteria 19340
573 Ga0496105_0105614 3300048908 Bacteria 2325
574 Ga0496107_0120691 3300048910 Bacteria 1931
575 Ga0496109_0101966 3300048912 Bacteria 2664
576 Ga0496111_0086704 3300048914 Bacteria 2291
577 Ga0496111_0103346 3300048914 Bacteria 2095
578 Ga0496112_0199407 3300048915 Bacteria 1961
579 Ga0496113_0001294 3300048916 Bacteria 13820
580 Ga0496113_0180622 3300048916 Bacteria 1673
581 Ga0496113_0238693 3300048916 Bacteria 1450
582 Ga0496113_0694742 3300048916 Bacteria 812
583 Ga0496114_0054285 3300048917 Bacteria 3342
584 Ga0496114_1030596 3300048917 Bacteria 707
585 Ga0496115_0000133 3300048918 Bacteria 67951
586 Ga0496115_0002099 3300048918 Bacteria 14267
587 Ga0496116_0005419 3300048919 Bacteria 11859
588 Ga0496117_0002127 3300048920 Bacteria 25909
589 Ga0496118_0000092 3300048921 Bacteria 169106
590 Ga0496119_0005121 3300048922 Bacteria 12704
591 Ga0496121_0005979 3300048924 Bacteria 15374
592 Ga0496122_0002763 3300048925 Bacteria 24229
593 Ga0496122_0122443 3300048925 Bacteria 1673
594 Ga0496123_0002753 3300048926 Bacteria 21034
595 Ga0496123_0004315 3300048926 Bacteria 15093
596 Ga0496123_0024484 3300048926 Bacteria 4586
597 Ga0496124_0000081 3300048927 Bacteria 208413
598 Ga0496124_0027915 3300048927 Bacteria 5055
599 Ga0496124_0109338 3300048927 Bacteria 2228
600 Ga0496125_0002309 3300048928 Bacteria 25170
601 Ga0496125_0055441 3300048928 Bacteria 3229
602 Ga0496126_0000283 3300048929 Bacteria 107129
603 Ga0495678_052232 3300049459 Bacteria 1575
604 Ga0495682_0001423 3300049460 Bacteria 12956
605 Ga0495682_0019235 3300049460 Bacteria 2569
606 Ga0501031_0158274 3300049568 Bacteria 1480
607 Ga0501034_0153494 3300049571 Bacteria 2278
608 Ga0501037_0008162 3300049573 Bacteria 7675
609 Ga0501040_0161456 3300049576 Bacteria 1584
610 Ga0501042_0229728 3300049578 Bacteria 1338
611 Ga0501046_0086394 3300049580 Bacteria 2418
612 Ga0501047_0065616 3300049581 Bacteria 3499
613 Ga0501070_0742247 3300049586 Bacteria 774
614 Ga0501071_0067106 3300049587 Bacteria 2608
615 Ga0501072_0049126 3300049588 Bacteria 3321
616 Ga0501074_0091035 3300049590 Bacteria 2184
617 Ga0501075_0023475 3300049591 Bacteria 4517
618 Ga0501222_006383 3300049662 Bacteria 1585
619 Ga0501079_0188111 3300049741 Bacteria 1611
620 Ga0501081_0392019 3300049743 Bacteria 1027
621 Ga0501083_0001990 3300049744 Bacteria 14063
622 Ga0501283_051438 3300049779 Bacteria 731
623 Ga0501035_0265361 3300049822 Bacteria 1454
624 Ga0501044_0185662 3300049823 Bacteria 2044
625 Ga0501045_0017114 3300049824 Bacteria 5147
626 Ga0501045_0208587 3300049824 Bacteria 1455
627 nmdc:mga0yw44_403469_c1 3300050492 Bacteria 924
628 nmdc:mga0k408_143932_c1 3300050493 Bacteria 1419
629 nmdc:mga0qj67_4962_c1 3300050509 Bacteria 9670
630 nmdc:mga06r32_4146_c1 3300050510 Bacteria 12977
631 nmdc:mga08y16_128079_c1 3300050511 Bacteria 2640
632 nmdc:mga08x19_181460_c1 3300050514 Bacteria 1437
633 nmdc:mga0a205_147214_c1 3300050515 Bacteria 2255
634 nmdc:mga0a205_292167_c1 3300050515 Bacteria 1504
635 Ga0500641_0150984 3300053096 Bacteria 1003
636 Ga0500658_0118260 3300053134 Bacteria 1173
637 Ga0500577_0038633 3300053142 Bacteria 1725
638 Ga0500637_0001526 3300053178 Bacteria 9882
639 Ga0501084_0080215 3300054114 Bacteria 2736
640 Ga0501082_0004352 3300060353 Bacteria 12381
641 Ga0501082_0039000 3300060353 Bacteria 4097
642 Ga0466962_0047367 3300061719 Bacteria 2054
643 Ga0530510_0105239 3300061734 Bacteria 2065
644 2643802205 2643221556 Bacteria 7251154
645 2644475713 2643221684 Bacteria 7145183
646 2739056719 2738541337 Bacteria 6183410
647 2793323047 2791355260 Bacteria 6598818
648 2809143030 2808606418 Bacteria 6724496
649 2839995432 2839993093 Bacteria 5512535
650 2904428217 2904424332 Bacteria 7633521
651 8047673937 8047673197 Bacteria 7395230
652 Ga0207661_10577259
653 JGI25406J46586_10001197
654 rootL2_10027771
655 rootL2_10054306
656 rootL2_10091597
657 rootH1_10055722
658 Ga0065165_1002492
659 Ga0065165_1013808
660 Ga0065712_10134503
661 Ga0065707_10040339
662 Ga0070658_10024394
663 Ga0070676_10008198
664 Ga0070676_10009376
665 Ga0070690_100127247
666 Ga0070690_100626752
667 Ga0070670_100094777
668 Ga0070677_10158214
669 Ga0068869_100003195
670 Ga0068869_100016813
671 Ga0070666_10008823
672 Ga0070680_100281145
673 Ga0070660_100015927
674 Ga0070689_100472999
675 Ga0070687_100045346
676 Ga0070661_100002899
677 Ga0070661_100244263
678 Ga0070668_100000574
679 Ga0070668_100088445
680 Ga0070668_100108246
681 Ga0070669_100000765
682 Ga0070669_100002931
683 Ga0070669_100314309
684 Ga0070675_100002140
685 Ga0070675_100049796
686 Ga0070675_100098419
687 Ga0070671_100362960
688 Ga0070671_100431307
689 Ga0070674_100011152
690 Ga0070673_100050730
691 Ga0070673_100054587
692 Ga0070673_100189764
693 Ga0070673_100283758
694 Ga0070673_100290054
695 Ga0070688_100069415
696 Ga0070659_100043712
697 Ga0070659_100098610
698 Ga0070667_100007739
699 Ga0070667_100112647
700 Ga0070713_100077183
701 Ga0070701_10030817
702 Ga0070700_100006109
703 Ga0070700_100452926
704 Ga0070694_100605285
705 Ga0070708_100239078
706 Ga0070663_100046491
707 Ga0070663_100074650
708 Ga0070678_100015798
709 Ga0070678_100093070
710 Ga0070678_100314383
711 Ga0070678_100540255
712 Ga0070662_100000783
713 Ga0070662_100003414
714 Ga0070662_100114029
715 Ga0068867_100005514
716 Ga0070685_10006909
717 Ga0070685_10273431
718 Ga0070707_100154998
719 Ga0070699_100020444
720 Ga0070699_100344869
721 Ga0070684_100013866
722 Ga0070684_100112329
723 Ga0068853_100005136
724 Ga0070672_100005134
725 Ga0070672_100079864
726 Ga0070672_100133928
727 Ga0070672_100175199
728 Ga0070686_100452398
729 Ga0070665_100461152
730 Ga0068855_100008710
731 Ga0068855_100047031
732 Ga0070664_100001492
733 Ga0070664_100213965
734 Ga0070664_100657232
735 Ga0068857_100000223
736 Ga0068857_100016081
737 Ga0068856_100000233
738 Ga0070702_100497747
739 Ga0068852_100001585
740 Ga0068852_100003813
741 Ga0068852_100008232
742 Ga0068852_100051386
743 Ga0068852_100055860
744 Ga0068852_100287673
745 Ga0068852_100293144
746 Ga0068859_100104541
747 Ga0068859_100275730
748 Ga0068864_100134405
749 Ga0068864_100428668
750 Ga0068864_101357713
751 Ga0068866_10002119
752 Ga0068861_100001729
753 Ga0068861_100004658
754 Ga0068861_100053641
755 Ga0068851_10015869
756 Ga0068851_10042740
757 Ga0068870_10268516
758 Ga0068863_100001215
759 Ga0068863_100012982
760 Ga0068863_100018013
761 Ga0068863_100041920
762 Ga0068863_100555689
763 Ga0068858_100011059
764 Ga0068858_100594133
765 Ga0068860_100009850
766 Ga0068860_100434683
767 Ga0068862_100007098
768 Ga0068862_100020474
769 Ga0081540_1010528
770 Ga0081540_1011231
771 Ga0081539_10002106
772 Ga0081539_10017714
773 Ga0075364_10007757
774 Ga0075366_10014006
775 Ga0075366_10094432
776 Ga0075366_10360109
777 Ga0097621_100233119
778 Ga0075370_10105980
779 Ga0075430_100009271
780 Ga0075431_100006662
781 Ga0075433_10136374
782 Ga0075433_10478595
783 Ga0075429_100820861
784 Ga0068865_100003044
785 Ga0068865_100086587
786 Ga0097620_100104540
787 Ga0097620_100275734
788 Ga0105244_10194078
789 Ga0105240_10033636
790 Ga0105240_10343586
791 Ga0105240_10697331
792 Ga0111539_10004167
793 Ga0105245_10087074
794 Ga0105245_11171294
795 Ga0114129_10244340
796 Ga0105243_10015973
797 Ga0105243_10033833
798 Ga0105243_11065297
799 Ga0105242_10076586
800 Ga0105242_10378330
801 Ga0105248_10027004
802 Ga0105248_10294006
803 Ga0105248_10477784
804 Ga0105249_10013028
805 Ga0099796_10020039
806 Ga0157373_10336949
807 Ga0157371_10054470
808 Ga0157369_10386620
809 Ga0157374_10012857
810 Ga0157374_10032897
811 Ga0157378_11117195
812 Ga0163162_10000769
813 Ga0163162_10009068
814 Ga0157372_10267770
815 Ga0157372_10654979
816 Ga0157375_10004451
817 Ga0157375_10010853
818 Ga0157375_10098672
819 Ga0163163_10004692
820 Ga0163163_10311894
821 Ga0157380_10004895
822 Ga0157380_10020507
823 Ga0157380_10064490
824 Ga0157380_11087100
825 Ga0182008_10099300
826 Ga0157377_10243610
827 Ga0157379_10042066
828 Ga0157379_10224998
829 Ga0183362_10002
830 Ga0163161_10002372
831 Ga0163161_10094713
832 Ga0163161_10158155
833 Ga0206353_10927837
834 Ga0209564_1024324
835 Ga0207697_10039525
836 Ga0207697_10110172
837 Ga0207656_10090576
838 Ga0207682_10081342
839 Ga0207642_10027248
840 Ga0207688_10427838
841 Ga0207647_10025339
842 Ga0207645_10001466
843 Ga0207645_10004020
844 Ga0207643_10247080
845 Ga0207705_10006844
846 Ga0207705_10008375
847 Ga0207707_10360714
848 Ga0207707_10802301
849 Ga0207695_10106857
850 Ga0207663_10347038
851 Ga0207660_10246050
852 Ga0207662_10019987
853 Ga0207662_10049144
854 Ga0207657_10007757
855 Ga0207657_10021906
856 Ga0207657_10132680
857 Ga0207649_10004404
858 Ga0207652_10207532
859 Ga0207652_10847863
860 Ga0207681_10000340
861 Ga0207681_10060318
862 Ga0207650_10056224
863 Ga0207659_10011262
864 Ga0207659_10089935
865 Ga0207687_10065552
866 Ga0207687_10075001
867 Ga0207700_10101063
868 Ga0207644_10144510
869 Ga0207690_10554807
870 Ga0207690_10594783
871 Ga0207706_10002793
872 Ga0207706_10025515
873 Ga0207706_10068785
874 Ga0207686_10003830
875 Ga0207686_10038506
876 Ga0207709_10078676
877 Ga0207709_10142024
878 Ga0207670_10144375
879 Ga0207669_10005760
880 Ga0207704_10003619
881 Ga0207704_10067479
882 Ga0207704_10162713
883 Ga0207691_10000481
884 Ga0207691_10044292
885 Ga0207691_10085217
886 Ga0207691_10260662
887 Ga0207711_10013198
888 Ga0207711_10259372
889 Ga0207689_10002255
890 Ga0207689_10027062
891 Ga0207661_10102718
892 Ga0207679_10008470
893 Ga0207679_10044727
894 Ga0207679_10706342
895 Ga0207712_10003827
896 Ga0207712_10007809
897 Ga0207668_10008601
898 Ga0207668_10239362
899 Ga0207668_10645974
900 Ga0207658_10000756
901 Ga0207677_10041185
902 Ga0207703_10001349
903 Ga0207639_10259996
904 Ga0207639_10386896
905 Ga0207678_10036525
906 Ga0207678_10169207
907 Ga0207678_10285260
908 Ga0207708_10002372
909 Ga0207708_10641043
910 Ga0207702_10000577
911 Ga0207702_11166354
912 Ga0207641_10005453
913 Ga0207641_10009111
914 Ga0207641_10011616
915 Ga0207641_10110562
916 Ga0207648_10002846
917 Ga0207648_10176800
918 Ga0207676_10049440
919 Ga0207676_10208514
920 Ga0207676_10348940
921 Ga0207676_10364508
922 Ga0207674_10000571
923 Ga0207674_10010814
924 Ga0207675_100000450
925 Ga0207675_100003938
926 Ga0207675_100518626
927 Ga0207683_10035993
928 Ga0207683_10116160
929 Ga0207683_10207273
930 Ga0207683_10392242
931 Ga0207698_10000978
932 Ga0207698_10005678
933 Ga0207698_10019541
934 Ga0268265_10014242
935 Ga0268265_10072385
936 Ga0268264_10011337
937 Ga0268264_10125645
938 Ga0265319_1003521
939 Ga0265319_1006243
940 Ga0265334_10126410
941 Ga0265318_10000412
942 Ga0307515_10000043
943 Ga0307515_10089387
944 Ga0265338_10151912
945 Ga0265330_10000345
946 Ga0265330_10000624
947 Ga0265332_10000406
948 Ga0265332_10000614
949 Ga0265332_10120583
950 Ga0265328_10004041
951 Ga0265320_10000433
952 Ga0265320_10001865
953 Ga0265320_10013162
954 Ga0265325_10047554
955 Ga0265329_10007656
956 Ga0265331_10000573
957 Ga0265331_10001570
958 Ga0265316_10005925
959 Ga0265316_10029349
960 Ga0265313_10000755
961 Ga0265313_10002098
962 Ga0265313_10036387
963 Ga0307508_10000096
964 Ga0316579_10185865
965 Ga0265314_10001005
966 Ga0265314_10001934
967 Ga0265314_10015645
968 Ga0265342_10002483
969 Ga0265342_10010321
970 Ga0316578_10217856
971 Ga0307405_10746366
972 Ga0307413_10225434
973 Ga0307413_10308756
974 Ga0307406_10375483
975 Ga0307406_10466191
976 Ga0307407_10147327
977 Ga0307412_10448459
978 Ga0307412_10690586
979 Ga0307409_100215933
980 Ga0307409_100279673
981 Ga0307416_100219733
982 Ga0307416_100342597
983 Ga0307416_101131994
984 Ga0307414_10491420
985 Ga0307411_10260085
986 Ga0307411_10278969
987 Ga0307411_10498596
988 Ga0307415_100347096
989 Ga0373939_0249952
990 Ga0373956_0122156
991 Ga0373955_0005149
992 Ga0373935_0045836
993 Ga0373925_0237970
994 Ga0395899_0022522
995 Ga0395899_0029567
996 Ga0395899_0367839
997 Ga0395900_0002740
998 Ga0395900_0032713
999 Ga0395900_0062721
1000 Ga0395900_0482881
1001 Ga0395898_0083998
1002 Ga0395898_0109850
1003 Ga0395905_0014949
1004 Ga0395905_0057275
1005 Ga0395905_0111218
1006 Ga0395901_0002267
1007 Ga0395901_0130418
1008 Ga0395901_0336351
1009 Ga0395901_0969797
1010 Ga0436361_0106978
1011 Ga0436361_0561101
1012 Ga0451797_0421985
1013 Ga0451800_0732284
1014 Ga0451807_0601123
1015 Ga0439448_0029711
1016 Ga0439435_0096948
1017 Ga0451577_0199955
1018 Ga0466969_0042599
1019 Ga0466972_0000929
1020 Ga0453683_0003988
1021 Ga0453683_0266213
1022 Ga0466965_0006307
1023 Ga0466965_0006393
1024 Ga0466966_0059651
1025 Ga0466966_0114587
1026 Ga0466966_0378601
1027 Ga0466961_0013520
1028 Ga0466961_0371731
1029 Ga0466964_0001168
1030 Ga0466964_0047079
1031 Ga0453684_0022196
1032 Ga0466971_0053378
1033 Ga0466971_0175691
1034 Ga0466970_0159370
1035 Ga0466957_0000301
1036 Ga0466957_0029441
1037 Ga0466957_0147278
1038 Ga0466957_0176358
1039 Ga0466957_0229855
1040 Ga0466957_0711135
1041 Ga0466960_0113618
1042 Ga0466959_0029619
1043 Ga0466959_0033854
1044 Ga0466959_0107663
1045 Ga0466959_0162681
1046 Ga0451576_0016907
1047 Ga0466958_0270156
1048 Ga0466967_0442515
1049 Ga0495617_000055
1050 Ga0495627_000123
1051 Ga0495590_0005483
1052 Ga0495590_0166937
1053 Ga0495629_0016433
1054 Ga0495638_0010532
1055 Ga0495653_0004577
1056 Ga0495653_0046362
1057 Ga0495580_0022065
1058 Ga0495582_0087705
1059 Ga0495582_0127194
1060 Ga0495605_0000035
1061 Ga0495605_0000295
1062 Ga0495584_0000269
1063 Ga0495584_0005974
1064 Ga0495584_0090251
1065 Ga0495584_0263438
1066 Ga0495585_0001645
1067 Ga0495585_0017999
1068 Ga0495585_0034628
1069 Ga0495585_0037463
1070 Ga0495585_0043338
1071 Ga0495585_0070487
1072 Ga0495585_0156323
1073 Ga0495594_0138356
1074 Ga0495596_0007503
1075 Ga0495596_0017215
1076 Ga0495596_0022359
1077 Ga0495596_0029961
1078 Ga0495596_0064843
1079 Ga0495607_0001166
1080 Ga0495607_0003986
1081 Ga0495607_0012237
1082 Ga0495607_0088538
1083 Ga0495607_0116750
1084 Ga0495583_0000903
1085 Ga0495583_0001133
1086 Ga0495606_0002110
1087 Ga0495606_0006889
1088 Ga0495606_0009787
1089 Ga0495606_0047018
1090 Ga0495616_0011495
1091 Ga0495616_0043694
1092 Ga0495628_0197955
1093 Ga0495630_0137322
1094 Ga0495631_0006475
1095 Ga0495631_0009245
1096 Ga0495631_0055530
1097 Ga0495631_0286979
1098 Ga0495631_0290905
1099 Ga0495632_0000236
1100 Ga0495632_0010207
1101 Ga0495632_0218884
1102 Ga0495643_0004661
1103 Ga0495643_0005473
1104 Ga0495643_0023090
1105 Ga0495644_0015854
1106 Ga0495644_0039529
1107 Ga0495648_0000527
1108 Ga0495663_0005202
1109 Ga0495666_0060180
1110 Ga0495666_0076299
1111 Ga0495666_0241371
1112 Ga0495642_0000005
1113 Ga0495642_0000174
1114 Ga0495642_0007222
1115 Ga0495642_0059570
1116 Ga0495652_0007357
1117 Ga0495665_0002419
1118 Ga0495665_0160109
1119 Ga0495586_0053153
1120 Ga0495586_0101643
1121 Ga0495587_0012772
1122 Ga0495587_0047504
1123 Ga0495587_0298236
1124 Ga0495621_0094562
1125 Ga0495597_0000456
1126 Ga0495597_0011359
1127 Ga0495597_0031190
1128 Ga0495597_0147443
1129 Ga0495622_0033222
1130 Ga0495622_0039083
1131 Ga0495622_0074292
1132 Ga0495622_0093130
1133 Ga0495633_0013034
1134 Ga0495633_0068025
1135 Ga0495633_0073545
1136 Ga0495633_0152118
1137 Ga0495633_0265541
1138 Ga0495656_0014217
1139 Ga0495656_0067639
1140 Ga0495668_0003850
1141 Ga0495668_0004835
1142 Ga0495611_0005156
1143 Ga0495611_0005581
1144 Ga0495611_0075600
1145 Ga0495625_0046978
1146 Ga0495635_0453283
1147 Ga0495661_0001403
1148 Ga0495661_0002211
1149 Ga0495661_0003246
1150 Ga0495661_0015341
1151 Ga0495661_0018291
1152 Ga0495661_0029067
1153 Ga0495661_0042329
1154 Ga0495661_0053722
1155 Ga0495661_0166614
1156 Ga0495588_0000174
1157 Ga0495588_0027385
1158 Ga0495588_0034367
1159 Ga0495588_0178136
1160 Ga0495623_0013243
1161 Ga0495623_0021712
1162 Ga0495623_0069013
1163 Ga0495669_0010777
1164 Ga0495669_0172800
1165 Ga0495670_0010488
1166 Ga0495670_0190866
1167 Ga0495671_0000294
1168 Ga0495671_0044757
1169 Ga0495649_0255050
1170 Ga0495589_0000161
1171 Ga0495589_0002183
1172 Ga0495589_0061727
1173 Ga0495589_0181485
1174 Ga0495600_0218517
1175 Ga0495600_0239498
1176 Ga0495660_0000157
1177 Ga0495660_0007122
1178 Ga0495660_0022472
1179 Ga0495660_0072648
1180 Ga0495581_0070697
1181 Ga0495581_0155345
1182 Ga0495604_0013177
1183 Ga0495604_0027495
1184 Ga0495636_0001470
1185 Ga0495636_0159480
1186 Ga0495674_0317131
1187 Ga0495672_0001930
1188 Ga0495672_0099452
1189 Ga0495676_0078378
1190 Ga0495680_0247980
1191 Ga0495683_0018703
1192 Ga0495683_0024581
1193 Ga0495683_0048730
1194 Ga0495687_000215
1195 Ga0495687_000298
1196 Ga0495675_0002719
1197 Ga0495677_0000109
1198 Ga0495677_0002072
1199 Ga0495677_0013665
1200 Ga0495677_0056799
1201 Ga0495679_007882
1202 Ga0495685_137303
1203 Ga0495673_0000003
1204 Ga0495681_0020236
1205 Ga0495681_0020485
1206 Ga0495681_0053813
1207 Ga0495686_0000142
1208 Ga0495686_0006640
1209 Ga0495686_0086030
1210 Ga0495593_0033938
1211 Ga0495602_0126083
1212 Ga0495614_0098752
1213 Ga0495626_0000016
1214 Ga0495626_0013785
1215 Ga0496101_0281329
1216 Ga0496101_0362972
1217 Ga0496102_0000173
1218 Ga0496102_0002646
1219 Ga0496102_0478709
1220 Ga0496103_0000131
1221 Ga0496103_0016801
1222 Ga0496104_0037026
1223 Ga0496105_0001020
1224 Ga0496105_0105614
1225 Ga0496107_0120691
1226 Ga0496109_0101966
1227 Ga0496111_0086704
1228 Ga0496111_0103346
1229 Ga0496112_0199407
1230 Ga0496113_0001294
1231 Ga0496113_0180622
1232 Ga0496113_0238693
1233 Ga0496113_0694742
1234 Ga0496114_0054285
1235 Ga0496114_1030596
1236 Ga0496115_0000133
1237 Ga0496115_0002099
1238 Ga0496116_0005419
1239 Ga0496117_0002127
1240 Ga0496118_0000092
1241 Ga0496119_0005121
1242 Ga0496121_0005979
1243 Ga0496122_0002763
1244 Ga0496122_0122443
1245 Ga0496123_0002753
1246 Ga0496123_0004315
1247 Ga0496123_0024484
1248 Ga0496124_0000081
1249 Ga0496124_0027915
1250 Ga0496124_0109338
1251 Ga0496125_0002309
1252 Ga0496125_0055441
1253 Ga0496126_0000283
1254 Ga0495678_052232
1255 Ga0495682_0001423
1256 Ga0495682_0019235
1257 Ga0501031_0158274
1258 Ga0501034_0153494
1259 Ga0501037_0008162
1260 Ga0501040_0161456
1261 Ga0501042_0229728
1262 Ga0501046_0086394
1263 Ga0501047_0065616
1264 Ga0501070_0742247
1265 Ga0501071_0067106
1266 Ga0501072_0049126
1267 Ga0501074_0091035
1268 Ga0501075_0023475
1269 Ga0501222_006383
1270 Ga0501079_0188111
1271 Ga0501081_0392019
1272 Ga0501083_0001990
1273 Ga0501283_051438
1274 Ga0501035_0265361
1275 Ga0501044_0185662
1276 Ga0501045_0017114
1277 Ga0501045_0208587
1278 nmdc:mga0yw44_403469_c1
1279 nmdc:mga0k408_143932_c1
1280 nmdc:mga0qj67_4962_c1
1281 nmdc:mga06r32_4146_c1
1282 nmdc:mga08y16_128079_c1
1283 nmdc:mga08x19_181460_c1
1284 nmdc:mga0a205_147214_c1
1285 nmdc:mga0a205_292167_c1
1286 Ga0500641_0150984
1287 Ga0500658_0118260
1288 Ga0500577_0038633
1289 Ga0500637_0001526
1290 Ga0501084_0080215
1291 Ga0501082_0004352
1292 Ga0501082_0039000
1293 Ga0466962_0047367
1294 Ga0530510_0105239
1295 2643802205
1296 2644475713
1297 2739056719
1298 2793323047
1299 2809143030
1300 2839995432
1301 2904428217
1302 8047673937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

20

224

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8782 1 214
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8625 1 214
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8037 1 215
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7912 1 215
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7835 1 214
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8709 2 214 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8436 2 214 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8037 1 215 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7912 1 215 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7639 1 214 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A239M7J6-F1-model_v4 RibD C-terminal domain-containing protein 0.9968 1 215 GO:0008703
GO:0009231
AF-A0A6B9YSD1-F1-model_v4 Dihydrofolate reductase 0.995 1 214 GO:0008703
GO:0009231
AF-A0A2A6JSK4-F1-model_v4 Deaminase 0.9948 1 213 GO:0008703
GO:0009231
AF-A0A536U3N6-F1-model_v4 Dihydrofolate reductase 0.9946 1 215 GO:0008703
GO:0009231
AF-A0A2N7SFS6-F1-model_v4 deleted 0.9946 59 214

Map