F472736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 653 | 313 | 653 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10793027|Ga0070658_107930272 |
| Length | 154 |
| Sequence | MPTVRTRASASREEADPVQEFYSIGEVCSLTDLRPHVLRYWESQFRILNPAKNRSGNRVYARREVELVLLVKHLLYTEKYTIEGARQKLDAHRRGGELRTAARAALVAETIEHFERELRDVGEMLAGRAAPRLRGTTEADEEPLDSRPPDVPAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 186 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 187 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 188 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 189 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 190 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 191 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 192 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 193 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 252 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 267 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 268 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 270 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 272 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 274 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 276 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 277 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 278 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 279 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 281 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 285 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 286 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 287 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 289 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 290 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 291 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 292 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 293 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 296 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.76 |
| Rhizosphere | 97.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10145756 | 3300003203 | Bacteria | 691 |
| 2 | rootL2_10163687 | 3300003322 | Bacteria | 1843 |
| 3 | Ga0065715_10604432 | 3300005293 | Bacteria | 705 |
| 4 | Ga0065707_10324499 | 3300005295 | Bacteria | 960 |
| 5 | Ga0070658_10200521 | 3300005327 | Bacteria | 1683 |
| 6 | Ga0070658_10793027 | 3300005327 | Bacteria | 823 |
| 7 | Ga0070676_10001926 | 3300005328 | Bacteria | 10538 |
| 8 | Ga0070690_100760644 | 3300005330 | Unclassified | 749 |
| 9 | Ga0070670_100752016 | 3300005331 | Bacteria | 878 |
| 10 | Ga0070677_10514782 | 3300005333 | Bacteria | 650 |
| 11 | Ga0068869_100050894 | 3300005334 | Bacteria | 3004 |
| 12 | Ga0070682_100095513 | 3300005337 | Bacteria | 1952 |
| 13 | Ga0070682_100362971 | 3300005337 | Unclassified | 1084 |
| 14 | Ga0070660_100288934 | 3300005339 | Bacteria | 1343 |
| 15 | Ga0070660_101211320 | 3300005339 | Bacteria | 640 |
| 16 | Ga0070687_100265328 | 3300005343 | Unclassified | 1074 |
| 17 | Ga0070661_100453931 | 3300005344 | Bacteria | 1020 |
| 18 | Ga0070661_101864374 | 3300005344 | Bacteria | 511 |
| 19 | Ga0070668_100010255 | 3300005347 | Bacteria | 6953 |
| 20 | Ga0070668_100567065 | 3300005347 | Bacteria | 990 |
| 21 | Ga0070669_100262483 | 3300005353 | Bacteria | 1379 |
| 22 | Ga0070669_100405137 | 3300005353 | Bacteria | 1117 |
| 23 | Ga0070669_101494500 | 3300005353 | Bacteria | 587 |
| 24 | Ga0070675_100112925 | 3300005354 | Bacteria | 2301 |
| 25 | Ga0070675_101391199 | 3300005354 | Bacteria | 647 |
| 26 | Ga0070671_100584872 | 3300005355 | Bacteria | 964 |
| 27 | Ga0070674_100000378 | 3300005356 | Bacteria | 22336 |
| 28 | Ga0070674_100502628 | 3300005356 | Bacteria | 1010 |
| 29 | Ga0070673_100033447 | 3300005364 | Bacteria | 3883 |
| 30 | Ga0070659_100486299 | 3300005366 | Bacteria | 1051 |
| 31 | Ga0070667_101918162 | 3300005367 | Archaea | 558 |
| 32 | Ga0070703_10002195 | 3300005406 | Bacteria | 5681 |
| 33 | Ga0070703_10007122 | 3300005406 | Bacteria | 3139 |
| 34 | Ga0070703_10037010 | 3300005406 | Bacteria | 1502 |
| 35 | Ga0070703_10314565 | 3300005406 | Bacteria | 657 |
| 36 | Ga0070709_10001217 | 3300005434 | Bacteria | 14132 |
| 37 | Ga0070709_10018925 | 3300005434 | Bacteria | 3973 |
| 38 | Ga0070709_10393620 | 3300005434 | Bacteria | 1033 |
| 39 | Ga0070709_11355469 | 3300005434 | Unclassified | 575 |
| 40 | Ga0070714_100389060 | 3300005435 | Bacteria | 1316 |
| 41 | Ga0070713_100113358 | 3300005436 | Bacteria | 2367 |
| 42 | Ga0070713_100534831 | 3300005436 | Bacteria | 1109 |
| 43 | Ga0070710_10175789 | 3300005437 | Bacteria | 1337 |
| 44 | Ga0070710_10874543 | 3300005437 | Bacteria | 647 |
| 45 | Ga0070701_10516595 | 3300005438 | Bacteria | 778 |
| 46 | Ga0070701_10979715 | 3300005438 | Bacteria | 588 |
| 47 | Ga0070711_100000239 | 3300005439 | Bacteria | 28182 |
| 48 | Ga0070711_100007712 | 3300005439 | Bacteria | 6554 |
| 49 | Ga0070705_100002647 | 3300005440 | Bacteria | 8956 |
| 50 | Ga0070705_100028862 | 3300005440 | Bacteria | 3044 |
| 51 | Ga0070705_100225392 | 3300005440 | Bacteria | 1300 |
| 52 | Ga0070700_100056332 | 3300005441 | Bacteria | 2464 |
| 53 | Ga0070700_100279504 | 3300005441 | Bacteria | 1210 |
| 54 | Ga0070694_100021499 | 3300005444 | Bacteria | 4124 |
| 55 | Ga0070694_100065552 | 3300005444 | Bacteria | 2488 |
| 56 | Ga0070694_100090828 | 3300005444 | Bacteria | 2142 |
| 57 | Ga0070694_100101863 | 3300005444 | Bacteria | 2032 |
| 58 | Ga0070694_101820730 | 3300005444 | Bacteria | 519 |
| 59 | Ga0070708_100016285 | 3300005445 | Bacteria | 6164 |
| 60 | Ga0070708_100066036 | 3300005445 | Bacteria | 3246 |
| 61 | Ga0070708_100156312 | 3300005445 | Bacteria | 2123 |
| 62 | Ga0070708_100171127 | 3300005445 | Bacteria | 2028 |
| 63 | Ga0070708_100394684 | 3300005445 | Bacteria | 1305 |
| 64 | Ga0070708_101360018 | 3300005445 | Bacteria | 663 |
| 65 | Ga0070663_100117091 | 3300005455 | Bacteria | 2009 |
| 66 | Ga0070663_100753113 | 3300005455 | Bacteria | 832 |
| 67 | Ga0070678_100010489 | 3300005456 | Bacteria | 5666 |
| 68 | Ga0070662_100051092 | 3300005457 | Bacteria | 2984 |
| 69 | Ga0070662_100332962 | 3300005457 | Bacteria | 1240 |
| 70 | Ga0070681_10104296 | 3300005458 | Bacteria | 2778 |
| 71 | Ga0070681_10140437 | 3300005458 | Bacteria | 2346 |
| 72 | Ga0070681_11117616 | 3300005458 | Bacteria | 709 |
| 73 | Ga0070681_11900379 | 3300005458 | Unclassified | 523 |
| 74 | Ga0068867_100001672 | 3300005459 | Bacteria | 15445 |
| 75 | Ga0068867_100319521 | 3300005459 | Bacteria | 1286 |
| 76 | Ga0070706_100100212 | 3300005467 | Bacteria | 2691 |
| 77 | Ga0070706_100105980 | 3300005467 | Bacteria | 2615 |
| 78 | Ga0070706_100147250 | 3300005467 | Bacteria | 2199 |
| 79 | Ga0070706_100241260 | 3300005467 | Bacteria | 1688 |
| 80 | Ga0070706_100829050 | 3300005467 | Bacteria | 856 |
| 81 | Ga0070706_100971083 | 3300005467 | Bacteria | 784 |
| 82 | Ga0070706_101589949 | 3300005467 | Unclassified | 596 |
| 83 | Ga0070707_100018022 | 3300005468 | Bacteria | 6642 |
| 84 | Ga0070707_100023066 | 3300005468 | Bacteria | 5888 |
| 85 | Ga0070707_100023968 | 3300005468 | Bacteria | 5774 |
| 86 | Ga0070707_100048346 | 3300005468 | Bacteria | 4075 |
| 87 | Ga0070707_100051348 | 3300005468 | Bacteria | 3954 |
| 88 | Ga0070707_100071620 | 3300005468 | Bacteria | 3339 |
| 89 | Ga0070707_100109021 | 3300005468 | Bacteria | 2685 |
| 90 | Ga0070707_101853330 | 3300005468 | Bacteria | 570 |
| 91 | Ga0070698_100000037 | 3300005471 | Bacteria | 92307 |
| 92 | Ga0070698_100088251 | 3300005471 | Bacteria | 3086 |
| 93 | Ga0070698_100093544 | 3300005471 | Bacteria | 2986 |
| 94 | Ga0070698_100355098 | 3300005471 | Bacteria | 1397 |
| 95 | Ga0070698_100742262 | 3300005471 | Bacteria | 925 |
| 96 | Ga0070699_100019554 | 3300005518 | Bacteria | 5834 |
| 97 | Ga0070699_100052119 | 3300005518 | Bacteria | 3542 |
| 98 | Ga0070699_100175890 | 3300005518 | Bacteria | 1898 |
| 99 | Ga0070699_100290171 | 3300005518 | Bacteria | 1467 |
| 100 | Ga0070699_100314188 | 3300005518 | Bacteria | 1407 |
| 101 | Ga0070699_100568310 | 3300005518 | Bacteria | 1033 |
| 102 | Ga0070699_100929130 | 3300005518 | Bacteria | 797 |
| 103 | Ga0070684_100859682 | 3300005535 | Bacteria | 849 |
| 104 | Ga0070684_100948302 | 3300005535 | Bacteria | 807 |
| 105 | Ga0070684_101027185 | 3300005535 | Bacteria | 774 |
| 106 | Ga0070697_100013672 | 3300005536 | Bacteria | 6369 |
| 107 | Ga0070697_100015734 | 3300005536 | Bacteria | 5940 |
| 108 | Ga0070697_100051645 | 3300005536 | Bacteria | 3340 |
| 109 | Ga0070697_100125275 | 3300005536 | Bacteria | 2152 |
| 110 | Ga0070697_100259515 | 3300005536 | Bacteria | 1487 |
| 111 | Ga0070697_100632342 | 3300005536 | Bacteria | 942 |
| 112 | Ga0070697_101187855 | 3300005536 | Bacteria | 680 |
| 113 | Ga0070697_101386299 | 3300005536 | Bacteria | 628 |
| 114 | Ga0070672_100227569 | 3300005543 | Bacteria | 1566 |
| 115 | Ga0070686_100377075 | 3300005544 | Bacteria | 1073 |
| 116 | Ga0070695_100002535 | 3300005545 | Bacteria | 10547 |
| 117 | Ga0070695_100033544 | 3300005545 | Bacteria | 3213 |
| 118 | Ga0070695_100041833 | 3300005545 | Bacteria | 2906 |
| 119 | Ga0070695_100053123 | 3300005545 | Bacteria | 2605 |
| 120 | Ga0070696_100012183 | 3300005546 | Bacteria | 5762 |
| 121 | Ga0070696_100101292 | 3300005546 | Bacteria | 2064 |
| 122 | Ga0070696_100114902 | 3300005546 | Bacteria | 1942 |
| 123 | Ga0070696_100163225 | 3300005546 | Bacteria | 1643 |
| 124 | Ga0070696_101004742 | 3300005546 | Unclassified | 697 |
| 125 | Ga0070693_100064398 | 3300005547 | Bacteria | 2140 |
| 126 | Ga0070665_101827498 | 3300005548 | Bacteria | 614 |
| 127 | Ga0070704_100005461 | 3300005549 | Bacteria | 7405 |
| 128 | Ga0070704_100049304 | 3300005549 | Bacteria | 2953 |
| 129 | Ga0070704_100061295 | 3300005549 | Bacteria | 2692 |
| 130 | Ga0070704_100160502 | 3300005549 | Bacteria | 1777 |
| 131 | Ga0070704_100179537 | 3300005549 | Bacteria | 1692 |
| 132 | Ga0068855_100688458 | 3300005563 | Bacteria | 1095 |
| 133 | Ga0070664_100893872 | 3300005564 | Unclassified | 833 |
| 134 | Ga0070664_100919080 | 3300005564 | Bacteria | 821 |
| 135 | Ga0068857_100009128 | 3300005577 | Bacteria | 8605 |
| 136 | Ga0068854_100008522 | 3300005578 | Bacteria | 6597 |
| 137 | Ga0068854_100776712 | 3300005578 | Bacteria | 833 |
| 138 | Ga0068854_101931471 | 3300005578 | Bacteria | 543 |
| 139 | Ga0070702_100001397 | 3300005615 | Bacteria | 9867 |
| 140 | Ga0070702_100751413 | 3300005615 | Unclassified | 749 |
| 141 | Ga0068852_100763766 | 3300005616 | Bacteria | 979 |
| 142 | Ga0068864_100000396 | 3300005618 | Bacteria | 37849 |
| 143 | Ga0068866_10000401 | 3300005718 | Bacteria | 20182 |
| 144 | Ga0068866_10206322 | 3300005718 | Unclassified | 1177 |
| 145 | Ga0068866_10379430 | 3300005718 | Bacteria | 906 |
| 146 | Ga0068861_100035865 | 3300005719 | Bacteria | 3677 |
| 147 | Ga0068861_100782930 | 3300005719 | Bacteria | 894 |
| 148 | Ga0068861_100801166 | 3300005719 | Bacteria | 884 |
| 149 | Ga0068870_10393123 | 3300005840 | Bacteria | 900 |
| 150 | Ga0068863_100168747 | 3300005841 | Bacteria | 2099 |
| 151 | Ga0068858_100014878 | 3300005842 | Bacteria | 7319 |
| 152 | Ga0068860_100553206 | 3300005843 | Bacteria | 1153 |
| 153 | Ga0068860_101159554 | 3300005843 | Bacteria | 793 |
| 154 | Ga0081455_10940938 | 3300005937 | Unclassified | 536 |
| 155 | Ga0081539_10072556 | 3300005985 | Bacteria | 1839 |
| 156 | Ga0070717_10140053 | 3300006028 | Bacteria | 2086 |
| 157 | Ga0070717_10444356 | 3300006028 | Bacteria | 1168 |
| 158 | Ga0070717_10445187 | 3300006028 | Bacteria | 1167 |
| 159 | Ga0070715_10684052 | 3300006163 | Bacteria | 611 |
| 160 | Ga0070716_100004394 | 3300006173 | Bacteria | 6738 |
| 161 | Ga0070716_100142125 | 3300006173 | Bacteria | 1532 |
| 162 | Ga0070716_100719062 | 3300006173 | Bacteria | 765 |
| 163 | Ga0070712_100145615 | 3300006175 | Bacteria | 1813 |
| 164 | Ga0070712_100257173 | 3300006175 | Bacteria | 1398 |
| 165 | Ga0070712_101215198 | 3300006175 | Bacteria | 656 |
| 166 | Ga0097621_100083421 | 3300006237 | Bacteria | 2663 |
| 167 | Ga0097621_101715348 | 3300006237 | Bacteria | 598 |
| 168 | Ga0068871_100056495 | 3300006358 | Bacteria | 3191 |
| 169 | Ga0075428_100016140 | 3300006844 | Bacteria | 8255 |
| 170 | Ga0075428_100297114 | 3300006844 | Bacteria | 1737 |
| 171 | Ga0075428_100339399 | 3300006844 | Bacteria | 1613 |
| 172 | Ga0075428_100692084 | 3300006844 | Bacteria | 1086 |
| 173 | Ga0075430_100249135 | 3300006846 | Bacteria | 1472 |
| 174 | Ga0075430_100449111 | 3300006846 | Bacteria | 1064 |
| 175 | Ga0075431_100019714 | 3300006847 | Bacteria | 6883 |
| 176 | Ga0075431_100044571 | 3300006847 | Bacteria | 4575 |
| 177 | Ga0075431_100210089 | 3300006847 | Bacteria | 1988 |
| 178 | Ga0075431_100216448 | 3300006847 | Bacteria | 1955 |
| 179 | Ga0075431_100242215 | 3300006847 | Bacteria | 1834 |
| 180 | Ga0075431_100850544 | 3300006847 | Bacteria | 883 |
| 181 | Ga0075433_10021691 | 3300006852 | Bacteria | 5387 |
| 182 | Ga0075433_10209853 | 3300006852 | Bacteria | 1731 |
| 183 | Ga0075433_10288202 | 3300006852 | Bacteria | 1454 |
| 184 | Ga0075433_10429476 | 3300006852 | Bacteria | 1165 |
| 185 | Ga0075434_100002527 | 3300006871 | Bacteria | 16141 |
| 186 | Ga0075434_100003715 | 3300006871 | Bacteria | 13630 |
| 187 | Ga0075434_100018158 | 3300006871 | Bacteria | 6789 |
| 188 | Ga0075434_100055478 | 3300006871 | Bacteria | 3937 |
| 189 | Ga0075434_100269706 | 3300006871 | Bacteria | 1721 |
| 190 | Ga0075429_100041578 | 3300006880 | Bacteria | 4003 |
| 191 | Ga0068865_100011523 | 3300006881 | Bacteria | 5540 |
| 192 | Ga0075436_100005906 | 3300006914 | Bacteria | 8410 |
| 193 | Ga0075436_100031336 | 3300006914 | Bacteria | 3661 |
| 194 | Ga0075436_100076036 | 3300006914 | Unclassified | 2325 |
| 195 | Ga0075436_100110759 | 3300006914 | Bacteria | 1916 |
| 196 | Ga0075436_100111996 | 3300006914 | Bacteria | 1905 |
| 197 | Ga0075436_100246078 | 3300006914 | Bacteria | 1272 |
| 198 | Ga0075435_100032513 | 3300007076 | Bacteria | 4120 |
| 199 | Ga0075435_100550731 | 3300007076 | Bacteria | 999 |
| 200 | Ga0099794_10211515 | 3300007265 | Bacteria | 995 |
| 201 | Ga0099794_10321373 | 3300007265 | Bacteria | 803 |
| 202 | Ga0099794_10356461 | 3300007265 | Bacteria | 761 |
| 203 | Ga0105240_10134820 | 3300009093 | Bacteria | 2958 |
| 204 | Ga0105240_10139041 | 3300009093 | Bacteria | 2905 |
| 205 | Ga0111539_10092205 | 3300009094 | Bacteria | 3560 |
| 206 | Ga0111539_10243912 | 3300009094 | Bacteria | 2092 |
| 207 | Ga0105245_10045195 | 3300009098 | Bacteria | 3932 |
| 208 | Ga0105245_10844759 | 3300009098 | Unclassified | 955 |
| 209 | Ga0105245_11033997 | 3300009098 | Bacteria | 866 |
| 210 | Ga0105245_11943589 | 3300009098 | Bacteria | 642 |
| 211 | Ga0105245_12804450 | 3300009098 | Bacteria | 540 |
| 212 | Ga0114129_10098954 | 3300009147 | Bacteria | 4037 |
| 213 | Ga0114129_10109415 | 3300009147 | Bacteria | 3815 |
| 214 | Ga0114129_10335660 | 3300009147 | Bacteria | 2006 |
| 215 | Ga0114129_10722906 | 3300009147 | Bacteria | 1278 |
| 216 | Ga0114129_10833866 | 3300009147 | Bacteria | 1173 |
| 217 | Ga0114129_11694071 | 3300009147 | Bacteria | 772 |
| 218 | Ga0114129_13492309 | 3300009147 | Bacteria | 503 |
| 219 | Ga0105243_10002610 | 3300009148 | Bacteria | 15026 |
| 220 | Ga0105242_10001397 | 3300009176 | Bacteria | 19028 |
| 221 | Ga0105242_10235288 | 3300009176 | Bacteria | 1644 |
| 222 | Ga0105248_10000658 | 3300009177 | Bacteria | 39283 |
| 223 | Ga0105248_10045262 | 3300009177 | Bacteria | 4935 |
| 224 | Ga0105248_10124698 | 3300009177 | Bacteria | 2905 |
| 225 | Ga0105248_10302518 | 3300009177 | Bacteria | 1801 |
| 226 | Ga0105238_11970412 | 3300009551 | Unclassified | 617 |
| 227 | Ga0105249_10018112 | 3300009553 | Bacteria | 6260 |
| 228 | Ga0105249_10045179 | 3300009553 | Bacteria | 4006 |
| 229 | Ga0105249_10363726 | 3300009553 | Bacteria | 1469 |
| 230 | Ga0105249_13261997 | 3300009553 | Bacteria | 522 |
| 231 | Ga0105239_10004859 | 3300010375 | Bacteria | 15900 |
| 232 | Ga0105239_11171465 | 3300010375 | Bacteria | 885 |
| 233 | Ga0105239_11409516 | 3300010375 | Bacteria | 804 |
| 234 | Ga0105246_10044479 | 3300011119 | Bacteria | 3018 |
| 235 | Ga0157373_10011153 | 3300013100 | Bacteria | 6614 |
| 236 | Ga0157373_10439135 | 3300013100 | Bacteria | 938 |
| 237 | Ga0157371_10134444 | 3300013102 | Bacteria | 1761 |
| 238 | Ga0157370_10097794 | 3300013104 | Bacteria | 2753 |
| 239 | Ga0157378_10002774 | 3300013297 | Bacteria | 15611 |
| 240 | Ga0163162_10010076 | 3300013306 | Bacteria | 9187 |
| 241 | Ga0163162_12168377 | 3300013306 | Unclassified | 638 |
| 242 | Ga0157372_10026323 | 3300013307 | Bacteria | 6329 |
| 243 | Ga0157372_10313932 | 3300013307 | Bacteria | 1825 |
| 244 | Ga0157372_12982941 | 3300013307 | Unclassified | 541 |
| 245 | Ga0157372_13260754 | 3300013307 | Bacteria | 517 |
| 246 | Ga0157372_13372266 | 3300013307 | Unclassified | 508 |
| 247 | Ga0157375_10102888 | 3300013308 | Bacteria | 2942 |
| 248 | Ga0157375_10141916 | 3300013308 | Bacteria | 2530 |
| 249 | Ga0157375_10395543 | 3300013308 | Bacteria | 1549 |
| 250 | Ga0157375_10503538 | 3300013308 | Bacteria | 1375 |
| 251 | Ga0157375_11800852 | 3300013308 | Bacteria | 726 |
| 252 | Ga0163163_10633560 | 3300014325 | Bacteria | 1133 |
| 253 | Ga0157380_10017279 | 3300014326 | Bacteria | 5337 |
| 254 | Ga0182008_10276769 | 3300014497 | Bacteria | 872 |
| 255 | Ga0157379_10008817 | 3300014968 | Bacteria | 8796 |
| 256 | Ga0157379_10994525 | 3300014968 | Bacteria | 799 |
| 257 | Ga0157379_11529687 | 3300014968 | Bacteria | 650 |
| 258 | Ga0157376_10154753 | 3300014969 | Bacteria | 2071 |
| 259 | Ga0157376_10315650 | 3300014969 | Bacteria | 1484 |
| 260 | Ga0157376_10513831 | 3300014969 | Bacteria | 1179 |
| 261 | Ga0163161_10278734 | 3300017792 | Bacteria | 1311 |
| 262 | Ga0207653_10010980 | 3300025885 | Bacteria | 2827 |
| 263 | Ga0207653_10102367 | 3300025885 | Bacteria | 1014 |
| 264 | Ga0207682_10133141 | 3300025893 | Bacteria | 1111 |
| 265 | Ga0207682_10260162 | 3300025893 | Bacteria | 809 |
| 266 | Ga0207692_10732872 | 3300025898 | Unclassified | 643 |
| 267 | Ga0207642_10000600 | 3300025899 | Bacteria | 11072 |
| 268 | Ga0207642_10084299 | 3300025899 | Unclassified | 1552 |
| 269 | Ga0207642_11088962 | 3300025899 | Bacteria | 516 |
| 270 | Ga0207645_10000145 | 3300025907 | Bacteria | 55543 |
| 271 | Ga0207645_10312898 | 3300025907 | Bacteria | 1047 |
| 272 | Ga0207643_10007892 | 3300025908 | Bacteria | 5710 |
| 273 | Ga0207705_10880011 | 3300025909 | Bacteria | 694 |
| 274 | Ga0207684_10000781 | 3300025910 | Bacteria | 36974 |
| 275 | Ga0207684_10018361 | 3300025910 | Bacteria | 5987 |
| 276 | Ga0207684_10128392 | 3300025910 | Bacteria | 2176 |
| 277 | Ga0207684_10195617 | 3300025910 | Bacteria | 1744 |
| 278 | Ga0207684_10813433 | 3300025910 | Bacteria | 789 |
| 279 | Ga0207707_10236112 | 3300025912 | Bacteria | 1590 |
| 280 | Ga0207695_10007320 | 3300025913 | Bacteria | 14094 |
| 281 | Ga0207695_10246308 | 3300025913 | Bacteria | 1687 |
| 282 | Ga0207693_10237158 | 3300025915 | Bacteria | 1432 |
| 283 | Ga0207693_10360152 | 3300025915 | Bacteria | 1138 |
| 284 | Ga0207663_10000256 | 3300025916 | Bacteria | 23155 |
| 285 | Ga0207660_10164184 | 3300025917 | Bacteria | 1715 |
| 286 | Ga0207657_10482811 | 3300025919 | Unclassified | 971 |
| 287 | Ga0207657_11419341 | 3300025919 | Bacteria | 521 |
| 288 | Ga0207652_10530348 | 3300025921 | Bacteria | 1059 |
| 289 | Ga0207646_10001100 | 3300025922 | Bacteria | 34422 |
| 290 | Ga0207646_10010434 | 3300025922 | Bacteria | 9082 |
| 291 | Ga0207646_10060180 | 3300025922 | Bacteria | 3392 |
| 292 | Ga0207646_10120623 | 3300025922 | Bacteria | 2355 |
| 293 | Ga0207646_10182352 | 3300025922 | Bacteria | 1896 |
| 294 | Ga0207646_11145723 | 3300025922 | Bacteria | 683 |
| 295 | Ga0207681_10013785 | 3300025923 | Bacteria | 5007 |
| 296 | Ga0207681_11421767 | 3300025923 | Bacteria | 582 |
| 297 | Ga0207659_10121710 | 3300025926 | Bacteria | 2000 |
| 298 | Ga0207687_10045351 | 3300025927 | Bacteria | 3038 |
| 299 | Ga0207687_10464023 | 3300025927 | Bacteria | 1052 |
| 300 | Ga0207700_10090497 | 3300025928 | Bacteria | 2415 |
| 301 | Ga0207700_10112692 | 3300025928 | Bacteria | 2192 |
| 302 | Ga0207644_10536877 | 3300025931 | Bacteria | 967 |
| 303 | Ga0207644_10872406 | 3300025931 | Bacteria | 754 |
| 304 | Ga0207690_10166335 | 3300025932 | Bacteria | 1648 |
| 305 | Ga0207690_11410945 | 3300025932 | Bacteria | 582 |
| 306 | Ga0207706_10000146 | 3300025933 | Bacteria | 76821 |
| 307 | Ga0207706_10049239 | 3300025933 | Bacteria | 3725 |
| 308 | Ga0207686_10002394 | 3300025934 | Bacteria | 10234 |
| 309 | Ga0207709_10001445 | 3300025935 | Bacteria | 16588 |
| 310 | Ga0207669_10001017 | 3300025937 | Bacteria | 11970 |
| 311 | Ga0207669_10144725 | 3300025937 | Bacteria | 1656 |
| 312 | Ga0207669_10497991 | 3300025937 | Bacteria | 974 |
| 313 | Ga0207704_10009204 | 3300025938 | Bacteria | 4755 |
| 314 | Ga0207704_10740032 | 3300025938 | Bacteria | 817 |
| 315 | Ga0207665_10003606 | 3300025939 | Bacteria | 10340 |
| 316 | Ga0207665_10615494 | 3300025939 | Bacteria | 849 |
| 317 | Ga0207691_10098418 | 3300025940 | Bacteria | 2613 |
| 318 | Ga0207711_10015225 | 3300025941 | Bacteria | 6385 |
| 319 | Ga0207711_10109668 | 3300025941 | Bacteria | 2453 |
| 320 | Ga0207711_10367069 | 3300025941 | Bacteria | 1334 |
| 321 | Ga0207689_10091551 | 3300025942 | Bacteria | 2498 |
| 322 | Ga0207661_10323620 | 3300025944 | Bacteria | 1387 |
| 323 | Ga0207667_10866794 | 3300025949 | Bacteria | 896 |
| 324 | Ga0207651_10046086 | 3300025960 | Bacteria | 2929 |
| 325 | Ga0207712_10002961 | 3300025961 | Bacteria | 10839 |
| 326 | Ga0207712_10018227 | 3300025961 | Bacteria | 4569 |
| 327 | Ga0207712_10478335 | 3300025961 | Bacteria | 1061 |
| 328 | Ga0207712_10881959 | 3300025961 | Unclassified | 790 |
| 329 | Ga0207668_10018117 | 3300025972 | Bacteria | 4425 |
| 330 | Ga0207668_10140298 | 3300025972 | Bacteria | 1857 |
| 331 | Ga0207640_10016781 | 3300025981 | Bacteria | 4268 |
| 332 | Ga0207640_11277918 | 3300025981 | Bacteria | 655 |
| 333 | Ga0207658_10442960 | 3300025986 | Bacteria | 1149 |
| 334 | Ga0207678_10140084 | 3300026067 | Bacteria | 2064 |
| 335 | Ga0207708_10021560 | 3300026075 | Bacteria | 4859 |
| 336 | Ga0207702_10368805 | 3300026078 | Bacteria | 1378 |
| 337 | Ga0207648_10001390 | 3300026089 | Bacteria | 26643 |
| 338 | Ga0207648_10195238 | 3300026089 | Bacteria | 1795 |
| 339 | Ga0207676_10002613 | 3300026095 | Bacteria | 12841 |
| 340 | Ga0207674_10024439 | 3300026116 | Bacteria | 6457 |
| 341 | Ga0207675_100048912 | 3300026118 | Bacteria | 3947 |
| 342 | Ga0207675_100342145 | 3300026118 | Bacteria | 1464 |
| 343 | Ga0207675_100407878 | 3300026118 | Bacteria | 1340 |
| 344 | Ga0207683_10005089 | 3300026121 | Bacteria | 11283 |
| 345 | Ga0209588_1000481 | 3300027671 | Bacteria | 10236 |
| 346 | Ga0209588_1082418 | 3300027671 | Bacteria | 1039 |
| 347 | Ga0209974_10290135 | 3300027876 | Bacteria | 624 |
| 348 | Ga0268265_10086766 | 3300028380 | Bacteria | 2488 |
| 349 | Ga0268265_11369295 | 3300028380 | Bacteria | 709 |
| 350 | Ga0268264_10657904 | 3300028381 | Bacteria | 1037 |
| 351 | Ga0307408_100004762 | 3300031548 | Bacteria | 9148 |
| 352 | Ga0307408_100011114 | 3300031548 | Bacteria | 5948 |
| 353 | Ga0307408_100017983 | 3300031548 | Bacteria | 4741 |
| 354 | Ga0307408_100029054 | 3300031548 | Bacteria | 3827 |
| 355 | Ga0307408_100150000 | 3300031548 | Bacteria | 1839 |
| 356 | Ga0307408_100449435 | 3300031548 | Bacteria | 1117 |
| 357 | Ga0307408_101019495 | 3300031548 | Bacteria | 764 |
| 358 | Ga0307405_10039351 | 3300031731 | Bacteria | 2857 |
| 359 | Ga0307405_10054341 | 3300031731 | Bacteria | 2500 |
| 360 | Ga0307405_10074660 | 3300031731 | Bacteria | 2193 |
| 361 | Ga0307405_10122430 | 3300031731 | Bacteria | 1782 |
| 362 | Ga0307405_10431693 | 3300031731 | Bacteria | 1039 |
| 363 | Ga0307413_10002235 | 3300031824 | Bacteria | 7805 |
| 364 | Ga0307413_10058357 | 3300031824 | Bacteria | 2365 |
| 365 | Ga0307413_10066721 | 3300031824 | Bacteria | 2246 |
| 366 | Ga0307413_10122940 | 3300031824 | Unclassified | 1761 |
| 367 | Ga0307410_10002605 | 3300031852 | Bacteria | 8771 |
| 368 | Ga0307410_10008516 | 3300031852 | Bacteria | 5692 |
| 369 | Ga0307410_10010055 | 3300031852 | Bacteria | 5341 |
| 370 | Ga0307410_10018355 | 3300031852 | Bacteria | 4227 |
| 371 | Ga0307410_10023153 | 3300031852 | Bacteria | 3855 |
| 372 | Ga0307410_10024422 | 3300031852 | Bacteria | 3775 |
| 373 | Ga0307410_10032478 | 3300031852 | Bacteria | 3360 |
| 374 | Ga0307410_10516044 | 3300031852 | Bacteria | 985 |
| 375 | Ga0307406_10015327 | 3300031901 | Bacteria | 4433 |
| 376 | Ga0307406_10021817 | 3300031901 | Bacteria | 3793 |
| 377 | Ga0307406_10025363 | 3300031901 | Bacteria | 3549 |
| 378 | Ga0307406_10039984 | 3300031901 | Bacteria | 2913 |
| 379 | Ga0307406_10167252 | 3300031901 | Bacteria | 1587 |
| 380 | Ga0307406_10232586 | 3300031901 | Bacteria | 1377 |
| 381 | Ga0307407_10006601 | 3300031903 | Bacteria | 5178 |
| 382 | Ga0307407_10016027 | 3300031903 | Bacteria | 3722 |
| 383 | Ga0307407_10018926 | 3300031903 | Bacteria | 3496 |
| 384 | Ga0307407_10068379 | 3300031903 | Bacteria | 2103 |
| 385 | Ga0307407_10077467 | 3300031903 | Bacteria | 2000 |
| 386 | Ga0307407_10462230 | 3300031903 | Unclassified | 923 |
| 387 | Ga0307407_11074951 | 3300031903 | Bacteria | 624 |
| 388 | Ga0307412_10038147 | 3300031911 | Bacteria | 3092 |
| 389 | Ga0307412_10114740 | 3300031911 | Bacteria | 1929 |
| 390 | Ga0307412_10221564 | 3300031911 | Bacteria | 1450 |
| 391 | Ga0307412_10894446 | 3300031911 | Bacteria | 778 |
| 392 | Ga0307409_100000308 | 3300031995 | Bacteria | 19988 |
| 393 | Ga0307409_100002174 | 3300031995 | Bacteria | 10114 |
| 394 | Ga0307409_100010633 | 3300031995 | Bacteria | 5739 |
| 395 | Ga0307409_100039948 | 3300031995 | Bacteria | 3487 |
| 396 | Ga0307409_100041252 | 3300031995 | Bacteria | 3445 |
| 397 | Ga0307409_100097319 | 3300031995 | Bacteria | 2430 |
| 398 | Ga0307409_100271574 | 3300031995 | Bacteria | 1562 |
| 399 | Ga0307409_100437432 | 3300031995 | Bacteria | 1259 |
| 400 | Ga0307409_101014129 | 3300031995 | Bacteria | 848 |
| 401 | Ga0307416_100001186 | 3300032002 | Bacteria | 13997 |
| 402 | Ga0307416_100002892 | 3300032002 | Bacteria | 10004 |
| 403 | Ga0307416_100005003 | 3300032002 | Bacteria | 8081 |
| 404 | Ga0307416_100012945 | 3300032002 | Bacteria | 5647 |
| 405 | Ga0307416_100128498 | 3300032002 | Bacteria | 2275 |
| 406 | Ga0307416_100218658 | 3300032002 | Bacteria | 1825 |
| 407 | Ga0307416_100335110 | 3300032002 | Bacteria | 1522 |
| 408 | Ga0307416_100370800 | 3300032002 | Bacteria | 1457 |
| 409 | Ga0307416_100917937 | 3300032002 | Bacteria | 976 |
| 410 | Ga0307416_101664233 | 3300032002 | Unclassified | 743 |
| 411 | Ga0307414_10007376 | 3300032004 | Bacteria | 6179 |
| 412 | Ga0307414_10018252 | 3300032004 | Bacteria | 4313 |
| 413 | Ga0307414_10020050 | 3300032004 | Bacteria | 4157 |
| 414 | Ga0307414_10029042 | 3300032004 | Bacteria | 3595 |
| 415 | Ga0307414_10038035 | 3300032004 | Bacteria | 3227 |
| 416 | Ga0307414_10068365 | 3300032004 | Bacteria | 2549 |
| 417 | Ga0307414_10262942 | 3300032004 | Bacteria | 1441 |
| 418 | Ga0307414_10544554 | 3300032004 | Bacteria | 1033 |
| 419 | Ga0307411_10007316 | 3300032005 | Bacteria | 5609 |
| 420 | Ga0307411_10021429 | 3300032005 | Bacteria | 3782 |
| 421 | Ga0307411_10037531 | 3300032005 | Bacteria | 3047 |
| 422 | Ga0307411_10043332 | 3300032005 | Bacteria | 2878 |
| 423 | Ga0307411_10060118 | 3300032005 | Bacteria | 2522 |
| 424 | Ga0307411_10073449 | 3300032005 | Bacteria | 2327 |
| 425 | Ga0307411_10221136 | 3300032005 | Bacteria | 1469 |
| 426 | Ga0307411_10540825 | 3300032005 | Bacteria | 992 |
| 427 | Ga0307411_10540882 | 3300032005 | Bacteria | 992 |
| 428 | Ga0307415_100000203 | 3300032126 | Bacteria | 26255 |
| 429 | Ga0307415_100001513 | 3300032126 | Bacteria | 11158 |
| 430 | Ga0307415_100002691 | 3300032126 | Bacteria | 8876 |
| 431 | Ga0307415_100024157 | 3300032126 | Bacteria | 3789 |
| 432 | Ga0307415_100113984 | 3300032126 | Bacteria | 2011 |
| 433 | Ga0307415_100180126 | 3300032126 | Bacteria | 1657 |
| 434 | Ga0307415_100331890 | 3300032126 | Bacteria | 1273 |
| 435 | Ga0307415_100343075 | 3300032126 | Bacteria | 1254 |
| 436 | Ga0373959_0194587 | 3300034820 | Bacteria | 533 |
| 437 | Ga0373934_0000216 | 3300035086 | Bacteria | 21032 |
| 438 | Ga0373923_0002487 | 3300035111 | Bacteria | 5689 |
| 439 | Ga0373936_0038548 | 3300035113 | Bacteria | 1911 |
| 440 | Ga0373954_0155934 | 3300035118 | Bacteria | 1116 |
| 441 | Ga0373956_0000127 | 3300035119 | Bacteria | 26808 |
| 442 | Ga0373957_0057748 | 3300035120 | Bacteria | 1497 |
| 443 | Ga0373960_0133512 | 3300035121 | Unclassified | 835 |
| 444 | Ga0373955_0000777 | 3300035172 | Bacteria | 13686 |
| 445 | Ga0316574_0149959 | 3300035398 | Bacteria | 1503 |
| 446 | Ga0373924_0017754 | 3300035410 | Bacteria | 2734 |
| 447 | Ga0373931_0119880 | 3300035691 | Bacteria | 1503 |
| 448 | Ga0373935_0734418 | 3300035692 | Bacteria | 727 |
| 449 | Ga0373933_0005312 | 3300035724 | Bacteria | 7019 |
| 450 | Ga0373937_0000195 | 3300036401 | Bacteria | 59262 |
| 451 | Ga0373937_0847827 | 3300036401 | Bacteria | 862 |
| 452 | Ga0395901_1198567 | 3300038443 | Bacteria | 725 |
| 453 | Ga0395901_1882353 | 3300038443 | Bacteria | 546 |
| 454 | Ga0242420_007720 | 3300038996 | Bacteria | 1732 |
| 455 | Ga0439447_117110 | 3300041407 | Bacteria | 611 |
| 456 | Ga0439457_051423 | 3300042014 | Bacteria | 925 |
| 457 | Ga0450914_040608 | 3300042118 | Bacteria | 589 |
| 458 | Ga0450923_037850 | 3300042125 | Bacteria | 1005 |
| 459 | Ga0450894_023986 | 3300042131 | Bacteria | 831 |
| 460 | Ga0450898_010361 | 3300042134 | Bacteria | 1507 |
| 461 | Ga0439434_0167615 | 3300042435 | Bacteria | 732 |
| 462 | Ga0439444_0010638 | 3300042437 | Bacteria | 1473 |
| 463 | Ga0451577_0031234 | 3300042876 | Bacteria | 4808 |
| 464 | Ga0451577_0733947 | 3300042876 | Unclassified | 894 |
| 465 | Ga0453683_0040950 | 3300044673 | Bacteria | 2909 |
| 466 | Ga0453683_0056185 | 3300044673 | Bacteria | 2463 |
| 467 | Ga0453683_0075053 | 3300044673 | Bacteria | 2117 |
| 468 | Ga0453683_0327185 | 3300044673 | Bacteria | 983 |
| 469 | Ga0466963_0781117 | 3300044694 | Bacteria | 674 |
| 470 | Ga0466964_0091732 | 3300044706 | Bacteria | 1323 |
| 471 | Ga0466957_0663714 | 3300044842 | Bacteria | 734 |
| 472 | Ga0466959_0406472 | 3300045049 | Unclassified | 925 |
| 473 | Ga0451576_0025189 | 3300045051 | Bacteria | 6413 |
| 474 | Ga0451576_0135615 | 3300045051 | Bacteria | 2566 |
| 475 | Ga0451576_0794135 | 3300045051 | Bacteria | 994 |
| 476 | Ga0451576_1746582 | 3300045051 | Bacteria | 644 |
| 477 | Ga0495592_0001514 | 3300046454 | Bacteria | 16195 |
| 478 | Ga0495603_0074871 | 3300046455 | Bacteria | 1988 |
| 479 | Ga0495629_0016005 | 3300046459 | Bacteria | 5391 |
| 480 | Ga0495651_0000050 | 3300046462 | Bacteria | 87816 |
| 481 | Ga0495653_0000134 | 3300046463 | Bacteria | 61770 |
| 482 | Ga0495582_0794280 | 3300046473 | Unclassified | 548 |
| 483 | Ga0495639_0111938 | 3300046475 | Bacteria | 1296 |
| 484 | Ga0495594_0020281 | 3300046499 | Bacteria | 3540 |
| 485 | Ga0495608_0000381 | 3300046511 | Bacteria | 30883 |
| 486 | Ga0495618_0103033 | 3300046514 | Bacteria | 1827 |
| 487 | Ga0495628_0001309 | 3300046516 | Bacteria | 22847 |
| 488 | Ga0495630_0005719 | 3300046517 | Bacteria | 8789 |
| 489 | Ga0495663_0062529 | 3300046525 | Bacteria | 1173 |
| 490 | Ga0495666_0389443 | 3300046526 | Bacteria | 627 |
| 491 | Ga0495652_0000931 | 3300046529 | Bacteria | 33631 |
| 492 | Ga0495665_0246976 | 3300046531 | Bacteria | 919 |
| 493 | Ga0495586_0527257 | 3300046535 | Bacteria | 682 |
| 494 | Ga0495586_0533446 | 3300046535 | Bacteria | 677 |
| 495 | Ga0495587_0000114 | 3300046536 | Bacteria | 61671 |
| 496 | Ga0495598_0331430 | 3300046537 | Bacteria | 582 |
| 497 | Ga0495645_0000065 | 3300046543 | Bacteria | 73256 |
| 498 | Ga0495645_0309920 | 3300046543 | Bacteria | 1028 |
| 499 | Ga0495622_0188763 | 3300046557 | Bacteria | 922 |
| 500 | Ga0495667_0000316 | 3300046559 | Bacteria | 30681 |
| 501 | Ga0495634_0184587 | 3300046642 | Bacteria | 1304 |
| 502 | Ga0495611_0251082 | 3300046648 | Bacteria | 820 |
| 503 | Ga0495635_0000103 | 3300046663 | Bacteria | 50496 |
| 504 | Ga0495657_0000606 | 3300046675 | Bacteria | 32796 |
| 505 | Ga0495599_0000189 | 3300046678 | Bacteria | 40669 |
| 506 | Ga0495623_0000086 | 3300046679 | Bacteria | 55086 |
| 507 | Ga0495646_0000522 | 3300046680 | Bacteria | 20560 |
| 508 | Ga0495613_0045542 | 3300046689 | Unclassified | 3244 |
| 509 | Ga0495613_0605398 | 3300046689 | Unclassified | 729 |
| 510 | Ga0495600_0000145 | 3300046809 | Bacteria | 40582 |
| 511 | Ga0495604_0001195 | 3300047317 | Bacteria | 21435 |
| 512 | Ga0495636_0016755 | 3300047318 | Bacteria | 2930 |
| 513 | Ga0495674_0000339 | 3300047319 | Bacteria | 41326 |
| 514 | Ga0495674_0434626 | 3300047319 | Bacteria | 1056 |
| 515 | Ga0495675_0003609 | 3300047444 | Bacteria | 9329 |
| 516 | Ga0495684_0000141 | 3300047471 | Bacteria | 53032 |
| 517 | Ga0495593_0208553 | 3300047673 | Bacteria | 981 |
| 518 | Ga0495602_0003470 | 3300048088 | Bacteria | 16312 |
| 519 | Ga0496100_0461076 | 3300048903 | Bacteria | 975 |
| 520 | Ga0496101_0679261 | 3300048904 | Unclassified | 813 |
| 521 | Ga0496102_0012149 | 3300048905 | Bacteria | 7443 |
| 522 | Ga0496102_0139858 | 3300048905 | Bacteria | 2270 |
| 523 | Ga0496106_0094860 | 3300048909 | Bacteria | 2307 |
| 524 | Ga0496106_0892106 | 3300048909 | Unclassified | 702 |
| 525 | Ga0496106_1230861 | 3300048909 | Unclassified | 583 |
| 526 | Ga0496107_0806595 | 3300048910 | Bacteria | 687 |
| 527 | Ga0496108_0014418 | 3300048911 | Bacteria | 6454 |
| 528 | Ga0496108_0191676 | 3300048911 | Bacteria | 1772 |
| 529 | Ga0496109_0043387 | 3300048912 | Bacteria | 4076 |
| 530 | Ga0496109_0253010 | 3300048912 | Bacteria | 1659 |
| 531 | Ga0496109_0483733 | 3300048912 | Bacteria | 1169 |
| 532 | Ga0496110_1136465 | 3300048913 | Unclassified | 689 |
| 533 | Ga0496111_0005733 | 3300048914 | Bacteria | 8009 |
| 534 | Ga0496112_0024531 | 3300048915 | Bacteria | 5776 |
| 535 | Ga0496113_0114414 | 3300048916 | Bacteria | 2103 |
| 536 | Ga0496114_0100688 | 3300048917 | Bacteria | 2466 |
| 537 | Ga0501292_017167 | 3300049515 | Bacteria | 1143 |
| 538 | Ga0501298_001135 | 3300049521 | Bacteria | 3847 |
| 539 | Ga0501036_0306114 | 3300049572 | Bacteria | 1329 |
| 540 | Ga0501039_0327426 | 3300049575 | Bacteria | 1204 |
| 541 | Ga0501040_0039277 | 3300049576 | Bacteria | 3219 |
| 542 | Ga0501040_0202547 | 3300049576 | Bacteria | 1409 |
| 543 | Ga0501040_0210907 | 3300049576 | Bacteria | 1381 |
| 544 | Ga0501040_1394112 | 3300049576 | Bacteria | 509 |
| 545 | Ga0501041_0211245 | 3300049577 | Bacteria | 1217 |
| 546 | Ga0501041_0225175 | 3300049577 | Bacteria | 1177 |
| 547 | Ga0501042_0039868 | 3300049578 | Bacteria | 3339 |
| 548 | Ga0501048_0401870 | 3300049582 | Bacteria | 979 |
| 549 | Ga0501067_0142408 | 3300049583 | Bacteria | 1335 |
| 550 | Ga0501067_0432539 | 3300049583 | Bacteria | 735 |
| 551 | Ga0501068_0483215 | 3300049584 | Unclassified | 803 |
| 552 | Ga0501069_0081213 | 3300049585 | Bacteria | 1826 |
| 553 | Ga0501069_0144646 | 3300049585 | Bacteria | 1365 |
| 554 | Ga0501069_0328912 | 3300049585 | Bacteria | 899 |
| 555 | Ga0501074_0148874 | 3300049590 | Bacteria | 1674 |
| 556 | Ga0501075_0012654 | 3300049591 | Bacteria | 6001 |
| 557 | Ga0501075_0423500 | 3300049591 | Bacteria | 1015 |
| 558 | Ga0501076_0006362 | 3300049592 | Bacteria | 8563 |
| 559 | Ga0501076_0054307 | 3300049592 | Bacteria | 3175 |
| 560 | Ga0501076_0100900 | 3300049592 | Bacteria | 2326 |
| 561 | Ga0501076_0542646 | 3300049592 | Bacteria | 959 |
| 562 | Ga0501076_1181383 | 3300049592 | Bacteria | 630 |
| 563 | Ga0501077_0049965 | 3300049593 | Bacteria | 2658 |
| 564 | Ga0501077_0068151 | 3300049593 | Bacteria | 2256 |
| 565 | Ga0501202_044021 | 3300049652 | Bacteria | 972 |
| 566 | Ga0501209_104200 | 3300049656 | Bacteria | 834 |
| 567 | Ga0501211_012261 | 3300049658 | Bacteria | 847 |
| 568 | Ga0501217_016584 | 3300049661 | Bacteria | 1690 |
| 569 | Ga0501239_001326 | 3300049672 | Bacteria | 2105 |
| 570 | Ga0501247_002620 | 3300049677 | Bacteria | 1881 |
| 571 | Ga0501249_004401 | 3300049679 | Bacteria | 2863 |
| 572 | Ga0501251_003724 | 3300049681 | Bacteria | 1537 |
| 573 | Ga0501252_015053 | 3300049682 | Bacteria | 963 |
| 574 | Ga0501253_002688 | 3300049683 | Bacteria | 2034 |
| 575 | Ga0501257_029004 | 3300049686 | Bacteria | 1329 |
| 576 | Ga0501259_028777 | 3300049688 | Bacteria | 1036 |
| 577 | Ga0501221_109014 | 3300049704 | Unclassified | 696 |
| 578 | Ga0501225_0038105 | 3300049705 | Bacteria | 1325 |
| 579 | Ga0501229_018661 | 3300049706 | Bacteria | 910 |
| 580 | Ga0501079_0066150 | 3300049741 | Bacteria | 2789 |
| 581 | Ga0501079_0114219 | 3300049741 | Bacteria | 2099 |
| 582 | Ga0501079_0115497 | 3300049741 | Bacteria | 2086 |
| 583 | Ga0501079_0157933 | 3300049741 | Bacteria | 1768 |
| 584 | Ga0501081_0086647 | 3300049743 | Bacteria | 2199 |
| 585 | Ga0501081_0116664 | 3300049743 | Bacteria | 1898 |
| 586 | Ga0501081_0433970 | 3300049743 | Bacteria | 975 |
| 587 | Ga0501083_0070119 | 3300049744 | Bacteria | 2332 |
| 588 | Ga0501083_0253680 | 3300049744 | Bacteria | 1145 |
| 589 | Ga0501262_013832 | 3300049759 | Bacteria | 1044 |
| 590 | Ga0501267_014316 | 3300049764 | Bacteria | 831 |
| 591 | Ga0501268_004221 | 3300049765 | Bacteria | 2015 |
| 592 | Ga0501270_004607 | 3300049767 | Bacteria | 1557 |
| 593 | Ga0501270_009331 | 3300049767 | Bacteria | 1265 |
| 594 | Ga0501271_013510 | 3300049768 | Unclassified | 895 |
| 595 | Ga0501272_000650 | 3300049769 | Bacteria | 3108 |
| 596 | Ga0501272_060896 | 3300049769 | Bacteria | 539 |
| 597 | Ga0501273_000667 | 3300049770 | Bacteria | 2888 |
| 598 | Ga0501275_007220 | 3300049772 | Bacteria | 1113 |
| 599 | Ga0501276_005632 | 3300049773 | Bacteria | 968 |
| 600 | Ga0501283_032985 | 3300049779 | Bacteria | 875 |
| 601 | Ga0501045_0033094 | 3300049824 | Bacteria | 3748 |
| 602 | Ga0501045_0164304 | 3300049824 | Bacteria | 1653 |
| 603 | Ga0501045_0227905 | 3300049824 | Bacteria | 1387 |
| 604 | Ga0501204_013191 | 3300049850 | Bacteria | 1001 |
| 605 | Ga0501212_012418 | 3300049851 | Bacteria | 1239 |
| 606 | nmdc:mga05p37_1090530_c1 | 3300050507 | Bacteria | 837 |
| 607 | nmdc:mga05p37_141682_c1 | 3300050507 | Bacteria | 2945 |
| 608 | nmdc:mga05p37_14934_c1 | 3300050507 | Bacteria | 9323 |
| 609 | nmdc:mga05p37_257030_c1 | 3300050507 | Bacteria | 2093 |
| 610 | nmdc:mga05p37_287594_c1 | 3300050507 | Bacteria | 1958 |
| 611 | nmdc:mga09592_118044_c1 | 3300050508 | Bacteria | 2277 |
| 612 | nmdc:mga09592_28843_c1 | 3300050508 | Bacteria | 4614 |
| 613 | nmdc:mga0qj67_351855_c1 | 3300050509 | Bacteria | 1191 |
| 614 | nmdc:mga0qj67_66558_c1 | 3300050509 | Bacteria | 2869 |
| 615 | nmdc:mga0qj67_724602_c1 | 3300050509 | Bacteria | 790 |
| 616 | nmdc:mga06r32_3480_c1 | 3300050510 | Bacteria | 14060 |
| 617 | nmdc:mga06r32_69410_c1 | 3300050510 | Bacteria | 3406 |
| 618 | nmdc:mga06r32_720935_c1 | 3300050510 | Bacteria | 962 |
| 619 | nmdc:mga08y16_1888723_c1 | 3300050511 | Bacteria | 548 |
| 620 | nmdc:mga08y16_1964688_c1 | 3300050511 | Bacteria | 535 |
| 621 | nmdc:mga08y16_240601_c1 | 3300050511 | Bacteria | 1871 |
| 622 | nmdc:mga0n895_1038875_c1 | 3300050512 | Bacteria | 799 |
| 623 | nmdc:mga0n895_118347_c1 | 3300050512 | Bacteria | 2669 |
| 624 | nmdc:mga0n895_1825373_c1 | 3300050512 | Bacteria | 568 |
| 625 | nmdc:mga0n895_383_c1 | 3300050512 | Bacteria | 29938 |
| 626 | nmdc:mga0n895_43514_c1 | 3300050512 | Bacteria | 4376 |
| 627 | nmdc:mga0n895_616_c1 | 3300050512 | Bacteria | 24731 |
| 628 | nmdc:mga0n895_9577_c1 | 3300050512 | Bacteria | 8484 |
| 629 | nmdc:mga0rr50_492534_c1 | 3300050513 | Bacteria | 1042 |
| 630 | nmdc:mga08x19_1089800_c1 | 3300050514 | Bacteria | 567 |
| 631 | nmdc:mga08x19_1141813_c1 | 3300050514 | Bacteria | 553 |
| 632 | nmdc:mga08x19_22359_c1 | 3300050514 | Bacteria | 3916 |
| 633 | nmdc:mga08x19_51459_c1 | 3300050514 | Bacteria | 2646 |
| 634 | nmdc:mga08x19_59612_c1 | 3300050514 | Unclassified | 2471 |
| 635 | nmdc:mga08x19_66088_c1 | 3300050514 | Bacteria | 2350 |
| 636 | nmdc:mga08x19_7632_c1 | 3300050514 | Bacteria | 6426 |
| 637 | nmdc:mga0a205_227538_c1 | 3300050515 | Bacteria | 1749 |
| 638 | nmdc:mga0a205_400033_c1 | 3300050515 | Bacteria | 1237 |
| 639 | nmdc:mga0a205_44464_c1 | 3300050515 | Bacteria | 4281 |
| 640 | nmdc:mga0a205_659_c1 | 3300050515 | Bacteria | 27518 |
| 641 | Ga0495601_0001299 | 3300053077 | Bacteria | 13725 |
| 642 | Ga0495612_0004440 | 3300053078 | Bacteria | 5820 |
| 643 | Ga0495595_0004129 | 3300053084 | Bacteria | 5828 |
| 644 | Ga0495619_0001149 | 3300053085 | Bacteria | 17383 |
| 645 | Ga0501084_0032489 | 3300054114 | Bacteria | 4365 |
| 646 | Ga0590071_003383 | 3300059421 | Bacteria | 3924 |
| 647 | Ga0501082_0021339 | 3300060353 | Bacteria | 5587 |
| 648 | Ga0501082_0042056 | 3300060353 | Bacteria | 3940 |
| 649 | Ga0501082_0089354 | 3300060353 | Bacteria | 2660 |
| 650 | Ga0530510_0373583 | 3300061734 | Bacteria | 1073 |
| 651 | Ga0530510_0482500 | 3300061734 | Bacteria | 939 |
| 652 | Ga0530510_0536910 | 3300061734 | Bacteria | 888 |
| 653 | Ga0530510_1032550 | 3300061734 | Bacteria | 629 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10026323 | Ga0157372_100263234 | 108 |
| 2 | 3300009093 | Ga0105240_10139041 | Ga0105240_101390414 | 115 |
| 3 | 3300059421 | Ga0590071_003383 | Ga0590071_003383_1990_2430 | 115 |
| 4 | 3300031548 | Ga0307408_101019495 | Ga0307408_1010194951 | 116 |
| 5 | 3300031852 | Ga0307410_10516044 | Ga0307410_105160442 | 116 |
| 6 | 3300031901 | Ga0307406_10232586 | Ga0307406_102325862 | 116 |
| 7 | 3300031903 | Ga0307407_10077467 | Ga0307407_100774672 | 116 |
| 8 | 3300031911 | Ga0307412_10894446 | Ga0307412_108944461 | 116 |
| 9 | 3300031995 | Ga0307409_100097319 | Ga0307409_1000973192 | 116 |
| 10 | 3300032002 | Ga0307416_100917937 | Ga0307416_1009179372 | 116 |
| 11 | 3300032004 | Ga0307414_10068365 | Ga0307414_100683652 | 116 |
| 12 | 3300032004 | Ga0307414_10544554 | Ga0307414_105445542 | 116 |
| 13 | 3300032005 | Ga0307411_10073449 | Ga0307411_100734492 | 116 |
| 14 | 3300032005 | Ga0307411_10540882 | Ga0307411_105408822 | 116 |
| 15 | 3300032126 | Ga0307415_100180126 | Ga0307415_1001801262 | 116 |
| 16 | 3300032126 | Ga0307415_100331890 | Ga0307415_1003318902 | 116 |
| 17 | 3300006844 | Ga0075428_100339399 | Ga0075428_1003393991 | 117 |
| 18 | 3300009094 | Ga0111539_10092205 | Ga0111539_100922052 | 117 |
| 19 | 3300046525 | Ga0495663_0062529 | Ga0495663_0062529_306_686 | 117 |
| 20 | 3300049652 | Ga0501202_044021 | Ga0501202_044021_10_390 | 117 |
| 21 | 3300050511 | nmdc:mga08y16_240601_c1 | nmdc:mga08y16_240601_c1_594_968 | 117 |
| 22 | 3300005434 | Ga0070709_11355469 | Ga0070709_113554692 | 118 |
| 23 | 3300005436 | Ga0070713_100113358 | Ga0070713_1001133584 | 118 |
| 24 | 3300005437 | Ga0070710_10175789 | Ga0070710_101757892 | 118 |
| 25 | 3300005437 | Ga0070710_10874543 | Ga0070710_108745432 | 118 |
| 26 | 3300005444 | Ga0070694_101820730 | Ga0070694_1018207302 | 118 |
| 27 | 3300005467 | Ga0070706_100829050 | Ga0070706_1008290502 | 118 |
| 28 | 3300005468 | Ga0070707_100023968 | Ga0070707_1000239686 | 118 |
| 29 | 3300005471 | Ga0070698_100742262 | Ga0070698_1007422622 | 118 |
| 30 | 3300005518 | Ga0070699_100568310 | Ga0070699_1005683102 | 118 |
| 31 | 3300005518 | Ga0070699_100929130 | Ga0070699_1009291302 | 118 |
| 32 | 3300005536 | Ga0070697_101187855 | Ga0070697_1011878552 | 118 |
| 33 | 3300005536 | Ga0070697_101386299 | Ga0070697_1013862992 | 118 |
| 34 | 3300005546 | Ga0070696_100163225 | Ga0070696_1001632252 | 118 |
| 35 | 3300005841 | Ga0068863_100168747 | Ga0068863_1001687473 | 118 |
| 36 | 3300006028 | Ga0070717_10140053 | Ga0070717_101400533 | 118 |
| 37 | 3300006163 | Ga0070715_10684052 | Ga0070715_106840522 | 118 |
| 38 | 3300006173 | Ga0070716_100142125 | Ga0070716_1001421251 | 118 |
| 39 | 3300006173 | Ga0070716_100719062 | Ga0070716_1007190622 | 118 |
| 40 | 3300006175 | Ga0070712_100145615 | Ga0070712_1001456152 | 118 |
| 41 | 3300006175 | Ga0070712_101215198 | Ga0070712_1012151982 | 118 |
| 42 | 3300006844 | Ga0075428_100016140 | Ga0075428_1000161406 | 118 |
| 43 | 3300006846 | Ga0075430_100449111 | Ga0075430_1004491112 | 118 |
| 44 | 3300006847 | Ga0075431_100216448 | Ga0075431_1002164482 | 118 |
| 45 | 3300006852 | Ga0075433_10209853 | Ga0075433_102098533 | 118 |
| 46 | 3300014497 | Ga0182008_10276769 | Ga0182008_102767692 | 118 |
| 47 | 3300014968 | Ga0157379_11529687 | Ga0157379_115296872 | 118 |
| 48 | 3300025928 | Ga0207700_10090497 | Ga0207700_100904975 | 118 |
| 49 | 3300038996 | Ga0242420_007720 | Ga0242420_007720_1210_1584 | 118 |
| 50 | 3300044706 | Ga0466964_0091732 | Ga0466964_0091732_500_874 | 118 |
| 51 | 3300048905 | Ga0496102_0012149 | Ga0496102_0012149_1188_1562 | 118 |
| 52 | 3300049585 | Ga0501069_0081213 | Ga0501069_0081213_1164_1538 | 118 |
| 53 | 3300049585 | Ga0501069_0144646 | Ga0501069_0144646_455_832 | 118 |
| 54 | 3300025898 | Ga0207692_10732872 | Ga0207692_107328722 | 119 |
| 55 | 3300044673 | Ga0453683_0327185 | Ga0453683_0327185_16_402 | 119 |
| 56 | 3300005344 | Ga0070661_101864374 | Ga0070661_1018643741 | 120 |
| 57 | 3300005406 | Ga0070703_10314565 | Ga0070703_103145652 | 120 |
| 58 | 3300005434 | Ga0070709_10001217 | Ga0070709_100012172 | 120 |
| 59 | 3300005435 | Ga0070714_100389060 | Ga0070714_1003890601 | 120 |
| 60 | 3300005436 | Ga0070713_100534831 | Ga0070713_1005348312 | 120 |
| 61 | 3300005439 | Ga0070711_100000239 | Ga0070711_10000023916 | 120 |
| 62 | 3300005444 | Ga0070694_100101863 | Ga0070694_1001018632 | 120 |
| 63 | 3300005455 | Ga0070663_100753113 | Ga0070663_1007531132 | 120 |
| 64 | 3300005458 | Ga0070681_10140437 | Ga0070681_101404373 | 120 |
| 65 | 3300005471 | Ga0070698_100093544 | Ga0070698_1000935442 | 120 |
| 66 | 3300005471 | Ga0070698_100355098 | Ga0070698_1003550982 | 120 |
| 67 | 3300005518 | Ga0070699_100314188 | Ga0070699_1003141882 | 120 |
| 68 | 3300005535 | Ga0070684_100948302 | Ga0070684_1009483022 | 120 |
| 69 | 3300005536 | Ga0070697_100051645 | Ga0070697_1000516452 | 120 |
| 70 | 3300005545 | Ga0070695_100002535 | Ga0070695_10000253510 | 120 |
| 71 | 3300005545 | Ga0070695_100033544 | Ga0070695_1000335445 | 120 |
| 72 | 3300005548 | Ga0070665_101827498 | Ga0070665_1018274981 | 120 |
| 73 | 3300005564 | Ga0070664_100919080 | Ga0070664_1009190802 | 120 |
| 74 | 3300005578 | Ga0068854_100776712 | Ga0068854_1007767122 | 120 |
| 75 | 3300006847 | Ga0075431_100044571 | Ga0075431_1000445714 | 120 |
| 76 | 3300006871 | Ga0075434_100269706 | Ga0075434_1002697062 | 120 |
| 77 | 3300006914 | Ga0075436_100031336 | Ga0075436_1000313364 | 120 |
| 78 | 3300009098 | Ga0105245_11033997 | Ga0105245_110339972 | 120 |
| 79 | 3300009147 | Ga0114129_13492309 | Ga0114129_134923092 | 120 |
| 80 | 3300009176 | Ga0105242_10235288 | Ga0105242_102352883 | 120 |
| 81 | 3300009177 | Ga0105248_10124698 | Ga0105248_101246984 | 120 |
| 82 | 3300009553 | Ga0105249_13261997 | Ga0105249_132619971 | 120 |
| 83 | 3300010375 | Ga0105239_11171465 | Ga0105239_111714652 | 120 |
| 84 | 3300013104 | Ga0157370_10097794 | Ga0157370_100977943 | 120 |
| 85 | 3300013308 | Ga0157375_10102888 | Ga0157375_101028884 | 120 |
| 86 | 3300014969 | Ga0157376_10315650 | Ga0157376_103156502 | 120 |
| 87 | 3300025885 | Ga0207653_10102367 | Ga0207653_101023672 | 120 |
| 88 | 3300025913 | Ga0207695_10007320 | Ga0207695_1000732010 | 120 |
| 89 | 3300025916 | Ga0207663_10000256 | Ga0207663_1000025615 | 120 |
| 90 | 3300025927 | Ga0207687_10464023 | Ga0207687_104640231 | 120 |
| 91 | 3300025931 | Ga0207644_10872406 | Ga0207644_108724062 | 120 |
| 92 | 3300025937 | Ga0207669_10144725 | Ga0207669_101447252 | 120 |
| 93 | 3300025941 | Ga0207711_10367069 | Ga0207711_103670692 | 120 |
| 94 | 3300026078 | Ga0207702_10368805 | Ga0207702_103688052 | 120 |
| 95 | 3300031852 | Ga0307410_10032478 | Ga0307410_100324784 | 120 |
| 96 | 3300031903 | Ga0307407_10018926 | Ga0307407_100189262 | 120 |
| 97 | 3300032004 | Ga0307414_10018252 | Ga0307414_100182525 | 120 |
| 98 | 3300032005 | Ga0307411_10540825 | Ga0307411_105408252 | 120 |
| 99 | 3300044694 | Ga0466963_0781117 | Ga0466963_0781117_205_579 | 120 |
| 100 | 3300045049 | Ga0466959_0406472 | Ga0466959_0406472_346_861 | 120 |
| 101 | 3300045051 | Ga0451576_0794135 | Ga0451576_0794135_297_677 | 120 |
| 102 | 3300046526 | Ga0495666_0389443 | Ga0495666_0389443_14_388 | 120 |
| 103 | 3300049576 | Ga0501040_0039277 | Ga0501040_0039277_839_1288 | 120 |
| 104 | 3300049577 | Ga0501041_0211245 | Ga0501041_0211245_586_966 | 120 |
| 105 | 3300049577 | Ga0501041_0225175 | Ga0501041_0225175_39_488 | 120 |
| 106 | 3300049582 | Ga0501048_0401870 | Ga0501048_0401870_334_783 | 120 |
| 107 | 3300049592 | Ga0501076_1181383 | Ga0501076_1181383_16_393 | 120 |
| 108 | 3300049593 | Ga0501077_0068151 | Ga0501077_0068151_1258_1638 | 120 |
| 109 | 3300049741 | Ga0501079_0114219 | Ga0501079_0114219_1393_1773 | 120 |
| 110 | 3300049743 | Ga0501081_0086647 | Ga0501081_0086647_347_796 | 120 |
| 111 | 3300049743 | Ga0501081_0116664 | Ga0501081_0116664_842_1222 | 120 |
| 112 | 3300049744 | Ga0501083_0253680 | Ga0501083_0253680_549_929 | 120 |
| 113 | 3300049824 | Ga0501045_0227905 | Ga0501045_0227905_178_627 | 120 |
| 114 | 3300050508 | nmdc:mga09592_118044_c1 | nmdc:mga09592_118044_c1_368_751 | 120 |
| 115 | 3300050509 | nmdc:mga0qj67_66558_c1 | nmdc:mga0qj67_66558_c1_1503_1919 | 120 |
| 116 | 3300050510 | nmdc:mga06r32_3480_c1 | nmdc:mga06r32_3480_c1_8627_9043 | 120 |
| 117 | 3300050512 | nmdc:mga0n895_118347_c1 | nmdc:mga0n895_118347_c1_771_1151 | 120 |
| 118 | 3300050512 | nmdc:mga0n895_1825373_c1 | nmdc:mga0n895_1825373_c1_157_537 | 120 |
| 119 | 3300050514 | nmdc:mga08x19_7632_c1 | nmdc:mga08x19_7632_c1_3862_4236 | 120 |
| 120 | 3300061734 | Ga0530510_0536910 | Ga0530510_0536910_390_839 | 120 |
| 121 | 3300005293 | Ga0065715_10604432 | Ga0065715_106044322 | 121 |
| 122 | 3300005327 | Ga0070658_10793027 | Ga0070658_107930272 | 121 |
| 123 | 3300005328 | Ga0070676_10001926 | Ga0070676_1000192613 | 121 |
| 124 | 3300005330 | Ga0070690_100760644 | Ga0070690_1007606441 | 121 |
| 125 | 3300005331 | Ga0070670_100752016 | Ga0070670_1007520162 | 121 |
| 126 | 3300005333 | Ga0070677_10514782 | Ga0070677_105147822 | 121 |
| 127 | 3300005334 | Ga0068869_100050894 | Ga0068869_1000508944 | 121 |
| 128 | 3300005337 | Ga0070682_100095513 | Ga0070682_1000955132 | 121 |
| 129 | 3300005339 | Ga0070660_101211320 | Ga0070660_1012113201 | 121 |
| 130 | 3300005347 | Ga0070668_100010255 | Ga0070668_1000102554 | 121 |
| 131 | 3300005347 | Ga0070668_100567065 | Ga0070668_1005670652 | 121 |
| 132 | 3300005353 | Ga0070669_100262483 | Ga0070669_1002624832 | 121 |
| 133 | 3300005353 | Ga0070669_100405137 | Ga0070669_1004051371 | 121 |
| 134 | 3300005353 | Ga0070669_101494500 | Ga0070669_1014945002 | 121 |
| 135 | 3300005354 | Ga0070675_100112925 | Ga0070675_1001129252 | 121 |
| 136 | 3300005354 | Ga0070675_101391199 | Ga0070675_1013911992 | 121 |
| 137 | 3300005355 | Ga0070671_100584872 | Ga0070671_1005848721 | 121 |
| 138 | 3300005356 | Ga0070674_100000378 | Ga0070674_10000037810 | 121 |
| 139 | 3300005356 | Ga0070674_100502628 | Ga0070674_1005026281 | 121 |
| 140 | 3300005364 | Ga0070673_100033447 | Ga0070673_1000334472 | 121 |
| 141 | 3300005367 | Ga0070667_101918162 | Ga0070667_1019181621 | 121 |
| 142 | 3300005406 | Ga0070703_10002195 | Ga0070703_100021952 | 121 |
| 143 | 3300005406 | Ga0070703_10007122 | Ga0070703_100071222 | 121 |
| 144 | 3300005406 | Ga0070703_10037010 | Ga0070703_100370102 | 121 |
| 145 | 3300005434 | Ga0070709_10018925 | Ga0070709_100189251 | 121 |
| 146 | 3300005434 | Ga0070709_10393620 | Ga0070709_103936202 | 121 |
| 147 | 3300005438 | Ga0070701_10516595 | Ga0070701_105165951 | 121 |
| 148 | 3300005440 | Ga0070705_100002647 | Ga0070705_1000026472 | 121 |
| 149 | 3300005440 | Ga0070705_100225392 | Ga0070705_1002253921 | 121 |
| 150 | 3300005441 | Ga0070700_100056332 | Ga0070700_1000563323 | 121 |
| 151 | 3300005444 | Ga0070694_100021499 | Ga0070694_1000214992 | 121 |
| 152 | 3300005444 | Ga0070694_100065552 | Ga0070694_1000655522 | 121 |
| 153 | 3300005444 | Ga0070694_100090828 | Ga0070694_1000908283 | 121 |
| 154 | 3300005445 | Ga0070708_100016285 | Ga0070708_1000162854 | 121 |
| 155 | 3300005445 | Ga0070708_100066036 | Ga0070708_1000660364 | 121 |
| 156 | 3300005445 | Ga0070708_100156312 | Ga0070708_1001563122 | 121 |
| 157 | 3300005445 | Ga0070708_100394684 | Ga0070708_1003946842 | 121 |
| 158 | 3300005445 | Ga0070708_101360018 | Ga0070708_1013600181 | 121 |
| 159 | 3300005455 | Ga0070663_100117091 | Ga0070663_1001170912 | 121 |
| 160 | 3300005456 | Ga0070678_100010489 | Ga0070678_1000104893 | 121 |
| 161 | 3300005457 | Ga0070662_100051092 | Ga0070662_1000510923 | 121 |
| 162 | 3300005458 | Ga0070681_11117616 | Ga0070681_111176162 | 121 |
| 163 | 3300005459 | Ga0068867_100001672 | Ga0068867_1000016728 | 121 |
| 164 | 3300005467 | Ga0070706_100100212 | Ga0070706_1001002123 | 121 |
| 165 | 3300005467 | Ga0070706_100105980 | Ga0070706_1001059803 | 121 |
| 166 | 3300005467 | Ga0070706_100147250 | Ga0070706_1001472502 | 121 |
| 167 | 3300005467 | Ga0070706_100241260 | Ga0070706_1002412602 | 121 |
| 168 | 3300005467 | Ga0070706_101589949 | Ga0070706_1015899492 | 121 |
| 169 | 3300005468 | Ga0070707_100018022 | Ga0070707_1000180224 | 121 |
| 170 | 3300005468 | Ga0070707_100023066 | Ga0070707_10002306610 | 121 |
| 171 | 3300005468 | Ga0070707_100048346 | Ga0070707_1000483466 | 121 |
| 172 | 3300005468 | Ga0070707_100051348 | Ga0070707_1000513484 | 121 |
| 173 | 3300005468 | Ga0070707_100071620 | Ga0070707_1000716206 | 121 |
| 174 | 3300005468 | Ga0070707_100109021 | Ga0070707_1001090212 | 121 |
| 175 | 3300005468 | Ga0070707_101853330 | Ga0070707_1018533302 | 121 |
| 176 | 3300005471 | Ga0070698_100000037 | Ga0070698_10000003786 | 121 |
| 177 | 3300005471 | Ga0070698_100088251 | Ga0070698_1000882514 | 121 |
| 178 | 3300005518 | Ga0070699_100019554 | Ga0070699_1000195548 | 121 |
| 179 | 3300005518 | Ga0070699_100052119 | Ga0070699_1000521194 | 121 |
| 180 | 3300005518 | Ga0070699_100290171 | Ga0070699_1002901712 | 121 |
| 181 | 3300005535 | Ga0070684_101027185 | Ga0070684_1010271851 | 121 |
| 182 | 3300005536 | Ga0070697_100013672 | Ga0070697_1000136725 | 121 |
| 183 | 3300005536 | Ga0070697_100015734 | Ga0070697_1000157347 | 121 |
| 184 | 3300005536 | Ga0070697_100125275 | Ga0070697_1001252752 | 121 |
| 185 | 3300005536 | Ga0070697_100259515 | Ga0070697_1002595152 | 121 |
| 186 | 3300005536 | Ga0070697_100632342 | Ga0070697_1006323421 | 121 |
| 187 | 3300005543 | Ga0070672_100227569 | Ga0070672_1002275692 | 121 |
| 188 | 3300005544 | Ga0070686_100377075 | Ga0070686_1003770751 | 121 |
| 189 | 3300005545 | Ga0070695_100041833 | Ga0070695_1000418331 | 121 |
| 190 | 3300005545 | Ga0070695_100053123 | Ga0070695_1000531233 | 121 |
| 191 | 3300005546 | Ga0070696_100101292 | Ga0070696_1001012921 | 121 |
| 192 | 3300005547 | Ga0070693_100064398 | Ga0070693_1000643984 | 121 |
| 193 | 3300005549 | Ga0070704_100005461 | Ga0070704_1000054615 | 121 |
| 194 | 3300005549 | Ga0070704_100061295 | Ga0070704_1000612953 | 121 |
| 195 | 3300005615 | Ga0070702_100001397 | Ga0070702_10000139710 | 121 |
| 196 | 3300005718 | Ga0068866_10379430 | Ga0068866_103794302 | 121 |
| 197 | 3300005719 | Ga0068861_100782930 | Ga0068861_1007829302 | 121 |
| 198 | 3300005719 | Ga0068861_100801166 | Ga0068861_1008011662 | 121 |
| 199 | 3300005840 | Ga0068870_10393123 | Ga0068870_103931232 | 121 |
| 200 | 3300005843 | Ga0068860_100553206 | Ga0068860_1005532062 | 121 |
| 201 | 3300005843 | Ga0068860_101159554 | Ga0068860_1011595542 | 121 |
| 202 | 3300006173 | Ga0070716_100004394 | Ga0070716_1000043949 | 121 |
| 203 | 3300006175 | Ga0070712_100257173 | Ga0070712_1002571732 | 121 |
| 204 | 3300006237 | Ga0097621_100083421 | Ga0097621_1000834213 | 121 |
| 205 | 3300006237 | Ga0097621_101715348 | Ga0097621_1017153481 | 121 |
| 206 | 3300006358 | Ga0068871_100056495 | Ga0068871_1000564953 | 121 |
| 207 | 3300006844 | Ga0075428_100692084 | Ga0075428_1006920842 | 121 |
| 208 | 3300006847 | Ga0075431_100019714 | Ga0075431_1000197144 | 121 |
| 209 | 3300006852 | Ga0075433_10021691 | Ga0075433_100216913 | 121 |
| 210 | 3300006852 | Ga0075433_10288202 | Ga0075433_102882022 | 121 |
| 211 | 3300006871 | Ga0075434_100002527 | Ga0075434_10000252714 | 121 |
| 212 | 3300006871 | Ga0075434_100003715 | Ga0075434_10000371510 | 121 |
| 213 | 3300006871 | Ga0075434_100018158 | Ga0075434_1000181585 | 121 |
| 214 | 3300006871 | Ga0075434_100055478 | Ga0075434_1000554785 | 121 |
| 215 | 3300006880 | Ga0075429_100041578 | Ga0075429_1000415782 | 121 |
| 216 | 3300006914 | Ga0075436_100005906 | Ga0075436_10000590612 | 121 |
| 217 | 3300006914 | Ga0075436_100111996 | Ga0075436_1001119962 | 121 |
| 218 | 3300006914 | Ga0075436_100246078 | Ga0075436_1002460782 | 121 |
| 219 | 3300007076 | Ga0075435_100032513 | Ga0075435_1000325132 | 121 |
| 220 | 3300007265 | Ga0099794_10211515 | Ga0099794_102115152 | 121 |
| 221 | 3300007265 | Ga0099794_10321373 | Ga0099794_103213732 | 121 |
| 222 | 3300007265 | Ga0099794_10356461 | Ga0099794_103564611 | 121 |
| 223 | 3300009098 | Ga0105245_12804450 | Ga0105245_128044502 | 121 |
| 224 | 3300009147 | Ga0114129_10335660 | Ga0114129_103356601 | 121 |
| 225 | 3300009147 | Ga0114129_10833866 | Ga0114129_108338662 | 121 |
| 226 | 3300009177 | Ga0105248_10045262 | Ga0105248_100452624 | 121 |
| 227 | 3300009177 | Ga0105248_10302518 | Ga0105248_103025182 | 121 |
| 228 | 3300009553 | Ga0105249_10363726 | Ga0105249_103637262 | 121 |
| 229 | 3300013308 | Ga0157375_10503538 | Ga0157375_105035382 | 121 |
| 230 | 3300013308 | Ga0157375_11800852 | Ga0157375_118008522 | 121 |
| 231 | 3300014325 | Ga0163163_10633560 | Ga0163163_106335602 | 121 |
| 232 | 3300014968 | Ga0157379_10994525 | Ga0157379_109945252 | 121 |
| 233 | 3300014969 | Ga0157376_10513831 | Ga0157376_105138311 | 121 |
| 234 | 3300017792 | Ga0163161_10278734 | Ga0163161_102787342 | 121 |
| 235 | 3300025885 | Ga0207653_10010980 | Ga0207653_100109803 | 121 |
| 236 | 3300025893 | Ga0207682_10133141 | Ga0207682_101331412 | 121 |
| 237 | 3300025899 | Ga0207642_11088962 | Ga0207642_110889622 | 121 |
| 238 | 3300025907 | Ga0207645_10000145 | Ga0207645_1000014538 | 121 |
| 239 | 3300025907 | Ga0207645_10312898 | Ga0207645_103128982 | 121 |
| 240 | 3300025910 | Ga0207684_10000781 | Ga0207684_1000078115 | 121 |
| 241 | 3300025910 | Ga0207684_10018361 | Ga0207684_100183618 | 121 |
| 242 | 3300025910 | Ga0207684_10128392 | Ga0207684_101283922 | 121 |
| 243 | 3300025910 | Ga0207684_10195617 | Ga0207684_101956173 | 121 |
| 244 | 3300025915 | Ga0207693_10360152 | Ga0207693_103601522 | 121 |
| 245 | 3300025922 | Ga0207646_10001100 | Ga0207646_1000110019 | 121 |
| 246 | 3300025922 | Ga0207646_10010434 | Ga0207646_100104347 | 121 |
| 247 | 3300025922 | Ga0207646_10060180 | Ga0207646_100601802 | 121 |
| 248 | 3300025922 | Ga0207646_10120623 | Ga0207646_101206233 | 121 |
| 249 | 3300025922 | Ga0207646_10182352 | Ga0207646_101823523 | 121 |
| 250 | 3300025922 | Ga0207646_11145723 | Ga0207646_111457232 | 121 |
| 251 | 3300025923 | Ga0207681_11421767 | Ga0207681_114217672 | 121 |
| 252 | 3300025933 | Ga0207706_10000146 | Ga0207706_1000014635 | 121 |
| 253 | 3300025934 | Ga0207686_10002394 | Ga0207686_100023943 | 121 |
| 254 | 3300025937 | Ga0207669_10001017 | Ga0207669_100010178 | 121 |
| 255 | 3300025937 | Ga0207669_10497991 | Ga0207669_104979912 | 121 |
| 256 | 3300025938 | Ga0207704_10009204 | Ga0207704_100092049 | 121 |
| 257 | 3300025939 | Ga0207665_10003606 | Ga0207665_1000360613 | 121 |
| 258 | 3300025939 | Ga0207665_10615494 | Ga0207665_106154942 | 121 |
| 259 | 3300025940 | Ga0207691_10098418 | Ga0207691_100984182 | 121 |
| 260 | 3300025941 | Ga0207711_10109668 | Ga0207711_101096683 | 121 |
| 261 | 3300025960 | Ga0207651_10046086 | Ga0207651_100460865 | 121 |
| 262 | 3300025961 | Ga0207712_10478335 | Ga0207712_104783352 | 121 |
| 263 | 3300025972 | Ga0207668_10140298 | Ga0207668_101402982 | 121 |
| 264 | 3300025986 | Ga0207658_10442960 | Ga0207658_104429602 | 121 |
| 265 | 3300026118 | Ga0207675_100407878 | Ga0207675_1004078782 | 121 |
| 266 | 3300026121 | Ga0207683_10005089 | Ga0207683_1000508912 | 121 |
| 267 | 3300027671 | Ga0209588_1082418 | Ga0209588_10824182 | 121 |
| 268 | 3300028380 | Ga0268265_11369295 | Ga0268265_113692951 | 121 |
| 269 | 3300028381 | Ga0268264_10657904 | Ga0268264_106579042 | 121 |
| 270 | 3300031548 | Ga0307408_100017983 | Ga0307408_1000179837 | 121 |
| 271 | 3300031548 | Ga0307408_100449435 | Ga0307408_1004494352 | 121 |
| 272 | 3300031731 | Ga0307405_10431693 | Ga0307405_104316932 | 121 |
| 273 | 3300031852 | Ga0307410_10018355 | Ga0307410_100183554 | 121 |
| 274 | 3300031852 | Ga0307410_10023153 | Ga0307410_100231532 | 121 |
| 275 | 3300031901 | Ga0307406_10167252 | Ga0307406_101672522 | 121 |
| 276 | 3300031903 | Ga0307407_11074951 | Ga0307407_110749512 | 121 |
| 277 | 3300031911 | Ga0307412_10114740 | Ga0307412_101147402 | 121 |
| 278 | 3300031995 | Ga0307409_101014129 | Ga0307409_1010141292 | 121 |
| 279 | 3300032002 | Ga0307416_100370800 | Ga0307416_1003708002 | 121 |
| 280 | 3300032004 | Ga0307414_10020050 | Ga0307414_100200503 | 121 |
| 281 | 3300032004 | Ga0307414_10029042 | Ga0307414_100290423 | 121 |
| 282 | 3300032005 | Ga0307411_10043332 | Ga0307411_100433323 | 121 |
| 283 | 3300032005 | Ga0307411_10221136 | Ga0307411_102211362 | 121 |
| 284 | 3300032126 | Ga0307415_100113984 | Ga0307415_1001139842 | 121 |
| 285 | 3300041407 | Ga0439447_117110 | Ga0439447_117110_74_466 | 121 |
| 286 | 3300042014 | Ga0439457_051423 | Ga0439457_051423_144_536 | 121 |
| 287 | 3300042118 | Ga0450914_040608 | Ga0450914_040608_40_435 | 121 |
| 288 | 3300042125 | Ga0450923_037850 | Ga0450923_037850_271_675 | 121 |
| 289 | 3300042131 | Ga0450894_023986 | Ga0450894_023986_269_673 | 121 |
| 290 | 3300042134 | Ga0450898_010361 | Ga0450898_010361_211_615 | 121 |
| 291 | 3300042435 | Ga0439434_0167615 | Ga0439434_0167615_89_484 | 121 |
| 292 | 3300042437 | Ga0439444_0010638 | Ga0439444_0010638_649_1044 | 121 |
| 293 | 3300042876 | Ga0451577_0733947 | Ga0451577_0733947_254_640 | 121 |
| 294 | 3300044673 | Ga0453683_0056185 | Ga0453683_0056185_875_1249 | 121 |
| 295 | 3300044673 | Ga0453683_0075053 | Ga0453683_0075053_1118_1498 | 121 |
| 296 | 3300045051 | Ga0451576_0025189 | Ga0451576_0025189_3410_3787 | 121 |
| 297 | 3300045051 | Ga0451576_1746582 | Ga0451576_1746582_144_521 | 121 |
| 298 | 3300046455 | Ga0495603_0074871 | Ga0495603_0074871_1075_1452 | 121 |
| 299 | 3300046473 | Ga0495582_0794280 | Ga0495582_0794280_128_508 | 121 |
| 300 | 3300049576 | Ga0501040_0210907 | Ga0501040_0210907_443_820 | 121 |
| 301 | 3300049576 | Ga0501040_1394112 | Ga0501040_1394112_13_390 | 121 |
| 302 | 3300049592 | Ga0501076_0100900 | Ga0501076_0100900_1401_1778 | 121 |
| 303 | 3300049741 | Ga0501079_0157933 | Ga0501079_0157933_956_1333 | 121 |
| 304 | 3300050507 | nmdc:mga05p37_257030_c1 | nmdc:mga05p37_257030_c1_980_1360 | 121 |
| 305 | 3300050507 | nmdc:mga05p37_287594_c1 | nmdc:mga05p37_287594_c1_191_568 | 121 |
| 306 | 3300050508 | nmdc:mga09592_28843_c1 | nmdc:mga09592_28843_c1_881_1261 | 121 |
| 307 | 3300050511 | nmdc:mga08y16_1888723_c1 | nmdc:mga08y16_1888723_c1_120_506 | 121 |
| 308 | 3300050511 | nmdc:mga08y16_1964688_c1 | nmdc:mga08y16_1964688_c1_68_511 | 121 |
| 309 | 3300050512 | nmdc:mga0n895_383_c1 | nmdc:mga0n895_383_c1_9277_9654 | 121 |
| 310 | 3300050512 | nmdc:mga0n895_43514_c1 | nmdc:mga0n895_43514_c1_1635_2012 | 121 |
| 311 | 3300050512 | nmdc:mga0n895_616_c1 | nmdc:mga0n895_616_c1_12440_12820 | 121 |
| 312 | 3300050512 | nmdc:mga0n895_9577_c1 | nmdc:mga0n895_9577_c1_5567_5944 | 121 |
| 313 | 3300050513 | nmdc:mga0rr50_492534_c1 | nmdc:mga0rr50_492534_c1_615_992 | 121 |
| 314 | 3300050514 | nmdc:mga08x19_1089800_c1 | nmdc:mga08x19_1089800_c1_49_426 | 121 |
| 315 | 3300050514 | nmdc:mga08x19_1141813_c1 | nmdc:mga08x19_1141813_c1_139_516 | 121 |
| 316 | 3300050514 | nmdc:mga08x19_22359_c1 | nmdc:mga08x19_22359_c1_2284_2661 | 121 |
| 317 | 3300050514 | nmdc:mga08x19_51459_c1 | nmdc:mga08x19_51459_c1_772_1149 | 121 |
| 318 | 3300050514 | nmdc:mga08x19_66088_c1 | nmdc:mga08x19_66088_c1_1007_1384 | 121 |
| 319 | 3300050515 | nmdc:mga0a205_400033_c1 | nmdc:mga0a205_400033_c1_103_480 | 121 |
| 320 | 3300050515 | nmdc:mga0a205_44464_c1 | nmdc:mga0a205_44464_c1_3655_4035 | 121 |
| 321 | 3300050515 | nmdc:mga0a205_659_c1 | nmdc:mga0a205_659_c1_6394_6771 | 121 |
| 322 | 3300060353 | Ga0501082_0042056 | Ga0501082_0042056_2574_2951 | 121 |
| 323 | 3300005295 | Ga0065707_10324499 | Ga0065707_103244991 | 122 |
| 324 | 3300005344 | Ga0070661_100453931 | Ga0070661_1004539312 | 122 |
| 325 | 3300005366 | Ga0070659_100486299 | Ga0070659_1004862992 | 122 |
| 326 | 3300005445 | Ga0070708_100171127 | Ga0070708_1001711272 | 122 |
| 327 | 3300005458 | Ga0070681_10104296 | Ga0070681_101042964 | 122 |
| 328 | 3300005546 | Ga0070696_101004742 | Ga0070696_1010047422 | 122 |
| 329 | 3300005549 | Ga0070704_100179537 | Ga0070704_1001795372 | 122 |
| 330 | 3300006846 | Ga0075430_100249135 | Ga0075430_1002491352 | 122 |
| 331 | 3300006847 | Ga0075431_100210089 | Ga0075431_1002100893 | 122 |
| 332 | 3300006847 | Ga0075431_100850544 | Ga0075431_1008505442 | 122 |
| 333 | 3300006852 | Ga0075433_10429476 | Ga0075433_104294762 | 122 |
| 334 | 3300009098 | Ga0105245_11943589 | Ga0105245_119435892 | 122 |
| 335 | 3300009147 | Ga0114129_10098954 | Ga0114129_100989543 | 122 |
| 336 | 3300009147 | Ga0114129_10109415 | Ga0114129_101094152 | 122 |
| 337 | 3300009147 | Ga0114129_11694071 | Ga0114129_116940711 | 122 |
| 338 | 3300013100 | Ga0157373_10011153 | Ga0157373_100111535 | 122 |
| 339 | 3300013102 | Ga0157371_10134444 | Ga0157371_101344442 | 122 |
| 340 | 3300013307 | Ga0157372_12982941 | Ga0157372_129829412 | 122 |
| 341 | 3300036401 | Ga0373937_0847827 | Ga0373937_0847827_422_817 | 122 |
| 342 | 3300038443 | Ga0395901_1882353 | Ga0395901_1882353_51_506 | 122 |
| 343 | 3300046535 | Ga0495586_0527257 | Ga0495586_0527257_133_528 | 122 |
| 344 | 3300046689 | Ga0495613_0605398 | Ga0495613_0605398_31_426 | 122 |
| 345 | 3300048912 | Ga0496109_0483733 | Ga0496109_0483733_667_1107 | 122 |
| 346 | 3300049575 | Ga0501039_0327426 | Ga0501039_0327426_409_834 | 122 |
| 347 | 3300049576 | Ga0501040_0202547 | Ga0501040_0202547_657_1082 | 122 |
| 348 | 3300049578 | Ga0501042_0039868 | Ga0501042_0039868_1395_1820 | 122 |
| 349 | 3300049590 | Ga0501074_0148874 | Ga0501074_0148874_855_1280 | 122 |
| 350 | 3300049591 | Ga0501075_0012654 | Ga0501075_0012654_246_638 | 122 |
| 351 | 3300049592 | Ga0501076_0054307 | Ga0501076_0054307_445_870 | 122 |
| 352 | 3300049593 | Ga0501077_0049965 | Ga0501077_0049965_1113_1538 | 122 |
| 353 | 3300049741 | Ga0501079_0066150 | Ga0501079_0066150_62_487 | 122 |
| 354 | 3300049743 | Ga0501081_0433970 | Ga0501081_0433970_442_828 | 122 |
| 355 | 3300049744 | Ga0501083_0070119 | Ga0501083_0070119_444_869 | 122 |
| 356 | 3300049824 | Ga0501045_0033094 | Ga0501045_0033094_2328_2753 | 122 |
| 357 | 3300050507 | nmdc:mga05p37_1090530_c1 | nmdc:mga05p37_1090530_c1_100_480 | 122 |
| 358 | 3300050507 | nmdc:mga05p37_141682_c1 | nmdc:mga05p37_141682_c1_2128_2508 | 122 |
| 359 | 3300050507 | nmdc:mga05p37_14934_c1 | nmdc:mga05p37_14934_c1_6757_7152 | 122 |
| 360 | 3300050509 | nmdc:mga0qj67_351855_c1 | nmdc:mga0qj67_351855_c1_16_411 | 122 |
| 361 | 3300050509 | nmdc:mga0qj67_724602_c1 | nmdc:mga0qj67_724602_c1_189_575 | 122 |
| 362 | 3300050510 | nmdc:mga06r32_720935_c1 | nmdc:mga06r32_720935_c1_549_944 | 122 |
| 363 | 3300050515 | nmdc:mga0a205_227538_c1 | nmdc:mga0a205_227538_c1_820_1200 | 122 |
| 364 | 3300054114 | Ga0501084_0032489 | Ga0501084_0032489_1619_2044 | 122 |
| 365 | 3300060353 | Ga0501082_0021339 | Ga0501082_0021339_3637_4062 | 122 |
| 366 | 3300061734 | Ga0530510_0482500 | Ga0530510_0482500_453_878 | 122 |
| 367 | 3300003203 | JGI25406J46586_10145756 | JGI25406J46586_101457562 | 123 |
| 368 | 3300003322 | rootL2_10163687 | rootL2_101636872 | 123 |
| 369 | 3300005327 | Ga0070658_10200521 | Ga0070658_102005211 | 123 |
| 370 | 3300005337 | Ga0070682_100362971 | Ga0070682_1003629712 | 123 |
| 371 | 3300005339 | Ga0070660_100288934 | Ga0070660_1002889342 | 123 |
| 372 | 3300005343 | Ga0070687_100265328 | Ga0070687_1002653282 | 123 |
| 373 | 3300005438 | Ga0070701_10979715 | Ga0070701_109797152 | 123 |
| 374 | 3300005439 | Ga0070711_100007712 | Ga0070711_1000077125 | 123 |
| 375 | 3300005440 | Ga0070705_100028862 | Ga0070705_1000288623 | 123 |
| 376 | 3300005441 | Ga0070700_100279504 | Ga0070700_1002795041 | 123 |
| 377 | 3300005457 | Ga0070662_100332962 | Ga0070662_1003329622 | 123 |
| 378 | 3300005458 | Ga0070681_11900379 | Ga0070681_119003791 | 123 |
| 379 | 3300005459 | Ga0068867_100319521 | Ga0068867_1003195212 | 123 |
| 380 | 3300005467 | Ga0070706_100971083 | Ga0070706_1009710831 | 123 |
| 381 | 3300005518 | Ga0070699_100175890 | Ga0070699_1001758901 | 123 |
| 382 | 3300005535 | Ga0070684_100859682 | Ga0070684_1008596821 | 123 |
| 383 | 3300005546 | Ga0070696_100012183 | Ga0070696_1000121835 | 123 |
| 384 | 3300005546 | Ga0070696_100114902 | Ga0070696_1001149022 | 123 |
| 385 | 3300005549 | Ga0070704_100049304 | Ga0070704_1000493043 | 123 |
| 386 | 3300005549 | Ga0070704_100160502 | Ga0070704_1001605023 | 123 |
| 387 | 3300005563 | Ga0068855_100688458 | Ga0068855_1006884582 | 123 |
| 388 | 3300005564 | Ga0070664_100893872 | Ga0070664_1008938722 | 123 |
| 389 | 3300005577 | Ga0068857_100009128 | Ga0068857_10000912811 | 123 |
| 390 | 3300005578 | Ga0068854_100008522 | Ga0068854_1000085224 | 123 |
| 391 | 3300005578 | Ga0068854_101931471 | Ga0068854_1019314712 | 123 |
| 392 | 3300005615 | Ga0070702_100751413 | Ga0070702_1007514131 | 123 |
| 393 | 3300005616 | Ga0068852_100763766 | Ga0068852_1007637662 | 123 |
| 394 | 3300005618 | Ga0068864_100000396 | Ga0068864_1000003964 | 123 |
| 395 | 3300005718 | Ga0068866_10000401 | Ga0068866_1000040121 | 123 |
| 396 | 3300005718 | Ga0068866_10206322 | Ga0068866_102063222 | 123 |
| 397 | 3300005719 | Ga0068861_100035865 | Ga0068861_1000358653 | 123 |
| 398 | 3300005842 | Ga0068858_100014878 | Ga0068858_10001487810 | 123 |
| 399 | 3300005937 | Ga0081455_10940938 | Ga0081455_109409381 | 123 |
| 400 | 3300005985 | Ga0081539_10072556 | Ga0081539_100725562 | 123 |
| 401 | 3300006028 | Ga0070717_10444356 | Ga0070717_104443562 | 123 |
| 402 | 3300006028 | Ga0070717_10445187 | Ga0070717_104451872 | 123 |
| 403 | 3300006844 | Ga0075428_100297114 | Ga0075428_1002971143 | 123 |
| 404 | 3300006847 | Ga0075431_100242215 | Ga0075431_1002422152 | 123 |
| 405 | 3300006881 | Ga0068865_100011523 | Ga0068865_1000115232 | 123 |
| 406 | 3300006914 | Ga0075436_100076036 | Ga0075436_1000760363 | 123 |
| 407 | 3300006914 | Ga0075436_100110759 | Ga0075436_1001107593 | 123 |
| 408 | 3300007076 | Ga0075435_100550731 | Ga0075435_1005507312 | 123 |
| 409 | 3300009093 | Ga0105240_10134820 | Ga0105240_101348205 | 123 |
| 410 | 3300009094 | Ga0111539_10243912 | Ga0111539_102439124 | 123 |
| 411 | 3300009098 | Ga0105245_10045195 | Ga0105245_100451954 | 123 |
| 412 | 3300009098 | Ga0105245_10844759 | Ga0105245_108447592 | 123 |
| 413 | 3300009147 | Ga0114129_10722906 | Ga0114129_107229062 | 123 |
| 414 | 3300009148 | Ga0105243_10002610 | Ga0105243_100026105 | 123 |
| 415 | 3300009176 | Ga0105242_10001397 | Ga0105242_1000139714 | 123 |
| 416 | 3300009177 | Ga0105248_10000658 | Ga0105248_1000065831 | 123 |
| 417 | 3300009551 | Ga0105238_11970412 | Ga0105238_119704122 | 123 |
| 418 | 3300009553 | Ga0105249_10018112 | Ga0105249_100181125 | 123 |
| 419 | 3300009553 | Ga0105249_10045179 | Ga0105249_100451794 | 123 |
| 420 | 3300010375 | Ga0105239_10004859 | Ga0105239_1000485910 | 123 |
| 421 | 3300010375 | Ga0105239_11409516 | Ga0105239_114095161 | 123 |
| 422 | 3300011119 | Ga0105246_10044479 | Ga0105246_100444794 | 123 |
| 423 | 3300013100 | Ga0157373_10439135 | Ga0157373_104391352 | 123 |
| 424 | 3300013297 | Ga0157378_10002774 | Ga0157378_1000277411 | 123 |
| 425 | 3300013306 | Ga0163162_10010076 | Ga0163162_100100763 | 123 |
| 426 | 3300013306 | Ga0163162_12168377 | Ga0163162_121683772 | 123 |
| 427 | 3300013307 | Ga0157372_10313932 | Ga0157372_103139322 | 123 |
| 428 | 3300013307 | Ga0157372_13260754 | Ga0157372_132607541 | 123 |
| 429 | 3300013307 | Ga0157372_13372266 | Ga0157372_133722662 | 123 |
| 430 | 3300013308 | Ga0157375_10141916 | Ga0157375_101419164 | 123 |
| 431 | 3300013308 | Ga0157375_10395543 | Ga0157375_103955431 | 123 |
| 432 | 3300014326 | Ga0157380_10017279 | Ga0157380_100172792 | 123 |
| 433 | 3300014968 | Ga0157379_10008817 | Ga0157379_1000881710 | 123 |
| 434 | 3300014969 | Ga0157376_10154753 | Ga0157376_101547533 | 123 |
| 435 | 3300025893 | Ga0207682_10260162 | Ga0207682_102601622 | 123 |
| 436 | 3300025899 | Ga0207642_10000600 | Ga0207642_100006003 | 123 |
| 437 | 3300025899 | Ga0207642_10084299 | Ga0207642_100842993 | 123 |
| 438 | 3300025908 | Ga0207643_10007892 | Ga0207643_100078923 | 123 |
| 439 | 3300025909 | Ga0207705_10880011 | Ga0207705_108800112 | 123 |
| 440 | 3300025910 | Ga0207684_10813433 | Ga0207684_108134332 | 123 |
| 441 | 3300025912 | Ga0207707_10236112 | Ga0207707_102361123 | 123 |
| 442 | 3300025913 | Ga0207695_10246308 | Ga0207695_102463083 | 123 |
| 443 | 3300025915 | Ga0207693_10237158 | Ga0207693_102371582 | 123 |
| 444 | 3300025917 | Ga0207660_10164184 | Ga0207660_101641842 | 123 |
| 445 | 3300025919 | Ga0207657_10482811 | Ga0207657_104828112 | 123 |
| 446 | 3300025919 | Ga0207657_11419341 | Ga0207657_114193411 | 123 |
| 447 | 3300025921 | Ga0207652_10530348 | Ga0207652_105303482 | 123 |
| 448 | 3300025923 | Ga0207681_10013785 | Ga0207681_100137855 | 123 |
| 449 | 3300025926 | Ga0207659_10121710 | Ga0207659_101217102 | 123 |
| 450 | 3300025927 | Ga0207687_10045351 | Ga0207687_100453514 | 123 |
| 451 | 3300025928 | Ga0207700_10112692 | Ga0207700_101126922 | 123 |
| 452 | 3300025931 | Ga0207644_10536877 | Ga0207644_105368772 | 123 |
| 453 | 3300025932 | Ga0207690_10166335 | Ga0207690_101663352 | 123 |
| 454 | 3300025932 | Ga0207690_11410945 | Ga0207690_114109452 | 123 |
| 455 | 3300025933 | Ga0207706_10049239 | Ga0207706_100492392 | 123 |
| 456 | 3300025935 | Ga0207709_10001445 | Ga0207709_100014452 | 123 |
| 457 | 3300025938 | Ga0207704_10740032 | Ga0207704_107400322 | 123 |
| 458 | 3300025941 | Ga0207711_10015225 | Ga0207711_100152258 | 123 |
| 459 | 3300025942 | Ga0207689_10091551 | Ga0207689_100915513 | 123 |
| 460 | 3300025944 | Ga0207661_10323620 | Ga0207661_103236202 | 123 |
| 461 | 3300025949 | Ga0207667_10866794 | Ga0207667_108667942 | 123 |
| 462 | 3300025961 | Ga0207712_10002961 | Ga0207712_1000296110 | 123 |
| 463 | 3300025961 | Ga0207712_10018227 | Ga0207712_100182277 | 123 |
| 464 | 3300025961 | Ga0207712_10881959 | Ga0207712_108819592 | 123 |
| 465 | 3300025972 | Ga0207668_10018117 | Ga0207668_100181172 | 123 |
| 466 | 3300025981 | Ga0207640_10016781 | Ga0207640_100167814 | 123 |
| 467 | 3300025981 | Ga0207640_11277918 | Ga0207640_112779182 | 123 |
| 468 | 3300026067 | Ga0207678_10140084 | Ga0207678_101400843 | 123 |
| 469 | 3300026075 | Ga0207708_10021560 | Ga0207708_100215603 | 123 |
| 470 | 3300026089 | Ga0207648_10001390 | Ga0207648_1000139010 | 123 |
| 471 | 3300026089 | Ga0207648_10195238 | Ga0207648_101952382 | 123 |
| 472 | 3300026095 | Ga0207676_10002613 | Ga0207676_100026134 | 123 |
| 473 | 3300026116 | Ga0207674_10024439 | Ga0207674_100244399 | 123 |
| 474 | 3300026118 | Ga0207675_100048912 | Ga0207675_1000489123 | 123 |
| 475 | 3300026118 | Ga0207675_100342145 | Ga0207675_1003421452 | 123 |
| 476 | 3300027671 | Ga0209588_1000481 | Ga0209588_10004812 | 123 |
| 477 | 3300027876 | Ga0209974_10290135 | Ga0209974_102901352 | 123 |
| 478 | 3300028380 | Ga0268265_10086766 | Ga0268265_100867664 | 123 |
| 479 | 3300031548 | Ga0307408_100004762 | Ga0307408_10000476211 | 123 |
| 480 | 3300031548 | Ga0307408_100011114 | Ga0307408_1000111142 | 123 |
| 481 | 3300031548 | Ga0307408_100029054 | Ga0307408_1000290542 | 123 |
| 482 | 3300031548 | Ga0307408_100150000 | Ga0307408_1001500002 | 123 |
| 483 | 3300031731 | Ga0307405_10039351 | Ga0307405_100393512 | 123 |
| 484 | 3300031731 | Ga0307405_10054341 | Ga0307405_100543412 | 123 |
| 485 | 3300031731 | Ga0307405_10074660 | Ga0307405_100746603 | 123 |
| 486 | 3300031731 | Ga0307405_10122430 | Ga0307405_101224303 | 123 |
| 487 | 3300031824 | Ga0307413_10002235 | Ga0307413_100022356 | 123 |
| 488 | 3300031824 | Ga0307413_10058357 | Ga0307413_100583573 | 123 |
| 489 | 3300031824 | Ga0307413_10066721 | Ga0307413_100667213 | 123 |
| 490 | 3300031824 | Ga0307413_10122940 | Ga0307413_101229403 | 123 |
| 491 | 3300031852 | Ga0307410_10002605 | Ga0307410_100026058 | 123 |
| 492 | 3300031852 | Ga0307410_10008516 | Ga0307410_100085162 | 123 |
| 493 | 3300031852 | Ga0307410_10010055 | Ga0307410_100100556 | 123 |
| 494 | 3300031852 | Ga0307410_10024422 | Ga0307410_100244224 | 123 |
| 495 | 3300031901 | Ga0307406_10015327 | Ga0307406_100153272 | 123 |
| 496 | 3300031901 | Ga0307406_10021817 | Ga0307406_100218176 | 123 |
| 497 | 3300031901 | Ga0307406_10025363 | Ga0307406_100253632 | 123 |
| 498 | 3300031901 | Ga0307406_10039984 | Ga0307406_100399844 | 123 |
| 499 | 3300031903 | Ga0307407_10006601 | Ga0307407_100066015 | 123 |
| 500 | 3300031903 | Ga0307407_10016027 | Ga0307407_100160271 | 123 |
| 501 | 3300031903 | Ga0307407_10068379 | Ga0307407_100683792 | 123 |
| 502 | 3300031903 | Ga0307407_10462230 | Ga0307407_104622302 | 123 |
| 503 | 3300031911 | Ga0307412_10038147 | Ga0307412_100381472 | 123 |
| 504 | 3300031911 | Ga0307412_10221564 | Ga0307412_102215642 | 123 |
| 505 | 3300031995 | Ga0307409_100000308 | Ga0307409_1000003089 | 123 |
| 506 | 3300031995 | Ga0307409_100002174 | Ga0307409_1000021746 | 123 |
| 507 | 3300031995 | Ga0307409_100010633 | Ga0307409_1000106332 | 123 |
| 508 | 3300031995 | Ga0307409_100039948 | Ga0307409_1000399483 | 123 |
| 509 | 3300031995 | Ga0307409_100041252 | Ga0307409_1000412525 | 123 |
| 510 | 3300031995 | Ga0307409_100271574 | Ga0307409_1002715742 | 123 |
| 511 | 3300031995 | Ga0307409_100437432 | Ga0307409_1004374322 | 123 |
| 512 | 3300032002 | Ga0307416_100001186 | Ga0307416_1000011869 | 123 |
| 513 | 3300032002 | Ga0307416_100002892 | Ga0307416_1000028926 | 123 |
| 514 | 3300032002 | Ga0307416_100005003 | Ga0307416_1000050032 | 123 |
| 515 | 3300032002 | Ga0307416_100012945 | Ga0307416_1000129456 | 123 |
| 516 | 3300032002 | Ga0307416_100128498 | Ga0307416_1001284982 | 123 |
| 517 | 3300032002 | Ga0307416_100218658 | Ga0307416_1002186582 | 123 |
| 518 | 3300032002 | Ga0307416_100335110 | Ga0307416_1003351102 | 123 |
| 519 | 3300032002 | Ga0307416_101664233 | Ga0307416_1016642332 | 123 |
| 520 | 3300032004 | Ga0307414_10007376 | Ga0307414_100073766 | 123 |
| 521 | 3300032004 | Ga0307414_10038035 | Ga0307414_100380352 | 123 |
| 522 | 3300032004 | Ga0307414_10262942 | Ga0307414_102629422 | 123 |
| 523 | 3300032005 | Ga0307411_10007316 | Ga0307411_100073165 | 123 |
| 524 | 3300032005 | Ga0307411_10021429 | Ga0307411_100214297 | 123 |
| 525 | 3300032005 | Ga0307411_10037531 | Ga0307411_100375314 | 123 |
| 526 | 3300032005 | Ga0307411_10060118 | Ga0307411_100601183 | 123 |
| 527 | 3300032126 | Ga0307415_100000203 | Ga0307415_10000020314 | 123 |
| 528 | 3300032126 | Ga0307415_100001513 | Ga0307415_1000015133 | 123 |
| 529 | 3300032126 | Ga0307415_100002691 | Ga0307415_10000269112 | 123 |
| 530 | 3300032126 | Ga0307415_100024157 | Ga0307415_1000241572 | 123 |
| 531 | 3300032126 | Ga0307415_100343075 | Ga0307415_1003430752 | 123 |
| 532 | 3300034820 | Ga0373959_0194587 | Ga0373959_0194587_87_521 | 123 |
| 533 | 3300035086 | Ga0373934_0000216 | Ga0373934_0000216_5505_5885 | 123 |
| 534 | 3300035111 | Ga0373923_0002487 | Ga0373923_0002487_3733_4113 | 123 |
| 535 | 3300035113 | Ga0373936_0038548 | Ga0373936_0038548_46_426 | 123 |
| 536 | 3300035118 | Ga0373954_0155934 | Ga0373954_0155934_378_758 | 123 |
| 537 | 3300035119 | Ga0373956_0000127 | Ga0373956_0000127_14713_15093 | 123 |
| 538 | 3300035120 | Ga0373957_0057748 | Ga0373957_0057748_383_763 | 123 |
| 539 | 3300035121 | Ga0373960_0133512 | Ga0373960_0133512_63_467 | 123 |
| 540 | 3300035172 | Ga0373955_0000777 | Ga0373955_0000777_2081_2461 | 123 |
| 541 | 3300035398 | Ga0316574_0149959 | Ga0316574_0149959_490_879 | 123 |
| 542 | 3300035410 | Ga0373924_0017754 | Ga0373924_0017754_2319_2699 | 123 |
| 543 | 3300035691 | Ga0373931_0119880 | Ga0373931_0119880_570_974 | 123 |
| 544 | 3300035692 | Ga0373935_0734418 | Ga0373935_0734418_154_534 | 123 |
| 545 | 3300035724 | Ga0373933_0005312 | Ga0373933_0005312_323_703 | 123 |
| 546 | 3300036401 | Ga0373937_0000195 | Ga0373937_0000195_20367_20747 | 123 |
| 547 | 3300038443 | Ga0395901_1198567 | Ga0395901_1198567_184_582 | 123 |
| 548 | 3300042876 | Ga0451577_0031234 | Ga0451577_0031234_1966_2364 | 123 |
| 549 | 3300044673 | Ga0453683_0040950 | Ga0453683_0040950_1399_1797 | 123 |
| 550 | 3300044842 | Ga0466957_0663714 | Ga0466957_0663714_83_580 | 123 |
| 551 | 3300045051 | Ga0451576_0135615 | Ga0451576_0135615_2086_2484 | 123 |
| 552 | 3300046454 | Ga0495592_0001514 | Ga0495592_0001514_15582_15962 | 123 |
| 553 | 3300046459 | Ga0495629_0016005 | Ga0495629_0016005_3962_4342 | 123 |
| 554 | 3300046462 | Ga0495651_0000050 | Ga0495651_0000050_45777_46157 | 123 |
| 555 | 3300046463 | Ga0495653_0000134 | Ga0495653_0000134_38850_39230 | 123 |
| 556 | 3300046475 | Ga0495639_0111938 | Ga0495639_0111938_376_756 | 123 |
| 557 | 3300046499 | Ga0495594_0020281 | Ga0495594_0020281_2487_2885 | 123 |
| 558 | 3300046511 | Ga0495608_0000381 | Ga0495608_0000381_21534_21914 | 123 |
| 559 | 3300046514 | Ga0495618_0103033 | Ga0495618_0103033_980_1360 | 123 |
| 560 | 3300046516 | Ga0495628_0001309 | Ga0495628_0001309_10231_10611 | 123 |
| 561 | 3300046517 | Ga0495630_0005719 | Ga0495630_0005719_5214_5594 | 123 |
| 562 | 3300046529 | Ga0495652_0000931 | Ga0495652_0000931_480_860 | 123 |
| 563 | 3300046531 | Ga0495665_0246976 | Ga0495665_0246976_385_765 | 123 |
| 564 | 3300046535 | Ga0495586_0533446 | Ga0495586_0533446_168_548 | 123 |
| 565 | 3300046536 | Ga0495587_0000114 | Ga0495587_0000114_60040_60420 | 123 |
| 566 | 3300046537 | Ga0495598_0331430 | Ga0495598_0331430_145_543 | 123 |
| 567 | 3300046543 | Ga0495645_0000065 | Ga0495645_0000065_50405_50785 | 123 |
| 568 | 3300046543 | Ga0495645_0309920 | Ga0495645_0309920_196_579 | 123 |
| 569 | 3300046557 | Ga0495622_0188763 | Ga0495622_0188763_75_473 | 123 |
| 570 | 3300046559 | Ga0495667_0000316 | Ga0495667_0000316_16632_17012 | 123 |
| 571 | 3300046642 | Ga0495634_0184587 | Ga0495634_0184587_828_1208 | 123 |
| 572 | 3300046648 | Ga0495611_0251082 | Ga0495611_0251082_113_511 | 123 |
| 573 | 3300046663 | Ga0495635_0000103 | Ga0495635_0000103_11591_11971 | 123 |
| 574 | 3300046675 | Ga0495657_0000606 | Ga0495657_0000606_29680_30060 | 123 |
| 575 | 3300046678 | Ga0495599_0000189 | Ga0495599_0000189_38873_39253 | 123 |
| 576 | 3300046679 | Ga0495623_0000086 | Ga0495623_0000086_40667_41047 | 123 |
| 577 | 3300046680 | Ga0495646_0000522 | Ga0495646_0000522_15459_15839 | 123 |
| 578 | 3300046689 | Ga0495613_0045542 | Ga0495613_0045542_1387_1767 | 123 |
| 579 | 3300046809 | Ga0495600_0000145 | Ga0495600_0000145_35475_35855 | 123 |
| 580 | 3300047317 | Ga0495604_0001195 | Ga0495604_0001195_6542_6922 | 123 |
| 581 | 3300047318 | Ga0495636_0016755 | Ga0495636_0016755_2242_2640 | 123 |
| 582 | 3300047319 | Ga0495674_0000339 | Ga0495674_0000339_32261_32641 | 123 |
| 583 | 3300047319 | Ga0495674_0434626 | Ga0495674_0434626_578_961 | 123 |
| 584 | 3300047444 | Ga0495675_0003609 | Ga0495675_0003609_305_685 | 123 |
| 585 | 3300047471 | Ga0495684_0000141 | Ga0495684_0000141_38521_38901 | 123 |
| 586 | 3300047673 | Ga0495593_0208553 | Ga0495593_0208553_399_779 | 123 |
| 587 | 3300048088 | Ga0495602_0003470 | Ga0495602_0003470_13908_14288 | 123 |
| 588 | 3300048903 | Ga0496100_0461076 | Ga0496100_0461076_343_741 | 123 |
| 589 | 3300048904 | Ga0496101_0679261 | Ga0496101_0679261_287_703 | 123 |
| 590 | 3300048905 | Ga0496102_0139858 | Ga0496102_0139858_1066_1470 | 123 |
| 591 | 3300048909 | Ga0496106_0094860 | Ga0496106_0094860_20_418 | 123 |
| 592 | 3300048909 | Ga0496106_0892106 | Ga0496106_0892106_43_447 | 123 |
| 593 | 3300048909 | Ga0496106_1230861 | Ga0496106_1230861_83_499 | 123 |
| 594 | 3300048910 | Ga0496107_0806595 | Ga0496107_0806595_197_595 | 123 |
| 595 | 3300048911 | Ga0496108_0014418 | Ga0496108_0014418_2333_2749 | 123 |
| 596 | 3300048911 | Ga0496108_0191676 | Ga0496108_0191676_1275_1718 | 123 |
| 597 | 3300048912 | Ga0496109_0043387 | Ga0496109_0043387_2000_2416 | 123 |
| 598 | 3300048912 | Ga0496109_0253010 | Ga0496109_0253010_730_1173 | 123 |
| 599 | 3300048913 | Ga0496110_1136465 | Ga0496110_1136465_79_495 | 123 |
| 600 | 3300048914 | Ga0496111_0005733 | Ga0496111_0005733_6812_7228 | 123 |
| 601 | 3300048915 | Ga0496112_0024531 | Ga0496112_0024531_1066_1482 | 123 |
| 602 | 3300048916 | Ga0496113_0114414 | Ga0496113_0114414_687_1103 | 123 |
| 603 | 3300048917 | Ga0496114_0100688 | Ga0496114_0100688_142_540 | 123 |
| 604 | 3300049515 | Ga0501292_017167 | Ga0501292_017167_607_1005 | 123 |
| 605 | 3300049521 | Ga0501298_001135 | Ga0501298_001135_2355_2753 | 123 |
| 606 | 3300049572 | Ga0501036_0306114 | Ga0501036_0306114_785_1177 | 123 |
| 607 | 3300049583 | Ga0501067_0142408 | Ga0501067_0142408_419_814 | 123 |
| 608 | 3300049583 | Ga0501067_0432539 | Ga0501067_0432539_56_463 | 123 |
| 609 | 3300049584 | Ga0501068_0483215 | Ga0501068_0483215_199_603 | 123 |
| 610 | 3300049585 | Ga0501069_0328912 | Ga0501069_0328912_300_695 | 123 |
| 611 | 3300049591 | Ga0501075_0423500 | Ga0501075_0423500_172_588 | 123 |
| 612 | 3300049592 | Ga0501076_0006362 | Ga0501076_0006362_4866_5291 | 123 |
| 613 | 3300049592 | Ga0501076_0542646 | Ga0501076_0542646_191_583 | 123 |
| 614 | 3300049656 | Ga0501209_104200 | Ga0501209_104200_72_470 | 123 |
| 615 | 3300049658 | Ga0501211_012261 | Ga0501211_012261_102_500 | 123 |
| 616 | 3300049661 | Ga0501217_016584 | Ga0501217_016584_934_1332 | 123 |
| 617 | 3300049672 | Ga0501239_001326 | Ga0501239_001326_1230_1628 | 123 |
| 618 | 3300049677 | Ga0501247_002620 | Ga0501247_002620_903_1301 | 123 |
| 619 | 3300049679 | Ga0501249_004401 | Ga0501249_004401_1592_1990 | 123 |
| 620 | 3300049681 | Ga0501251_003724 | Ga0501251_003724_441_839 | 123 |
| 621 | 3300049682 | Ga0501252_015053 | Ga0501252_015053_461_859 | 123 |
| 622 | 3300049683 | Ga0501253_002688 | Ga0501253_002688_1164_1562 | 123 |
| 623 | 3300049686 | Ga0501257_029004 | Ga0501257_029004_840_1238 | 123 |
| 624 | 3300049688 | Ga0501259_028777 | Ga0501259_028777_109_507 | 123 |
| 625 | 3300049704 | Ga0501221_109014 | Ga0501221_109014_177_581 | 123 |
| 626 | 3300049705 | Ga0501225_0038105 | Ga0501225_0038105_92_490 | 123 |
| 627 | 3300049706 | Ga0501229_018661 | Ga0501229_018661_247_645 | 123 |
| 628 | 3300049741 | Ga0501079_0115497 | Ga0501079_0115497_584_1009 | 123 |
| 629 | 3300049759 | Ga0501262_013832 | Ga0501262_013832_214_612 | 123 |
| 630 | 3300049764 | Ga0501267_014316 | Ga0501267_014316_272_670 | 123 |
| 631 | 3300049765 | Ga0501268_004221 | Ga0501268_004221_847_1245 | 123 |
| 632 | 3300049767 | Ga0501270_004607 | Ga0501270_004607_536_934 | 123 |
| 633 | 3300049767 | Ga0501270_009331 | Ga0501270_009331_522_926 | 123 |
| 634 | 3300049768 | Ga0501271_013510 | Ga0501271_013510_196_591 | 123 |
| 635 | 3300049769 | Ga0501272_000650 | Ga0501272_000650_1760_2158 | 123 |
| 636 | 3300049769 | Ga0501272_060896 | Ga0501272_060896_115_510 | 123 |
| 637 | 3300049770 | Ga0501273_000667 | Ga0501273_000667_1339_1737 | 123 |
| 638 | 3300049772 | Ga0501275_007220 | Ga0501275_007220_278_658 | 123 |
| 639 | 3300049773 | Ga0501276_005632 | Ga0501276_005632_304_702 | 123 |
| 640 | 3300049779 | Ga0501283_032985 | Ga0501283_032985_404_799 | 123 |
| 641 | 3300049824 | Ga0501045_0164304 | Ga0501045_0164304_489_914 | 123 |
| 642 | 3300049850 | Ga0501204_013191 | Ga0501204_013191_579_977 | 123 |
| 643 | 3300049851 | Ga0501212_012418 | Ga0501212_012418_729_1127 | 123 |
| 644 | 3300050510 | nmdc:mga06r32_69410_c1 | nmdc:mga06r32_69410_c1_2221_2607 | 123 |
| 645 | 3300050512 | nmdc:mga0n895_1038875_c1 | nmdc:mga0n895_1038875_c1_12_416 | 123 |
| 646 | 3300050514 | nmdc:mga08x19_59612_c1 | nmdc:mga08x19_59612_c1_695_1081 | 123 |
| 647 | 3300053077 | Ga0495601_0001299 | Ga0495601_0001299_3797_4177 | 123 |
| 648 | 3300053078 | Ga0495612_0004440 | Ga0495612_0004440_549_929 | 123 |
| 649 | 3300053084 | Ga0495595_0004129 | Ga0495595_0004129_198_578 | 123 |
| 650 | 3300053085 | Ga0495619_0001149 | Ga0495619_0001149_9694_10074 | 123 |
| 651 | 3300060353 | Ga0501082_0089354 | Ga0501082_0089354_2208_2633 | 123 |
| 652 | 3300061734 | Ga0530510_0373583 | Ga0530510_0373583_170_562 | 123 |
| 653 | 3300061734 | Ga0530510_1032550 | Ga0530510_1032550_129_545 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r4e-assembly1.cif.gz_B | structure of glnr-dna complex | 0.901 | 8 | 82 |
| 5i44-assembly4.cif.gz_E | structure of raca-dna complex; p21 form | 0.8988 | 8 | 74 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.8959 | 8 | 78 |
| 5i44-assembly4.cif.gz_F-2 | structure of raca-dna complex; p21 form | 0.887 | 8 | 73 |
| 4r4e-assembly1.cif.gz_A | structure of glnr-dna complex | 0.8815 | 8 | 83 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i44J00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9151 | 8 | 72 | 1.10.1660.10 |
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8982 | 8 | 78 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8898 | 8 | 80 | 1.10.1660.10 |
| af_P9WME7_10_96_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8822 | 11 | 79 | 1.10.1660.10 |
| 4r4eA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8815 | 8 | 83 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N0ZHV7-F1-model_v4 | MerR family transcriptional regulator | 0.9859 | 6 | 80 |
GO:0003677
GO:0003700 |
| AF-A0A1M7SBL4-F1-model_v4 | MerR HTH family regulatory protein | 0.9831 | 9 | 85 |
GO:0003677
GO:0003700 |
| AF-A0A7X7DLD9-F1-model_v4 | MerR family transcriptional regulator | 0.9692 | 6 | 83 |
GO:0003677
GO:0003700 |
| AF-A0A2H0PEP8-F1-model_v4 | MerR family transcriptional regulator | 0.9692 | 6 | 80 |
GO:0003677
GO:0003700 |
| AF-A0A2M8FZ47-F1-model_v4 | HTH merR-type domain-containing protein | 0.9687 | 6 | 84 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar