F472776

General Info

Members Datasets Scaffolds Average Seq Length
653 310 650 165

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101239182|Ga0307416_1012391821
Length 190
Sequence MPSSQPPHVAVFPGSFDPLTSGHVDIIERGRYIFDKVIVAVLINRTKVPLFTTDERVAMIREVFRDQADVEVDTFDGLLVEYAAHKGAHALIRGLRAVSDFEYEFQMAAMNRRLDASVDTVFLMASESQQFISSRFVKEIARLGGDISPFVSPRVAQHVRQAIARGGEAAKPDDDGVGTTMPAPAGRKPI

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
3 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
4 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
164 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
165 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
187 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
188 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
189 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
192 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
195 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
199 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
202 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
203 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
204 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
205 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
206 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
207 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
213 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
302 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
303 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.77
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 4.59
Rhizosphere 89.59
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5547123 2162886011 Bacteria 913
2 Ga0065712_10022087 3300005290 Unclassified 1547
3 Ga0065712_10126316 3300005290 Bacteria 1603
4 Ga0065712_10188467 3300005290 Bacteria 1159
5 Ga0065715_10005160 3300005293 Bacteria 3544
6 Ga0065715_10144946 3300005293 Bacteria 1801
7 Ga0065715_10227519 3300005293 Bacteria 1238
8 Ga0065715_10235947 3300005293 Bacteria 1217
9 Ga0065715_10346250 3300005293 Bacteria 958
10 Ga0065715_10502506 3300005293 Bacteria 778
11 Ga0065715_10508785 3300005293 Unclassified 762
12 Ga0065715_10949294 3300005293 Bacteria 560
13 Ga0065707_10000711 3300005295 Bacteria 16357
14 Ga0065707_10106345 3300005295 Bacteria 2600
15 Ga0065707_10113287 3300005295 Bacteria 2333
16 Ga0070670_100003718 3300005331 Bacteria 12699
17 Ga0070670_100008752 3300005331 Bacteria 8644
18 Ga0070677_10110750 3300005333 Bacteria 1225
19 Ga0070660_100007604 3300005339 Bacteria 7552
20 Ga0070669_100007815 3300005353 Bacteria 7642
21 Ga0070669_100076401 3300005353 Bacteria 2486
22 Ga0070669_100081037 3300005353 Bacteria 2417
23 Ga0070669_100295257 3300005353 Bacteria 1302
24 Ga0070675_100024928 3300005354 Bacteria 4794
25 Ga0070675_100033155 3300005354 Bacteria 4185
26 Ga0070675_100207374 3300005354 Bacteria 1703
27 Ga0070675_100243452 3300005354 Bacteria 1572
28 Ga0070675_100337905 3300005354 Bacteria 1333
29 Ga0070671_100728976 3300005355 Bacteria 861
30 Ga0070674_100107356 3300005356 Bacteria 2044
31 Ga0070673_100581056 3300005364 Bacteria 1020
32 Ga0070673_100799038 3300005364 Bacteria 871
33 Ga0070688_100018132 3300005365 Bacteria 4056
34 Ga0070659_100198953 3300005366 Bacteria 1649
35 Ga0070667_100308307 3300005367 Bacteria 1426
36 Ga0070667_100480464 3300005367 Bacteria 1137
37 Ga0070667_100650899 3300005367 Bacteria 973
38 Ga0070703_10079911 3300005406 Bacteria 1111
39 Ga0070709_10257787 3300005434 Bacteria 1259
40 Ga0070714_100071785 3300005435 Bacteria 2995
41 Ga0070713_100004167 3300005436 Bacteria 9646
42 Ga0070713_100546882 3300005436 Bacteria 1096
43 Ga0070710_10256412 3300005437 Bacteria 1126
44 Ga0070701_10224384 3300005438 Bacteria 1122
45 Ga0070711_101051916 3300005439 Bacteria 700
46 Ga0070705_100452019 3300005440 Bacteria 964
47 Ga0070700_100290856 3300005441 Bacteria 1189
48 Ga0070663_100939935 3300005455 Bacteria 749
49 Ga0070662_100054119 3300005457 Bacteria 2908
50 Ga0070662_100447266 3300005457 Bacteria 1072
51 Ga0070681_10101934 3300005458 Bacteria 2815
52 Ga0070681_10150160 3300005458 Bacteria 2257
53 Ga0068867_100430239 3300005459 Bacteria 1120
54 Ga0070685_10076878 3300005466 Bacteria 1992
55 Ga0070685_10736612 3300005466 Bacteria 722
56 Ga0070699_101137803 3300005518 Bacteria 716
57 Ga0070679_100033557 3300005530 Bacteria 5082
58 Ga0070679_100070971 3300005530 Bacteria 3474
59 Ga0070679_100596072 3300005530 Unclassified 1048
60 Ga0070684_100555217 3300005535 Bacteria 1066
61 Ga0070684_100953268 3300005535 Bacteria 805
62 Ga0068853_100489001 3300005539 Unclassified 1161
63 Ga0070672_100003964 3300005543 Bacteria 9654
64 Ga0070672_100209788 3300005543 Bacteria 1631
65 Ga0070686_100058831 3300005544 Bacteria 2474
66 Ga0070695_100401599 3300005545 Bacteria 1039
67 Ga0070696_100433236 3300005546 Bacteria 1035
68 Ga0070665_100076194 3300005548 Bacteria 3361
69 Ga0070665_100159829 3300005548 Bacteria 2255
70 Ga0070665_100462537 3300005548 Archaea 1279
71 Ga0070704_100492093 3300005549 Bacteria 1063
72 Ga0070704_100574194 3300005549 Bacteria 988
73 Ga0068855_100010055 3300005563 Bacteria 11402
74 Ga0068855_100731020 3300005563 Bacteria 1057
75 Ga0070664_100030898 3300005564 Bacteria 4471
76 Ga0070664_100264778 3300005564 Bacteria 1547
77 Ga0070664_100861406 3300005564 Bacteria 849
78 Ga0068857_100010719 3300005577 Bacteria 7976
79 Ga0068852_100076611 3300005616 Bacteria 2953
80 Ga0068864_100008813 3300005618 Bacteria 8317
81 Ga0068864_100121533 3300005618 Bacteria 2335
82 Ga0068864_101789605 3300005618 Bacteria 619
83 Ga0068861_100185407 3300005719 Bacteria 1735
84 Ga0068870_10216016 3300005840 Bacteria 1171
85 Ga0068858_100050154 3300005842 Bacteria 3863
86 Ga0068858_100235042 3300005842 Bacteria 1738
87 Ga0068860_100165429 3300005843 Bacteria 2135
88 Ga0068860_100401680 3300005843 Bacteria 1356
89 Ga0068860_101267610 3300005843 Bacteria 758
90 Ga0068860_101635902 3300005843 Bacteria 666
91 Ga0068862_100034975 3300005844 Bacteria 4252
92 Ga0068862_100535767 3300005844 Bacteria 1116
93 Ga0068862_101462950 3300005844 Bacteria 688
94 Ga0081455_10118733 3300005937 Bacteria 2087
95 Ga0070717_10064218 3300006028 Bacteria 3049
96 Ga0070715_10096971 3300006163 Bacteria 1368
97 Ga0070716_100117678 3300006173 Bacteria 1658
98 Ga0070712_100894674 3300006175 Bacteria 765
99 Ga0070712_101121770 3300006175 Bacteria 683
100 Ga0075367_10034089 3300006178 Bacteria 2938
101 Ga0075367_10211489 3300006178 Bacteria 1213
102 Ga0075366_10250608 3300006195 Bacteria 1080
103 Ga0075366_10553156 3300006195 Bacteria 713
104 Ga0097621_100041740 3300006237 Bacteria 3694
105 Ga0097621_100382798 3300006237 Bacteria 1257
106 Ga0097621_100673271 3300006237 Bacteria 951
107 Ga0068871_100109118 3300006358 Bacteria 2326
108 Ga0068871_100254285 3300006358 Bacteria 1531
109 Ga0068871_100529985 3300006358 Bacteria 1065
110 Ga0075428_100000010 3300006844 Bacteria 213631
111 Ga0075428_100060560 3300006844 Bacteria 4145
112 Ga0075428_100316927 3300006844 Bacteria 1676
113 Ga0075428_101181011 3300006844 Bacteria 807
114 Ga0075430_100033278 3300006846 Bacteria 4375
115 Ga0075430_100134791 3300006846 Bacteria 2058
116 Ga0075430_100180754 3300006846 Bacteria 1754
117 Ga0075431_100016240 3300006847 Bacteria 7553
118 Ga0075431_100047948 3300006847 Bacteria 4406
119 Ga0075431_100140965 3300006847 Bacteria 2485
120 Ga0075431_100558505 3300006847 Bacteria 1132
121 Ga0075433_10026230 3300006852 Bacteria 4932
122 Ga0075433_10094811 3300006852 Bacteria 2641
123 Ga0075434_100024773 3300006871 Bacteria 5866
124 Ga0075434_100273290 3300006871 Bacteria 1709
125 Ga0075434_100868685 3300006871 Bacteria 917
126 Ga0075429_100141020 3300006880 Bacteria 2110
127 Ga0075429_100157523 3300006880 Bacteria 1988
128 Ga0075429_100253869 3300006880 Bacteria 1540
129 Ga0068865_100162246 3300006881 Bacteria 1706
130 Ga0075436_100122921 3300006914 Bacteria 1817
131 Ga0075435_100051016 3300007076 Bacteria 3331
132 Ga0075435_100072662 3300007076 Bacteria 2810
133 Ga0075435_101232732 3300007076 Bacteria 655
134 Ga0105251_10052654 3300009011 Bacteria 1937
135 Ga0105240_10211148 3300009093 Bacteria 2268
136 Ga0105240_10690082 3300009093 Bacteria 1115
137 Ga0111539_10000001 3300009094 Bacteria 1035431
138 Ga0111539_10220842 3300009094 Bacteria 2207
139 Ga0105245_10269974 3300009098 Bacteria 1659
140 Ga0105247_10010871 3300009101 Bacteria 5499
141 Ga0105247_10046659 3300009101 Bacteria 2660
142 Ga0105247_10068387 3300009101 Bacteria 2215
143 Ga0114129_10008349 3300009147 Bacteria 14765
144 Ga0114129_10042823 3300009147 Bacteria 6371
145 Ga0114129_10077442 3300009147 Bacteria 4625
146 Ga0114129_10849020 3300009147 Unclassified 1161
147 Ga0105243_10098573 3300009148 Bacteria 2421
148 Ga0105243_10505157 3300009148 Bacteria 1146
149 Ga0105243_12414682 3300009148 Bacteria 564
150 Ga0105241_10683636 3300009174 Bacteria 935
151 Ga0105242_10139317 3300009176 Bacteria 2103
152 Ga0105242_10148776 3300009176 Bacteria 2040
153 Ga0105242_10329383 3300009176 Bacteria 1403
154 Ga0105242_10887331 3300009176 Bacteria 890
155 Ga0105242_11450394 3300009176 Unclassified 715
156 Ga0105248_10002926 3300009177 Bacteria 18953
157 Ga0105248_10014811 3300009177 Bacteria 8590
158 Ga0105248_10232301 3300009177 Bacteria 2076
159 Ga0105248_10260777 3300009177 Bacteria 1951
160 Ga0105248_10366110 3300009177 Bacteria 1623
161 Ga0105248_10467242 3300009177 Bacteria 1422
162 Ga0105248_11453137 3300009177 Unclassified 776
163 Ga0105248_11669217 3300009177 Bacteria 722
164 Ga0105237_11214851 3300009545 Bacteria 760
165 Ga0105238_10519926 3300009551 Bacteria 1193
166 Ga0105249_10001189 3300009553 Bacteria 22992
167 Ga0105249_10016809 3300009553 Bacteria 6491
168 Ga0105249_10089504 3300009553 Bacteria 2876
169 Ga0105249_10265080 3300009553 Bacteria 1709
170 Ga0105239_10350821 3300010375 Bacteria 1666
171 Ga0105239_10609676 3300010375 Bacteria 1245
172 Ga0105239_10701976 3300010375 Bacteria 1157
173 Ga0105239_11807558 3300010375 Bacteria 708
174 Ga0105239_12153638 3300010375 Bacteria 648
175 Ga0105246_11082982 3300011119 Bacteria 731
176 Ga0157378_10015911 3300013297 Bacteria 6587
177 Ga0157378_10129721 3300013297 Bacteria 2333
178 Ga0157378_10800102 3300013297 Bacteria 968
179 Ga0163162_10062145 3300013306 Bacteria 3775
180 Ga0163162_10662633 3300013306 Bacteria 1167
181 Ga0163162_11929475 3300013306 Bacteria 676
182 Ga0157372_12149589 3300013307 Bacteria 641
183 Ga0157375_10659836 3300013308 Bacteria 1202
184 Ga0157375_11171752 3300013308 Bacteria 901
185 Ga0163163_10010034 3300014325 Bacteria 8496
186 Ga0163163_10022050 3300014325 Bacteria 6022
187 Ga0157380_10024634 3300014326 Bacteria 4556
188 Ga0157380_10136005 3300014326 Bacteria 2104
189 Ga0157380_10145526 3300014326 Bacteria 2042
190 Ga0157380_10251187 3300014326 Bacteria 1601
191 Ga0157380_12255688 3300014326 Bacteria 609
192 Ga0157379_10005817 3300014968 Bacteria 10602
193 Ga0157379_10100223 3300014968 Bacteria 2600
194 Ga0157379_10474634 3300014968 Bacteria 1157
195 Ga0157376_10665930 3300014969 Bacteria 1043
196 Ga0163161_10020936 3300017792 Bacteria 4595
197 Ga0207697_10128368 3300025315 Bacteria 1095
198 Ga0207653_10083380 3300025885 Bacteria 1110
199 Ga0207692_10426633 3300025898 Bacteria 831
200 Ga0207642_10032915 3300025899 Bacteria 2188
201 Ga0207710_10004642 3300025900 Bacteria 5964
202 Ga0207710_10032468 3300025900 Bacteria 2286
203 Ga0207680_10995913 3300025903 Bacteria 600
204 Ga0207685_10091381 3300025905 Bacteria 1282
205 Ga0207699_10166694 3300025906 Bacteria 1471
206 Ga0207699_10420624 3300025906 Bacteria 954
207 Ga0207645_10017428 3300025907 Bacteria 4740
208 Ga0207643_10033609 3300025908 Bacteria 2870
209 Ga0207654_10263843 3300025911 Bacteria 1159
210 Ga0207707_10323488 3300025912 Bacteria 1331
211 Ga0207707_10447358 3300025912 Bacteria 1106
212 Ga0207707_10583847 3300025912 Bacteria 947
213 Ga0207695_10479453 3300025913 Bacteria 1126
214 Ga0207693_10559790 3300025915 Bacteria 891
215 Ga0207663_10467043 3300025916 Bacteria 975
216 Ga0207660_10070688 3300025917 Bacteria 2538
217 Ga0207660_10104025 3300025917 Bacteria 2125
218 Ga0207657_10031590 3300025919 Bacteria 4795
219 Ga0207649_10312992 3300025920 Bacteria 1151
220 Ga0207652_10018925 3300025921 Bacteria 5654
221 Ga0207652_10746898 3300025921 Bacteria 871
222 Ga0207646_11117823 3300025922 Bacteria 693
223 Ga0207646_11466181 3300025922 Bacteria 592
224 Ga0207681_10003121 3300025923 Bacteria 10423
225 Ga0207681_10201022 3300025923 Bacteria 1530
226 Ga0207681_10274900 3300025923 Bacteria 1324
227 Ga0207681_10735088 3300025923 Bacteria 822
228 Ga0207694_10379926 3300025924 Bacteria 1172
229 Ga0207650_10108818 3300025925 Bacteria 2143
230 Ga0207650_10134031 3300025925 Bacteria 1941
231 Ga0207650_10514985 3300025925 Bacteria 1001
232 Ga0207659_10004392 3300025926 Bacteria 8521
233 Ga0207659_10220753 3300025926 Unclassified 1524
234 Ga0207659_10297299 3300025926 Bacteria 1325
235 Ga0207659_10299936 3300025926 Bacteria 1319
236 Ga0207659_10368812 3300025926 Unclassified 1195
237 Ga0207700_10008345 3300025928 Bacteria 6411
238 Ga0207700_10112583 3300025928 Bacteria 2192
239 Ga0207664_10377825 3300025929 Bacteria 1257
240 Ga0207644_10077512 3300025931 Bacteria 2448
241 Ga0207690_10309947 3300025932 Bacteria 1238
242 Ga0207690_10567846 3300025932 Bacteria 924
243 Ga0207706_10089304 3300025933 Bacteria 2709
244 Ga0207706_10144639 3300025933 Bacteria 2092
245 Ga0207706_10348743 3300025933 Bacteria 1287
246 Ga0207706_11077868 3300025933 Unclassified 672
247 Ga0207686_10403801 3300025934 Bacteria 1041
248 Ga0207686_10555384 3300025934 Bacteria 898
249 Ga0207709_10150320 3300025935 Bacteria 1612
250 Ga0207709_10835945 3300025935 Bacteria 745
251 Ga0207704_10326423 3300025938 Bacteria 1186
252 Ga0207704_10348950 3300025938 Bacteria 1151
253 Ga0207704_10745405 3300025938 Unclassified 814
254 Ga0207665_10285383 3300025939 Bacteria 1230
255 Ga0207691_10008714 3300025940 Bacteria 9728
256 Ga0207691_10142021 3300025940 Bacteria 2115
257 Ga0207691_10279983 3300025940 Bacteria 1435
258 Ga0207711_10089417 3300025941 Bacteria 2706
259 Ga0207711_10412483 3300025941 Bacteria 1256
260 Ga0207711_10661511 3300025941 Bacteria 974
261 Ga0207661_10218080 3300025944 Bacteria 1685
262 Ga0207679_10090586 3300025945 Bacteria 2365
263 Ga0207679_10092276 3300025945 Bacteria 2346
264 Ga0207679_10177072 3300025945 Bacteria 1761
265 Ga0207667_10009099 3300025949 Bacteria 11739
266 Ga0207667_10413336 3300025949 Bacteria 1373
267 Ga0207712_10127104 3300025961 Bacteria 1937
268 Ga0207712_10202195 3300025961 Bacteria 1576
269 Ga0207712_10349216 3300025961 Bacteria 1229
270 Ga0207712_10924861 3300025961 Bacteria 772
271 Ga0207712_10948692 3300025961 Bacteria 762
272 Ga0207668_10749206 3300025972 Bacteria 862
273 Ga0207658_11030391 3300025986 Bacteria 751
274 Ga0207677_10095799 3300026023 Bacteria 2170
275 Ga0207703_10023896 3300026035 Bacteria 4806
276 Ga0207703_10666245 3300026035 Bacteria 988
277 Ga0207639_10509150 3300026041 Bacteria 1101
278 Ga0207708_10210300 3300026075 Bacteria 1555
279 Ga0207708_10439024 3300026075 Bacteria 1085
280 Ga0207641_10199963 3300026088 Bacteria 1842
281 Ga0207648_10080772 3300026089 Bacteria 2836
282 Ga0207648_10348635 3300026089 Bacteria 1334
283 Ga0207676_10134202 3300026095 Bacteria 2109
284 Ga0207676_10706588 3300026095 Bacteria 977
285 Ga0207676_11920204 3300026095 Bacteria 591
286 Ga0207674_10025110 3300026116 Bacteria 6358
287 Ga0207674_10136535 3300026116 Bacteria 2414
288 Ga0207675_100242896 3300026118 Bacteria 1740
289 Ga0207675_100449555 3300026118 Bacteria 1277
290 Ga0207683_10080735 3300026121 Bacteria 2885
291 Ga0207683_10231999 3300026121 Bacteria 1683
292 Ga0207683_10239430 3300026121 Bacteria 1655
293 Ga0207698_10214635 3300026142 Bacteria 1734
294 Ga0207428_10000002 3300027907 Bacteria 854851
295 Ga0207428_10060191 3300027907 Bacteria 3009
296 Ga0268266_10063251 3300028379 Bacteria 3195
297 Ga0268266_10175315 3300028379 Bacteria 1949
298 Ga0268265_10010459 3300028380 Bacteria 6267
299 Ga0268265_10351733 3300028380 Bacteria 1346
300 Ga0268265_10957356 3300028380 Bacteria 844
301 Ga0268265_11363259 3300028380 Bacteria 711
302 Ga0268264_10400061 3300028381 Bacteria 1319
303 Ga0268264_10846659 3300028381 Bacteria 916
304 Ga0268264_10871185 3300028381 Bacteria 903
305 Ga0265316_10120765 3300031344 Bacteria 1979
306 Ga0307408_101119854 3300031548 Bacteria 731
307 Ga0316575_10000035 3300031665 Bacteria 32977
308 Ga0316575_10000389 3300031665 Bacteria 12533
309 Ga0316575_10009884 3300031665 Bacteria 3497
310 Ga0316575_10051071 3300031665 Bacteria 1646
311 Ga0316575_10110746 3300031665 Bacteria 1120
312 Ga0316575_10176569 3300031665 Bacteria 886
313 Ga0316575_10241777 3300031665 Bacteria 756
314 Ga0316579_10000957 3300031691 Bacteria 10106
315 Ga0316579_10001214 3300031691 Bacteria 9247
316 Ga0316579_10003017 3300031691 Bacteria 6472
317 Ga0316579_10015725 3300031691 Bacteria 3291
318 Ga0316579_10031056 3300031691 Bacteria 2443
319 Ga0265314_10022431 3300031711 Bacteria 4836
320 Ga0316576_10000046 3300031727 Bacteria 37895
321 Ga0316576_10004420 3300031727 Bacteria 8423
322 Ga0316576_10009067 3300031727 Bacteria 6401
323 Ga0316576_10019400 3300031727 Unclassified 4659
324 Ga0316576_10025025 3300031727 Bacteria 4175
325 Ga0316576_10035360 3300031727 Bacteria 3565
326 Ga0316576_10071072 3300031727 Bacteria 2567
327 Ga0316576_10084356 3300031727 Bacteria 2361
328 Ga0316576_10140119 3300031727 Bacteria 1821
329 Ga0316576_10147999 3300031727 Bacteria 1769
330 Ga0316576_10173861 3300031727 Bacteria 1625
331 Ga0316576_10262882 3300031727 Bacteria 1294
332 Ga0316576_10396128 3300031727 Bacteria 1023
333 Ga0316576_10570479 3300031727 Bacteria 828
334 Ga0316576_10633020 3300031727 Bacteria 779
335 Ga0316576_10649650 3300031727 Bacteria 767
336 Ga0316576_10736988 3300031727 Bacteria 712
337 Ga0316576_10890620 3300031727 Bacteria 638
338 Ga0316578_10000655 3300031728 Bacteria 12269
339 Ga0316578_10011920 3300031728 Bacteria 4568
340 Ga0316578_10014047 3300031728 Bacteria 4264
341 Ga0316578_10036238 3300031728 Bacteria 2839
342 Ga0316578_10041677 3300031728 Bacteria 2659
343 Ga0316578_10052157 3300031728 Bacteria 2396
344 Ga0316578_10145635 3300031728 Bacteria 1427
345 Ga0316578_10149855 3300031728 Bacteria 1405
346 Ga0316578_10285871 3300031728 Bacteria 987
347 Ga0316578_10509657 3300031728 Bacteria 708
348 Ga0316578_10610440 3300031728 Bacteria 639
349 Ga0316577_10003406 3300031733 Bacteria 8025
350 Ga0316577_10047642 3300031733 Bacteria 2393
351 Ga0316577_10089362 3300031733 Bacteria 1724
352 Ga0316577_10109267 3300031733 Bacteria 1551
353 Ga0316577_10149983 3300031733 Bacteria 1314
354 Ga0307409_100224447 3300031995 Bacteria 1698
355 Ga0307409_101105587 3300031995 Bacteria 814
356 Ga0307416_100620234 3300032002 Bacteria 1163
357 Ga0307416_101239182 3300032002 Bacteria 852
358 Ga0307411_10897495 3300032005 Unclassified 787
359 Ga0316583_10000182 3300032133 Bacteria 16037
360 Ga0316583_10001812 3300032133 Bacteria 7272
361 Ga0316583_10001854 3300032133 Bacteria 7200
362 Ga0316583_10005415 3300032133 Bacteria 4581
363 Ga0316583_10009721 3300032133 Bacteria 3466
364 Ga0316583_10023089 3300032133 Bacteria 2224
365 Ga0316583_10030002 3300032133 Bacteria 1936
366 Ga0316583_10072408 3300032133 Bacteria 1205
367 Ga0316585_10000030 3300032137 Bacteria 21335
368 Ga0316585_10001618 3300032137 Bacteria 5970
369 Ga0316585_10002641 3300032137 Bacteria 4855
370 Ga0316585_10012291 3300032137 Bacteria 2534
371 Ga0316585_10043724 3300032137 Bacteria 1430
372 Ga0316580_10000056 3300032139 Bacteria 18370
373 Ga0316580_10006824 3300032139 Bacteria 3380
374 Ga0316580_10029294 3300032139 Bacteria 1703
375 Ga0316580_10038867 3300032139 Bacteria 1470
376 Ga0316592_1009087 3300033524 Bacteria 1983
377 Ga0316592_1020412 3300033524 Bacteria 1407
378 Ga0316596_1022872 3300033541 Bacteria 1599
379 Ga0316596_1042629 3300033541 Bacteria 1194
380 Ga0316596_1045808 3300033541 Bacteria 1154
381 Ga0373934_0257531 3300035086 Bacteria 722
382 Ga0373945_0194463 3300035116 Bacteria 840
383 Ga0373956_0117696 3300035119 Bacteria 1240
384 Ga0373956_0260952 3300035119 Bacteria 824
385 Ga0373957_0142310 3300035120 Bacteria 981
386 Ga0373943_0000587 3300035170 Bacteria 15773
387 Ga0316574_0000522 3300035398 Bacteria 15704
388 Ga0316574_0002176 3300035398 Bacteria 9716
389 Ga0316574_0014587 3300035398 Bacteria 4542
390 Ga0316574_0105245 3300035398 Unclassified 1807
391 Ga0316574_0245932 3300035398 Bacteria 1143
392 Ga0316574_0469679 3300035398 Bacteria 787
393 Ga0373924_0013327 3300035410 Bacteria 3087
394 Ga0373931_0456314 3300035691 Bacteria 818
395 Ga0373935_0012449 3300035692 Bacteria 5118
396 Ga0373927_0222835 3300035695 Bacteria 1239
397 Ga0373933_0292283 3300035724 Bacteria 1054
398 Ga0373947_0000839 3300035725 Bacteria 18556
399 Ga0373937_0195391 3300036401 Bacteria 1901
400 Ga0373937_1484627 3300036401 Bacteria 625
401 Ga0316582_0000428 3300036647 Bacteria 15432
402 Ga0316582_0001511 3300036647 Bacteria 10280
403 Ga0316582_0002614 3300036647 Bacteria 8531
404 Ga0316582_0003700 3300036647 Bacteria 7565
405 Ga0316582_0032367 3300036647 Bacteria 3203
406 Ga0316582_0057783 3300036647 Bacteria 2479
407 Ga0316582_0102882 3300036647 Bacteria 1894
408 Ga0316582_0177996 3300036647 Bacteria 1446
409 Ga0316582_0188772 3300036647 Bacteria 1404
410 Ga0316582_0238321 3300036647 Bacteria 1246
411 Ga0316582_0252809 3300036647 Unclassified 1208
412 Ga0316582_0256018 3300036647 Bacteria 1200
413 Ga0316582_0342740 3300036647 Bacteria 1028
414 Ga0316582_0430475 3300036647 Bacteria 909
415 Ga0316584_0003414 3300036712 Bacteria 10306
416 Ga0316584_0016916 3300036712 Bacteria 5232
417 Ga0316584_0046916 3300036712 Bacteria 3226
418 Ga0316584_0054179 3300036712 Bacteria 3002
419 Ga0316584_0091429 3300036712 Bacteria 2278
420 Ga0316584_0097107 3300036712 Bacteria 2206
421 Ga0316584_0246277 3300036712 Bacteria 1307
422 Ga0316584_0254697 3300036712 Bacteria 1281
423 Ga0316584_0331456 3300036712 Bacteria 1096
424 Ga0316584_0503591 3300036712 Bacteria 850
425 Ga0373925_0003817 3300037068 Bacteria 11563
426 Ga0373925_0433612 3300037068 Bacteria 1075
427 Ga0395905_0110478 3300037471 Bacteria 2582
428 Ga0316581_0004584 3300037588 Bacteria 3535
429 Ga0316581_0057481 3300037588 Bacteria 1193
430 Ga0400490_29105 3300038726 Bacteria 1049
431 Ga0400490_29447 3300038726 Bacteria 1168
432 Ga0400491_29415 3300038727 Bacteria 5139
433 Ga0400485_10511 3300038735 Bacteria 11370
434 Ga0400485_12953 3300038735 Bacteria 10256
435 Ga0400488_09257 3300038741 Bacteria 1717
436 Ga0400488_20927 3300038741 Bacteria 10957
437 Ga0400488_25044 3300038741 Bacteria 1299
438 Ga0400488_61560 3300038741 Bacteria 6519
439 Ga0400486_25600 3300038742 Bacteria 31060
440 Ga0400486_30854 3300038742 Bacteria 55977
441 Ga0400483_010828 3300039062 Bacteria 25274
442 Ga0400483_016329 3300039062 Bacteria 2882
443 Ga0400483_034219 3300039062 Bacteria 29338
444 Ga0400483_035847 3300039062 Bacteria 3306
445 Ga0400483_061632 3300039062 Bacteria 9058
446 Ga0400483_167725 3300039062 Bacteria 2775
447 Ga0400483_255949 3300039062 Unclassified 1101
448 Ga0400489_36589 3300039093 Bacteria 22091
449 Ga0400487_28190 3300039110 Unclassified 1417
450 Ga0400487_34922 3300039110 Bacteria 34543
451 Ga0400487_66110 3300039110 Bacteria 2505
452 Ga0439461_0011147 3300041410 Unclassified 1664
453 Ga0439433_0002782 3300041999 Bacteria 3729
454 Ga0439433_0039154 3300041999 Bacteria 1101
455 Ga0439441_023931 3300042001 Bacteria 1144
456 Ga0439445_0176357 3300042004 Bacteria 627
457 Ga0439449_0117194 3300042007 Bacteria 988
458 Ga0439454_005973 3300042011 Bacteria 1478
459 Ga0439455_0061706 3300042012 Bacteria 995
460 Ga0439462_0032086 3300042015 Bacteria 1392
461 Ga0450920_048126 3300042122 Bacteria 853
462 Ga0450923_050040 3300042125 Unclassified 895
463 Ga0450894_005829 3300042131 Bacteria 1596
464 Ga0450896_001951 3300042133 Bacteria 2620
465 Ga0450902_047777 3300042137 Bacteria 732
466 Ga0450889_025860 3300042144 Bacteria 670
467 Ga0450908_001456 3300042184 Bacteria 4598
468 Ga0450908_072150 3300042184 Bacteria 614
469 Ga0439434_0023085 3300042435 Bacteria 1871
470 Ga0439434_0302598 3300042435 Bacteria 553
471 Ga0439459_0037143 3300042438 Unclassified 1019
472 Ga0439464_0003729 3300042439 Bacteria 3866
473 Ga0439460_0027081 3300042461 Bacteria 1608
474 Ga0450916_011256 3300042530 Bacteria 1128
475 Ga0450918_016535 3300042531 Bacteria 1282
476 Ga0450918_049786 3300042531 Bacteria 762
477 Ga0451577_0027233 3300042876 Bacteria 5173
478 Ga0451577_0728998 3300042876 Unclassified 897
479 Ga0453683_0476983 3300044673 Bacteria 808
480 Ga0466963_0053935 3300044694 Bacteria 2671
481 Ga0453684_0171621 3300044712 Bacteria 2555
482 Ga0453684_0445850 3300044712 Bacteria 1442
483 Ga0453684_0550832 3300044712 Bacteria 1270
484 Ga0453684_0780281 3300044712 Bacteria 1032
485 Ga0451576_0217196 3300045051 Bacteria 1996
486 Ga0466958_0398315 3300045836 Bacteria 889
487 Ga0466967_1113823 3300045976 Bacteria 787
488 Ga0466967_1379423 3300045976 Bacteria 702
489 Ga0495592_0149168 3300046454 Bacteria 1619
490 Ga0495592_0378425 3300046454 Bacteria 901
491 Ga0495603_0303166 3300046455 Bacteria 918
492 Ga0495629_0374829 3300046459 Bacteria 969
493 Ga0495651_0340567 3300046462 Bacteria 994
494 Ga0495580_0849871 3300046472 Bacteria 589
495 Ga0495664_0574905 3300046477 Bacteria 671
496 Ga0495608_0094793 3300046511 Bacteria 1929
497 Ga0495618_0464382 3300046514 Bacteria 767
498 Ga0495628_0063757 3300046516 Bacteria 2887
499 Ga0495628_0386405 3300046516 Bacteria 1024
500 Ga0495630_0193175 3300046517 Bacteria 1553
501 Ga0495642_0167177 3300046528 Bacteria 955
502 Ga0495642_0328297 3300046528 Bacteria 671
503 Ga0495665_0301068 3300046531 Bacteria 821
504 Ga0495640_0556631 3300046533 Bacteria 695
505 Ga0495586_0081629 3300046535 Bacteria 1777
506 Ga0495586_0128550 3300046535 Bacteria 1418
507 Ga0495586_0280028 3300046535 Bacteria 954
508 Ga0495634_0428327 3300046642 Unclassified 783
509 Ga0495634_0576068 3300046642 Bacteria 655
510 Ga0495635_0169710 3300046663 Bacteria 1484
511 Ga0495635_0171417 3300046663 Bacteria 1476
512 Ga0495599_0072930 3300046678 Bacteria 2143
513 Ga0495599_0212389 3300046678 Bacteria 1186
514 Ga0495599_0292361 3300046678 Unclassified 985
515 Ga0495647_0036553 3300046681 Bacteria 1849
516 Ga0495658_0237166 3300046683 Bacteria 1145
517 Ga0495658_0412615 3300046683 Bacteria 861
518 Ga0495613_0349644 3300046689 Bacteria 1015
519 Ga0495613_0404132 3300046689 Bacteria 931
520 Ga0495624_0747324 3300046690 Unclassified 579
521 Ga0495600_0417460 3300046809 Bacteria 833
522 Ga0495604_0057611 3300047317 Bacteria 2987
523 Ga0495674_0276313 3300047319 Bacteria 1377
524 Ga0495674_0379046 3300047319 Bacteria 1145
525 Ga0495674_0540909 3300047319 Unclassified 928
526 Ga0495672_0024901 3300047320 Bacteria 3844
527 Ga0495680_0124893 3300047322 Bacteria 1897
528 Ga0495680_0130196 3300047322 Bacteria 1850
529 Ga0495680_0401071 3300047322 Bacteria 947
530 Ga0495684_0105885 3300047471 Bacteria 2125
531 Ga0496100_0532047 3300048903 Bacteria 908
532 Ga0496101_0243653 3300048904 Bacteria 1399
533 Ga0496101_0316482 3300048904 Bacteria 1224
534 Ga0496102_0326291 3300048905 Bacteria 1446
535 Ga0496102_0582132 3300048905 Bacteria 1042
536 Ga0496103_0652345 3300048906 Bacteria 669
537 Ga0496104_0006688 3300048907 Bacteria 10145
538 Ga0496104_0107517 3300048907 Bacteria 2673
539 Ga0496105_0064903 3300048908 Bacteria 3013
540 Ga0496106_0284405 3300048909 Bacteria 1325
541 Ga0496106_0521570 3300048909 Bacteria 954
542 Ga0496106_0940108 3300048909 Bacteria 681
543 Ga0496108_0011048 3300048911 Bacteria 7332
544 Ga0496108_0184912 3300048911 Bacteria 1805
545 Ga0496108_0197696 3300048911 Bacteria 1744
546 Ga0496109_0020083 3300048912 Bacteria 5901
547 Ga0496109_0218451 3300048912 Bacteria 1793
548 Ga0496109_1068544 3300048912 Bacteria 744
549 Ga0496111_0133642 3300048914 Bacteria 1837
550 Ga0496111_0263475 3300048914 Bacteria 1279
551 Ga0496112_0033300 3300048915 Bacteria 5008
552 Ga0496112_0086542 3300048915 Bacteria 3100
553 Ga0496112_1114963 3300048915 Bacteria 707
554 Ga0496112_1587022 3300048915 Bacteria 568
555 Ga0496113_0057491 3300048916 Bacteria 2923
556 Ga0496114_0008895 3300048917 Bacteria 7963
557 Ga0496114_0099260 3300048917 Bacteria 2483
558 Ga0496114_0397652 3300048917 Bacteria 1220
559 Ga0496115_0086623 3300048918 Bacteria 2556
560 Ga0496115_0461975 3300048918 Bacteria 1024
561 Ga0501033_0322619 3300049570 Bacteria 1085
562 Ga0501034_0127536 3300049571 Bacteria 2529
563 Ga0501036_0035839 3300049572 Bacteria 4199
564 Ga0501037_0339919 3300049573 Bacteria 1037
565 Ga0501038_0366265 3300049574 Bacteria 1120
566 Ga0501041_0163082 3300049577 Bacteria 1394
567 Ga0501042_0435937 3300049578 Bacteria 950
568 Ga0501042_0646003 3300049578 Bacteria 769
569 Ga0501043_0181977 3300049579 Bacteria 1637
570 Ga0501046_0701235 3300049580 Bacteria 713
571 Ga0501047_0046383 3300049581 Bacteria 4200
572 Ga0501071_0105020 3300049587 Bacteria 2085
573 Ga0501071_0421341 3300049587 Bacteria 1020
574 Ga0501072_0257484 3300049588 Bacteria 1389
575 Ga0501072_0492218 3300049588 Bacteria 970
576 Ga0501073_0285310 3300049589 Bacteria 1139
577 Ga0501074_0316055 3300049590 Bacteria 1109
578 Ga0501075_0015987 3300049591 Bacteria 5398
579 Ga0501075_0020162 3300049591 Bacteria 4845
580 Ga0501075_0199422 3300049591 Bacteria 1526
581 Ga0501075_0272398 3300049591 Bacteria 1290
582 Ga0501076_0025220 3300049592 Bacteria 4600
583 Ga0501076_0098475 3300049592 Bacteria 2356
584 Ga0501076_0480989 3300049592 Bacteria 1023
585 Ga0501225_0142966 3300049705 Bacteria 725
586 Ga0501079_0040549 3300049741 Bacteria 3592
587 Ga0501079_0340193 3300049741 Bacteria 1175
588 Ga0501080_0063036 3300049742 Bacteria 3450
589 Ga0501080_0588049 3300049742 Bacteria 989
590 Ga0501080_1203404 3300049742 Bacteria 651
591 Ga0501081_0050507 3300049743 Bacteria 2865
592 Ga0501081_0102428 3300049743 Bacteria 2025
593 Ga0501081_0611706 3300049743 Bacteria 816
594 Ga0501083_0024832 3300049744 Bacteria 4151
595 Ga0501035_0282968 3300049822 Bacteria 1401
596 Ga0501035_0470510 3300049822 Bacteria 1038
597 Ga0501044_0024597 3300049823 Bacteria 6390
598 Ga0501045_0033959 3300049824 Bacteria 3701
599 Ga0501045_0083334 3300049824 Bacteria 2359
600 Ga0501045_0495946 3300049824 Bacteria 907
601 Ga0501045_0847667 3300049824 Bacteria 672
602 nmdc:mga00v17_214036_c1 3300050491 Bacteria 1247
603 nmdc:mga0yw44_316416_c1 3300050492 Bacteria 1047
604 nmdc:mga0k408_62255_c1 3300050493 Bacteria 2169
605 nmdc:mga05p37_1134093_c1 3300050507 Bacteria 815
606 nmdc:mga05p37_117604_c1 3300050507 Unclassified 3266
607 nmdc:mga05p37_7125_c1 3300050507 Bacteria 13184
608 nmdc:mga05p37_934570_c1 3300050507 Bacteria 930
609 nmdc:mga09592_140784_c1 3300050508 Bacteria 2079
610 nmdc:mga09592_283813_c1 3300050508 Bacteria 1436
611 nmdc:mga0qj67_144533_c1 3300050509 Bacteria 1929
612 nmdc:mga06r32_1391484_c1 3300050510 Bacteria 643
613 nmdc:mga06r32_139277_c1 3300050510 Bacteria 2402
614 nmdc:mga06r32_20786_c1 3300050510 Bacteria 6048
615 nmdc:mga06r32_288005_c1 3300050510 Bacteria 1629
616 nmdc:mga06r32_446280_c1 3300050510 Bacteria 1273
617 nmdc:mga06r32_484667_c1 3300050510 Bacteria 1214
618 nmdc:mga06r32_65986_c1 3300050510 Bacteria 3492
619 nmdc:mga08y16_186124_c1 3300050511 Bacteria 2155
620 nmdc:mga08y16_3_c1 3300050511 Bacteria 936907
621 nmdc:mga08y16_40617_c1 3300050511 Bacteria 4875
622 nmdc:mga0n895_123088_c1 3300050512 Bacteria 2615
623 nmdc:mga0n895_166712_c1 3300050512 Bacteria 2234
624 nmdc:mga0n895_206331_c1 3300050512 Bacteria 1996
625 nmdc:mga0n895_961802_c1 3300050512 Bacteria 837
626 nmdc:mga08x19_21369_c1 3300050514 Bacteria 3995
627 nmdc:mga0a205_25306_c1 3300050515 Bacteria 5653
628 nmdc:mga0a205_741249_c1 3300050515 Bacteria 831
629 Ga0495601_0118253 3300053077 Bacteria 1720
630 Ga0495601_0338185 3300053077 Bacteria 979
631 Ga0495601_0356771 3300053077 Bacteria 950
632 Ga0495612_0180998 3300053078 Bacteria 926
633 Ga0495595_0079466 3300053084 Bacteria 1560
634 Ga0495595_0282686 3300053084 Bacteria 833
635 Ga0495619_0007485 3300053085 Bacteria 6916
636 Ga0495619_0088967 3300053085 Bacteria 2089
637 Ga0500555_000372 3300053103 Bacteria 19028
638 Ga0500592_040023 3300053116 Bacteria 758
639 Ga0500628_058510 3300053129 Bacteria 935
640 Ga0500568_0003417 3300053139 Bacteria 8858
641 Ga0500616_0002270 3300053153 Bacteria 16325
642 Ga0500609_047236 3300053731 Bacteria 597
643 Ga0501084_0086510 3300054114 Bacteria 2632
644 Ga0501084_0156341 3300054114 Bacteria 1923
645 Ga0501084_0385240 3300054114 Bacteria 1185
646 Ga0590075_027686 3300059424 Bacteria 1431
647 Ga0590077_076776 3300059426 Bacteria 766
648 Ga0501082_0404475 3300060353 Bacteria 1191
649 Ga0501082_0461451 3300060353 Bacteria 1110
650 Ga0501082_0825433 3300060353 Bacteria 811

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10659836 Ga0157375_106598362 148
2 3300014969 Ga0157376_10665930 Ga0157376_106659302 148
3 3300042125 Ga0450923_050040 Ga0450923_050040_392_847 151
4 3300035086 Ga0373934_0257531 Ga0373934_0257531_214_693 156
5 iso_pu_bacteria 2744054657 2745169134 157
6 iso_pu_bacteria 2816332336 2817619547 157
7 3300006852 Ga0075433_10094811 Ga0075433_100948112 158
8 3300009147 Ga0114129_10008349 Ga0114129_100083497 158
9 3300009176 Ga0105242_10887331 Ga0105242_108873312 158
10 3300013297 Ga0157378_10015911 Ga0157378_100159112 158
11 3300045976 Ga0466967_1379423 Ga0466967_1379423_205_690 158
12 3300046517 Ga0495630_0193175 Ga0495630_0193175_443_919 158
13 3300046535 Ga0495586_0081629 Ga0495586_0081629_697_1173 158
14 3300046642 Ga0495634_0428327 Ga0495634_0428327_211_687 158
15 3300046663 Ga0495635_0169710 Ga0495635_0169710_178_654 158
16 3300046683 Ga0495658_0412615 Ga0495658_0412615_110_586 158
17 3300046689 Ga0495613_0349644 Ga0495613_0349644_182_658 158
18 3300046690 Ga0495624_0747324 Ga0495624_0747324_28_504 158
19 3300047319 Ga0495674_0276313 Ga0495674_0276313_776_1252 158
20 3300047471 Ga0495684_0105885 Ga0495684_0105885_316_792 158
21 3300053077 Ga0495601_0356771 Ga0495601_0356771_367_843 158
22 3300053084 Ga0495595_0079466 Ga0495595_0079466_809_1285 158
23 3300053085 Ga0495619_0007485 Ga0495619_0007485_912_1388 158
24 iso_pu_bacteria 2740891818 2740992767 158
25 3300005295 Ga0065707_10000711 Ga0065707_1000071112 159
26 3300005353 Ga0070669_100295257 Ga0070669_1002952572 159
27 3300005354 Ga0070675_100024928 Ga0070675_1000249283 159
28 3300005406 Ga0070703_10079911 Ga0070703_100799112 159
29 3300005435 Ga0070714_100071785 Ga0070714_1000717853 159
30 3300005436 Ga0070713_100546882 Ga0070713_1005468822 159
31 3300005844 Ga0068862_100535767 Ga0068862_1005357672 159
32 3300006844 Ga0075428_100000010 Ga0075428_10000001068 159
33 3300006847 Ga0075431_100140965 Ga0075431_1001409653 159
34 3300009093 Ga0105240_10211148 Ga0105240_102111482 159
35 3300009094 Ga0111539_10000001 Ga0111539_10000001132 159
36 3300009553 Ga0105249_10089504 Ga0105249_100895043 159
37 3300014326 Ga0157380_10024634 Ga0157380_100246342 159
38 3300014326 Ga0157380_10136005 Ga0157380_101360053 159
39 3300025885 Ga0207653_10083380 Ga0207653_100833802 159
40 3300025913 Ga0207695_10479453 Ga0207695_104794532 159
41 3300025923 Ga0207681_10274900 Ga0207681_102749002 159
42 3300025925 Ga0207650_10514985 Ga0207650_105149852 159
43 3300025926 Ga0207659_10220753 Ga0207659_102207532 159
44 3300025926 Ga0207659_10297299 Ga0207659_102972992 159
45 3300025926 Ga0207659_10299936 Ga0207659_102999361 159
46 3300025928 Ga0207700_10112583 Ga0207700_101125832 159
47 3300025929 Ga0207664_10377825 Ga0207664_103778252 159
48 3300025940 Ga0207691_10279983 Ga0207691_102799832 159
49 3300025961 Ga0207712_10202195 Ga0207712_102021952 159
50 3300026121 Ga0207683_10231999 Ga0207683_102319992 159
51 3300027907 Ga0207428_10000002 Ga0207428_10000002145 159
52 3300032002 Ga0307416_100620234 Ga0307416_1006202342 159
53 3300036647 Ga0316582_0188772 Ga0316582_0188772_369_848 159
54 3300039110 Ga0400487_66110 Ga0400487_66110_1015_1494 159
55 3300042184 Ga0450908_072150 Ga0450908_072150_51_545 159
56 3300042438 Ga0439459_0037143 Ga0439459_0037143_433_927 159
57 3300042531 Ga0450918_049786 Ga0450918_049786_83_577 159
58 3300044694 Ga0466963_0053935 Ga0466963_0053935_1845_2324 159
59 3300044712 Ga0453684_0171621 Ga0453684_0171621_959_1438 159
60 3300045836 Ga0466958_0398315 Ga0466958_0398315_249_728 159
61 3300045976 Ga0466967_1113823 Ga0466967_1113823_192_680 159
62 3300049580 Ga0501046_0701235 Ga0501046_0701235_197_685 159
63 3300049587 Ga0501071_0105020 Ga0501071_0105020_508_996 159
64 3300049590 Ga0501074_0316055 Ga0501074_0316055_248_736 159
65 3300049591 Ga0501075_0020162 Ga0501075_0020162_1672_2160 159
66 3300049592 Ga0501076_0098475 Ga0501076_0098475_42_530 159
67 3300049741 Ga0501079_0040549 Ga0501079_0040549_44_532 159
68 3300049743 Ga0501081_0102428 Ga0501081_0102428_1504_1992 159
69 3300049744 Ga0501083_0024832 Ga0501083_0024832_3291_3788 159
70 3300049824 Ga0501045_0033959 Ga0501045_0033959_1328_1816 159
71 3300050510 nmdc:mga06r32_1391484_c1 nmdc:mga06r32_1391484_c1_68_547 159
72 3300050510 nmdc:mga06r32_139277_c1 nmdc:mga06r32_139277_c1_972_1466 159
73 3300050511 nmdc:mga08y16_3_c1 nmdc:mga08y16_3_c1_156139_156633 159
74 3300054114 Ga0501084_0385240 Ga0501084_0385240_438_926 159
75 3300060353 Ga0501082_0825433 Ga0501082_0825433_49_537 159
76 3300005333 Ga0070677_10110750 Ga0070677_101107502 160
77 3300005364 Ga0070673_100581056 Ga0070673_1005810562 160
78 3300005367 Ga0070667_100308307 Ga0070667_1003083073 160
79 3300005843 Ga0068860_101267610 Ga0068860_1012676102 160
80 3300006178 Ga0075367_10211489 Ga0075367_102114892 160
81 3300006358 Ga0068871_100529985 Ga0068871_1005299852 160
82 3300009101 Ga0105247_10046659 Ga0105247_100466594 160
83 3300009177 Ga0105248_10232301 Ga0105248_102323011 160
84 3300013297 Ga0157378_10129721 Ga0157378_101297213 160
85 3300014326 Ga0157380_10145526 Ga0157380_101455263 160
86 3300025900 Ga0207710_10032468 Ga0207710_100324683 160
87 3300031711 Ga0265314_10022431 Ga0265314_100224317 160
88 3300031727 Ga0316576_10004420 Ga0316576_100044208 160
89 3300031727 Ga0316576_10009067 Ga0316576_100090675 160
90 3300031727 Ga0316576_10071072 Ga0316576_100710722 160
91 3300031727 Ga0316576_10084356 Ga0316576_100843562 160
92 3300035116 Ga0373945_0194463 Ga0373945_0194463_240_731 160
93 3300035119 Ga0373956_0117696 Ga0373956_0117696_551_1042 160
94 3300035120 Ga0373957_0142310 Ga0373957_0142310_408_899 160
95 3300035724 Ga0373933_0292283 Ga0373933_0292283_410_901 160
96 3300036401 Ga0373937_1484627 Ga0373937_1484627_78_569 160
97 3300037068 Ga0373925_0433612 Ga0373925_0433612_233_724 160
98 3300042001 Ga0439441_023931 Ga0439441_023931_626_1108 160
99 3300042137 Ga0450902_047777 Ga0450902_047777_33_515 160
100 3300042144 Ga0450889_025860 Ga0450889_025860_165_647 160
101 3300042435 Ga0439434_0302598 Ga0439434_0302598_48_530 160
102 3300042461 Ga0439460_0027081 Ga0439460_0027081_1103_1585 160
103 3300042530 Ga0450916_011256 Ga0450916_011256_197_679 160
104 3300046459 Ga0495629_0374829 Ga0495629_0374829_447_938 160
105 3300046472 Ga0495580_0849871 Ga0495580_0849871_28_519 160
106 3300046477 Ga0495664_0574905 Ga0495664_0574905_150_641 160
107 3300046516 Ga0495628_0063757 Ga0495628_0063757_153_644 160
108 3300046531 Ga0495665_0301068 Ga0495665_0301068_288_779 160
109 3300046535 Ga0495586_0128550 Ga0495586_0128550_53_544 160
110 3300046642 Ga0495634_0576068 Ga0495634_0576068_153_644 160
111 3300046663 Ga0495635_0171417 Ga0495635_0171417_801_1292 160
112 3300046678 Ga0495599_0292361 Ga0495599_0292361_342_833 160
113 3300046681 Ga0495647_0036553 Ga0495647_0036553_1186_1677 160
114 3300046683 Ga0495658_0237166 Ga0495658_0237166_535_1026 160
115 3300046689 Ga0495613_0404132 Ga0495613_0404132_11_502 160
116 3300046809 Ga0495600_0417460 Ga0495600_0417460_236_727 160
117 3300047319 Ga0495674_0540909 Ga0495674_0540909_386_877 160
118 3300047322 Ga0495680_0124893 Ga0495680_0124893_782_1273 160
119 3300049592 Ga0501076_0480989 Ga0501076_0480989_227_709 160
120 3300049705 Ga0501225_0142966 Ga0501225_0142966_97_579 160
121 3300049743 Ga0501081_0611706 Ga0501081_0611706_113_595 160
122 3300050492 nmdc:mga0yw44_316416_c1 nmdc:mga0yw44_316416_c1_81_566 160
123 3300053077 Ga0495601_0338185 Ga0495601_0338185_209_700 160
124 3300053084 Ga0495595_0282686 Ga0495595_0282686_155_646 160
125 3300053085 Ga0495619_0088967 Ga0495619_0088967_47_538 160
126 3300005290 Ga0065712_10022087 Ga0065712_100220872 161
127 3300005290 Ga0065712_10126316 Ga0065712_101263162 161
128 3300005290 Ga0065712_10188467 Ga0065712_101884671 161
129 3300005293 Ga0065715_10235947 Ga0065715_102359472 161
130 3300005293 Ga0065715_10346250 Ga0065715_103462502 161
131 3300005293 Ga0065715_10508785 Ga0065715_105087852 161
132 3300005295 Ga0065707_10113287 Ga0065707_101132873 161
133 3300005331 Ga0070670_100003718 Ga0070670_10000371815 161
134 3300005339 Ga0070660_100007604 Ga0070660_1000076047 161
135 3300005353 Ga0070669_100007815 Ga0070669_1000078153 161
136 3300005353 Ga0070669_100076401 Ga0070669_1000764013 161
137 3300005354 Ga0070675_100207374 Ga0070675_1002073743 161
138 3300005354 Ga0070675_100243452 Ga0070675_1002434522 161
139 3300005354 Ga0070675_100337905 Ga0070675_1003379052 161
140 3300005366 Ga0070659_100198953 Ga0070659_1001989532 161
141 3300005367 Ga0070667_100650899 Ga0070667_1006508992 161
142 3300005434 Ga0070709_10257787 Ga0070709_102577872 161
143 3300005436 Ga0070713_100004167 Ga0070713_1000041673 161
144 3300005437 Ga0070710_10256412 Ga0070710_102564122 161
145 3300005439 Ga0070711_101051916 Ga0070711_1010519162 161
146 3300005440 Ga0070705_100452019 Ga0070705_1004520191 161
147 3300005457 Ga0070662_100447266 Ga0070662_1004472662 161
148 3300005458 Ga0070681_10101934 Ga0070681_101019342 161
149 3300005458 Ga0070681_10150160 Ga0070681_101501602 161
150 3300005530 Ga0070679_100033557 Ga0070679_1000335572 161
151 3300005530 Ga0070679_100070971 Ga0070679_1000709713 161
152 3300005530 Ga0070679_100596072 Ga0070679_1005960722 161
153 3300005535 Ga0070684_100555217 Ga0070684_1005552172 161
154 3300005535 Ga0070684_100953268 Ga0070684_1009532681 161
155 3300005543 Ga0070672_100209788 Ga0070672_1002097882 161
156 3300005545 Ga0070695_100401599 Ga0070695_1004015992 161
157 3300005546 Ga0070696_100433236 Ga0070696_1004332361 161
158 3300005548 Ga0070665_100159829 Ga0070665_1001598292 161
159 3300005549 Ga0070704_100574194 Ga0070704_1005741941 161
160 3300005563 Ga0068855_100010055 Ga0068855_1000100552 161
161 3300005563 Ga0068855_100731020 Ga0068855_1007310202 161
162 3300005564 Ga0070664_100264778 Ga0070664_1002647782 161
163 3300005577 Ga0068857_100010719 Ga0068857_1000107193 161
164 3300005618 Ga0068864_100121533 Ga0068864_1001215334 161
165 3300005618 Ga0068864_101789605 Ga0068864_1017896051 161
166 3300005842 Ga0068858_100050154 Ga0068858_1000501543 161
167 3300005843 Ga0068860_100401680 Ga0068860_1004016802 161
168 3300005844 Ga0068862_100034975 Ga0068862_1000349752 161
169 3300005844 Ga0068862_101462950 Ga0068862_1014629501 161
170 3300005937 Ga0081455_10118733 Ga0081455_101187332 161
171 3300006028 Ga0070717_10064218 Ga0070717_100642182 161
172 3300006173 Ga0070716_100117678 Ga0070716_1001176782 161
173 3300006175 Ga0070712_100894674 Ga0070712_1008946741 161
174 3300006175 Ga0070712_101121770 Ga0070712_1011217701 161
175 3300006844 Ga0075428_100060560 Ga0075428_1000605604 161
176 3300006844 Ga0075428_100316927 Ga0075428_1003169272 161
177 3300006846 Ga0075430_100033278 Ga0075430_1000332783 161
178 3300006847 Ga0075431_100016240 Ga0075431_1000162403 161
179 3300006847 Ga0075431_100047948 Ga0075431_1000479483 161
180 3300006852 Ga0075433_10026230 Ga0075433_100262303 161
181 3300006871 Ga0075434_100273290 Ga0075434_1002732902 161
182 3300006871 Ga0075434_100868685 Ga0075434_1008686852 161
183 3300006880 Ga0075429_100141020 Ga0075429_1001410202 161
184 3300006880 Ga0075429_100157523 Ga0075429_1001575232 161
185 3300007076 Ga0075435_100072662 Ga0075435_1000726623 161
186 3300007076 Ga0075435_101232732 Ga0075435_1012327321 161
187 3300009011 Ga0105251_10052654 Ga0105251_100526542 161
188 3300009093 Ga0105240_10690082 Ga0105240_106900822 161
189 3300009094 Ga0111539_10220842 Ga0111539_102208422 161
190 3300009101 Ga0105247_10010871 Ga0105247_100108713 161
191 3300009101 Ga0105247_10068387 Ga0105247_100683872 161
192 3300009147 Ga0114129_10042823 Ga0114129_100428232 161
193 3300009147 Ga0114129_10077442 Ga0114129_100774423 161
194 3300009148 Ga0105243_10505157 Ga0105243_105051572 161
195 3300009148 Ga0105243_12414682 Ga0105243_124146821 161
196 3300009174 Ga0105241_10683636 Ga0105241_106836362 161
197 3300009177 Ga0105248_10002926 Ga0105248_1000292619 161
198 3300009177 Ga0105248_10260777 Ga0105248_102607772 161
199 3300009177 Ga0105248_10366110 Ga0105248_103661102 161
200 3300009551 Ga0105238_10519926 Ga0105238_105199262 161
201 3300009553 Ga0105249_10001189 Ga0105249_1000118923 161
202 3300010375 Ga0105239_10701976 Ga0105239_107019762 161
203 3300010375 Ga0105239_11807558 Ga0105239_118075581 161
204 3300011119 Ga0105246_11082982 Ga0105246_110829821 161
205 3300013306 Ga0163162_10662633 Ga0163162_106626332 161
206 3300014325 Ga0163163_10010034 Ga0163163_100100349 161
207 3300014325 Ga0163163_10022050 Ga0163163_100220502 161
208 3300014326 Ga0157380_10251187 Ga0157380_102511872 161
209 3300014968 Ga0157379_10005817 Ga0157379_100058174 161
210 3300014968 Ga0157379_10100223 Ga0157379_101002232 161
211 3300025315 Ga0207697_10128368 Ga0207697_101283682 161
212 3300025898 Ga0207692_10426633 Ga0207692_104266332 161
213 3300025900 Ga0207710_10004642 Ga0207710_100046424 161
214 3300025905 Ga0207685_10091381 Ga0207685_100913812 161
215 3300025906 Ga0207699_10166694 Ga0207699_101666943 161
216 3300025906 Ga0207699_10420624 Ga0207699_104206242 161
217 3300025912 Ga0207707_10323488 Ga0207707_103234882 161
218 3300025912 Ga0207707_10583847 Ga0207707_105838472 161
219 3300025915 Ga0207693_10559790 Ga0207693_105597902 161
220 3300025917 Ga0207660_10070688 Ga0207660_100706882 161
221 3300025917 Ga0207660_10104025 Ga0207660_101040252 161
222 3300025919 Ga0207657_10031590 Ga0207657_100315903 161
223 3300025920 Ga0207649_10312992 Ga0207649_103129922 161
224 3300025921 Ga0207652_10018925 Ga0207652_100189253 161
225 3300025921 Ga0207652_10746898 Ga0207652_107468982 161
226 3300025922 Ga0207646_11117823 Ga0207646_111178232 161
227 3300025922 Ga0207646_11466181 Ga0207646_114661811 161
228 3300025923 Ga0207681_10003121 Ga0207681_100031214 161
229 3300025923 Ga0207681_10201022 Ga0207681_102010222 161
230 3300025924 Ga0207694_10379926 Ga0207694_103799262 161
231 3300025926 Ga0207659_10368812 Ga0207659_103688121 161
232 3300025928 Ga0207700_10008345 Ga0207700_100083456 161
233 3300025932 Ga0207690_10309947 Ga0207690_103099472 161
234 3300025932 Ga0207690_10567846 Ga0207690_105678462 161
235 3300025933 Ga0207706_10144639 Ga0207706_101446392 161
236 3300025933 Ga0207706_10348743 Ga0207706_103487432 161
237 3300025935 Ga0207709_10835945 Ga0207709_108359452 161
238 3300025938 Ga0207704_10348950 Ga0207704_103489502 161
239 3300025939 Ga0207665_10285383 Ga0207665_102853831 161
240 3300025941 Ga0207711_10661511 Ga0207711_106615111 161
241 3300025945 Ga0207679_10090586 Ga0207679_100905863 161
242 3300025945 Ga0207679_10177072 Ga0207679_101770722 161
243 3300025949 Ga0207667_10009099 Ga0207667_1000909910 161
244 3300025949 Ga0207667_10413336 Ga0207667_104133362 161
245 3300025961 Ga0207712_10127104 Ga0207712_101271042 161
246 3300025961 Ga0207712_10349216 Ga0207712_103492162 161
247 3300025961 Ga0207712_10924861 Ga0207712_109248611 161
248 3300025972 Ga0207668_10749206 Ga0207668_107492062 161
249 3300026035 Ga0207703_10023896 Ga0207703_100238963 161
250 3300026035 Ga0207703_10666245 Ga0207703_106662451 161
251 3300026041 Ga0207639_10509150 Ga0207639_105091502 161
252 3300026095 Ga0207676_10706588 Ga0207676_107065882 161
253 3300026116 Ga0207674_10025110 Ga0207674_100251103 161
254 3300026116 Ga0207674_10136535 Ga0207674_101365352 161
255 3300026118 Ga0207675_100449555 Ga0207675_1004495552 161
256 3300027907 Ga0207428_10060191 Ga0207428_100601912 161
257 3300028379 Ga0268266_10175315 Ga0268266_101753152 161
258 3300028380 Ga0268265_10010459 Ga0268265_100104595 161
259 3300028380 Ga0268265_10351733 Ga0268265_103517333 161
260 3300028381 Ga0268264_10400061 Ga0268264_104000612 161
261 3300028381 Ga0268264_10846659 Ga0268264_108466592 161
262 3300031548 Ga0307408_101119854 Ga0307408_1011198542 161
263 3300031995 Ga0307409_100224447 Ga0307409_1002244472 161
264 3300032005 Ga0307411_10897495 Ga0307411_108974951 161
265 3300035119 Ga0373956_0260952 Ga0373956_0260952_305_793 161
266 3300035170 Ga0373943_0000587 Ga0373943_0000587_14026_14514 161
267 3300035410 Ga0373924_0013327 Ga0373924_0013327_629_1117 161
268 3300035691 Ga0373931_0456314 Ga0373931_0456314_53_565 161
269 3300035692 Ga0373935_0012449 Ga0373935_0012449_1377_1865 161
270 3300035695 Ga0373927_0222835 Ga0373927_0222835_291_779 161
271 3300035725 Ga0373947_0000839 Ga0373947_0000839_6992_7480 161
272 3300036401 Ga0373937_0195391 Ga0373937_0195391_335_820 161
273 3300036647 Ga0316582_0102882 Ga0316582_0102882_449_937 161
274 3300037068 Ga0373925_0003817 Ga0373925_0003817_8993_9481 161
275 3300038735 Ga0400485_10511 Ga0400485_10511_8160_8645 161
276 3300038741 Ga0400488_25044 Ga0400488_25044_73_558 161
277 3300038742 Ga0400486_30854 Ga0400486_30854_2762_3247 161
278 3300039093 Ga0400489_36589 Ga0400489_36589_5449_5934 161
279 3300039110 Ga0400487_34922 Ga0400487_34922_15242_15727 161
280 3300041410 Ga0439461_0011147 Ga0439461_0011147_778_1281 161
281 3300041999 Ga0439433_0039154 Ga0439433_0039154_571_1074 161
282 3300042004 Ga0439445_0176357 Ga0439445_0176357_56_559 161
283 3300042007 Ga0439449_0117194 Ga0439449_0117194_445_948 161
284 3300042011 Ga0439454_005973 Ga0439454_005973_137_640 161
285 3300042435 Ga0439434_0023085 Ga0439434_0023085_1290_1793 161
286 3300042876 Ga0451577_0027233 Ga0451577_0027233_319_822 161
287 3300044712 Ga0453684_0780281 Ga0453684_0780281_61_564 161
288 3300046454 Ga0495592_0378425 Ga0495592_0378425_196_681 161
289 3300046455 Ga0495603_0303166 Ga0495603_0303166_151_642 161
290 3300046462 Ga0495651_0340567 Ga0495651_0340567_261_746 161
291 3300046511 Ga0495608_0094793 Ga0495608_0094793_107_592 161
292 3300046514 Ga0495618_0464382 Ga0495618_0464382_120_605 161
293 3300046516 Ga0495628_0386405 Ga0495628_0386405_271_756 161
294 3300046528 Ga0495642_0167177 Ga0495642_0167177_190_681 161
295 3300046528 Ga0495642_0328297 Ga0495642_0328297_86_592 161
296 3300046533 Ga0495640_0556631 Ga0495640_0556631_83_574 161
297 3300046535 Ga0495586_0280028 Ga0495586_0280028_143_628 161
298 3300046678 Ga0495599_0072930 Ga0495599_0072930_458_946 161
299 3300046678 Ga0495599_0212389 Ga0495599_0212389_642_1127 161
300 3300047317 Ga0495604_0057611 Ga0495604_0057611_934_1419 161
301 3300047319 Ga0495674_0379046 Ga0495674_0379046_576_1061 161
302 3300047322 Ga0495680_0401071 Ga0495680_0401071_250_735 161
303 3300048905 Ga0496102_0326291 Ga0496102_0326291_940_1431 161
304 3300048905 Ga0496102_0582132 Ga0496102_0582132_332_835 161
305 3300048906 Ga0496103_0652345 Ga0496103_0652345_129_632 161
306 3300048907 Ga0496104_0107517 Ga0496104_0107517_1772_2260 161
307 3300048911 Ga0496108_0011048 Ga0496108_0011048_5596_6084 161
308 3300048911 Ga0496108_0184912 Ga0496108_0184912_318_803 161
309 3300048912 Ga0496109_1068544 Ga0496109_1068544_189_674 161
310 3300048914 Ga0496111_0263475 Ga0496111_0263475_276_764 161
311 3300048915 Ga0496112_0086542 Ga0496112_0086542_677_1165 161
312 3300048915 Ga0496112_1114963 Ga0496112_1114963_26_517 161
313 3300048915 Ga0496112_1587022 Ga0496112_1587022_37_528 161
314 3300048917 Ga0496114_0397652 Ga0496114_0397652_40_537 161
315 3300049570 Ga0501033_0322619 Ga0501033_0322619_519_1022 161
316 3300049571 Ga0501034_0127536 Ga0501034_0127536_1242_1736 161
317 3300049572 Ga0501036_0035839 Ga0501036_0035839_2992_3495 161
318 3300049573 Ga0501037_0339919 Ga0501037_0339919_508_1002 161
319 3300049574 Ga0501038_0366265 Ga0501038_0366265_165_659 161
320 3300049577 Ga0501041_0163082 Ga0501041_0163082_858_1361 161
321 3300049578 Ga0501042_0435937 Ga0501042_0435937_303_806 161
322 3300049578 Ga0501042_0646003 Ga0501042_0646003_38_523 161
323 3300049579 Ga0501043_0181977 Ga0501043_0181977_903_1397 161
324 3300049581 Ga0501047_0046383 Ga0501047_0046383_1649_2143 161
325 3300049587 Ga0501071_0421341 Ga0501071_0421341_172_675 161
326 3300049588 Ga0501072_0257484 Ga0501072_0257484_715_1218 161
327 3300049589 Ga0501073_0285310 Ga0501073_0285310_61_564 161
328 3300049591 Ga0501075_0015987 Ga0501075_0015987_1539_2042 161
329 3300049591 Ga0501075_0199422 Ga0501075_0199422_334_837 161
330 3300049592 Ga0501076_0025220 Ga0501076_0025220_1136_1639 161
331 3300049741 Ga0501079_0340193 Ga0501079_0340193_58_561 161
332 3300049742 Ga0501080_0063036 Ga0501080_0063036_665_1168 161
333 3300049742 Ga0501080_0588049 Ga0501080_0588049_76_579 161
334 3300049743 Ga0501081_0050507 Ga0501081_0050507_1429_1932 161
335 3300049822 Ga0501035_0470510 Ga0501035_0470510_464_967 161
336 3300049823 Ga0501044_0024597 Ga0501044_0024597_3348_3842 161
337 3300049824 Ga0501045_0083334 Ga0501045_0083334_152_655 161
338 3300050507 nmdc:mga05p37_117604_c1 nmdc:mga05p37_117604_c1_2161_2664 161
339 3300050507 nmdc:mga05p37_7125_c1 nmdc:mga05p37_7125_c1_5529_6056 161
340 3300050508 nmdc:mga09592_140784_c1 nmdc:mga09592_140784_c1_1257_1760 161
341 3300050508 nmdc:mga09592_283813_c1 nmdc:mga09592_283813_c1_283_786 161
342 3300050509 nmdc:mga0qj67_144533_c1 nmdc:mga0qj67_144533_c1_337_840 161
343 3300050510 nmdc:mga06r32_20786_c1 nmdc:mga06r32_20786_c1_4697_5200 161
344 3300050510 nmdc:mga06r32_65986_c1 nmdc:mga06r32_65986_c1_1324_1827 161
345 3300050511 nmdc:mga08y16_186124_c1 nmdc:mga08y16_186124_c1_1346_1849 161
346 3300050511 nmdc:mga08y16_40617_c1 nmdc:mga08y16_40617_c1_968_1471 161
347 3300050512 nmdc:mga0n895_123088_c1 nmdc:mga0n895_123088_c1_1034_1519 161
348 3300050512 nmdc:mga0n895_166712_c1 nmdc:mga0n895_166712_c1_286_789 161
349 3300050512 nmdc:mga0n895_961802_c1 nmdc:mga0n895_961802_c1_225_728 161
350 3300050515 nmdc:mga0a205_25306_c1 nmdc:mga0a205_25306_c1_3664_4167 161
351 3300053077 Ga0495601_0118253 Ga0495601_0118253_996_1481 161
352 3300053078 Ga0495612_0180998 Ga0495612_0180998_406_894 161
353 3300053129 Ga0500628_058510 Ga0500628_058510_14_499 161
354 3300005293 Ga0065715_10949294 Ga0065715_109492941 162
355 3300005364 Ga0070673_100799038 Ga0070673_1007990382 162
356 3300005438 Ga0070701_10224384 Ga0070701_102243842 162
357 3300005548 Ga0070665_100462537 Ga0070665_1004625371 162
358 3300005843 Ga0068860_101635902 Ga0068860_1016359021 162
359 3300006178 Ga0075367_10034089 Ga0075367_100340893 162
360 3300006195 Ga0075366_10250608 Ga0075366_102506082 162
361 3300006237 Ga0097621_100673271 Ga0097621_1006732712 162
362 3300006871 Ga0075434_100024773 Ga0075434_1000247732 162
363 3300006914 Ga0075436_100122921 Ga0075436_1001229212 162
364 3300007076 Ga0075435_100051016 Ga0075435_1000510162 162
365 3300009553 Ga0105249_10265080 Ga0105249_102650802 162
366 3300010375 Ga0105239_12153638 Ga0105239_121536381 162
367 3300025912 Ga0207707_10447358 Ga0207707_104473582 162
368 3300025916 Ga0207663_10467043 Ga0207663_104670431 162
369 3300028380 Ga0268265_11363259 Ga0268265_113632592 162
370 3300031665 Ga0316575_10000035 Ga0316575_1000003529 162
371 3300031665 Ga0316575_10000389 Ga0316575_100003899 162
372 3300031665 Ga0316575_10009884 Ga0316575_100098843 162
373 3300031665 Ga0316575_10051071 Ga0316575_100510712 162
374 3300031665 Ga0316575_10110746 Ga0316575_101107461 162
375 3300031665 Ga0316575_10241777 Ga0316575_102417772 162
376 3300031691 Ga0316579_10000957 Ga0316579_100009572 162
377 3300031691 Ga0316579_10001214 Ga0316579_100012149 162
378 3300031691 Ga0316579_10003017 Ga0316579_100030173 162
379 3300031691 Ga0316579_10015725 Ga0316579_100157252 162
380 3300031691 Ga0316579_10031056 Ga0316579_100310564 162
381 3300031727 Ga0316576_10000046 Ga0316576_1000004621 162
382 3300031727 Ga0316576_10019400 Ga0316576_100194006 162
383 3300031727 Ga0316576_10025025 Ga0316576_100250254 162
384 3300031727 Ga0316576_10035360 Ga0316576_100353604 162
385 3300031727 Ga0316576_10140119 Ga0316576_101401193 162
386 3300031727 Ga0316576_10147999 Ga0316576_101479994 162
387 3300031727 Ga0316576_10173861 Ga0316576_101738613 162
388 3300031727 Ga0316576_10262882 Ga0316576_102628822 162
389 3300031727 Ga0316576_10396128 Ga0316576_103961282 162
390 3300031727 Ga0316576_10570479 Ga0316576_105704792 162
391 3300031727 Ga0316576_10633020 Ga0316576_106330202 162
392 3300031727 Ga0316576_10649650 Ga0316576_106496501 162
393 3300031727 Ga0316576_10736988 Ga0316576_107369882 162
394 3300031727 Ga0316576_10890620 Ga0316576_108906202 162
395 3300031728 Ga0316578_10000655 Ga0316578_100006554 162
396 3300031728 Ga0316578_10011920 Ga0316578_100119204 162
397 3300031728 Ga0316578_10014047 Ga0316578_100140476 162
398 3300031728 Ga0316578_10041677 Ga0316578_100416772 162
399 3300031728 Ga0316578_10052157 Ga0316578_100521572 162
400 3300031728 Ga0316578_10145635 Ga0316578_101456352 162
401 3300031728 Ga0316578_10149855 Ga0316578_101498553 162
402 3300031728 Ga0316578_10285871 Ga0316578_102858711 162
403 3300031728 Ga0316578_10509657 Ga0316578_105096571 162
404 3300031728 Ga0316578_10610440 Ga0316578_106104401 162
405 3300031733 Ga0316577_10047642 Ga0316577_100476422 162
406 3300031733 Ga0316577_10089362 Ga0316577_100893622 162
407 3300031733 Ga0316577_10109267 Ga0316577_101092672 162
408 3300031733 Ga0316577_10149983 Ga0316577_101499832 162
409 3300032133 Ga0316583_10000182 Ga0316583_100001828 162
410 3300032133 Ga0316583_10001812 Ga0316583_100018125 162
411 3300032133 Ga0316583_10001854 Ga0316583_100018546 162
412 3300032133 Ga0316583_10005415 Ga0316583_100054152 162
413 3300032133 Ga0316583_10009721 Ga0316583_100097213 162
414 3300032133 Ga0316583_10023089 Ga0316583_100230892 162
415 3300032133 Ga0316583_10030002 Ga0316583_100300023 162
416 3300032133 Ga0316583_10072408 Ga0316583_100724083 162
417 3300032137 Ga0316585_10000030 Ga0316585_100000305 162
418 3300032137 Ga0316585_10001618 Ga0316585_100016184 162
419 3300032137 Ga0316585_10002641 Ga0316585_100026416 162
420 3300032137 Ga0316585_10012291 Ga0316585_100122914 162
421 3300032139 Ga0316580_10000056 Ga0316580_1000005621 162
422 3300032139 Ga0316580_10006824 Ga0316580_100068244 162
423 3300032139 Ga0316580_10029294 Ga0316580_100292942 162
424 3300032139 Ga0316580_10038867 Ga0316580_100388672 162
425 3300033524 Ga0316592_1009087 Ga0316592_10090874 162
426 3300033524 Ga0316592_1020412 Ga0316592_10204121 162
427 3300033541 Ga0316596_1022872 Ga0316596_10228722 162
428 3300033541 Ga0316596_1042629 Ga0316596_10426292 162
429 3300033541 Ga0316596_1045808 Ga0316596_10458083 162
430 3300035398 Ga0316574_0000522 Ga0316574_0000522_5811_6299 162
431 3300035398 Ga0316574_0002176 Ga0316574_0002176_2951_3448 162
432 3300035398 Ga0316574_0014587 Ga0316574_0014587_482_988 162
433 3300035398 Ga0316574_0105245 Ga0316574_0105245_118_609 162
434 3300035398 Ga0316574_0245932 Ga0316574_0245932_323_814 162
435 3300035398 Ga0316574_0469679 Ga0316574_0469679_48_536 162
436 3300036647 Ga0316582_0000428 Ga0316582_0000428_8881_9369 162
437 3300036647 Ga0316582_0002614 Ga0316582_0002614_2022_2528 162
438 3300036647 Ga0316582_0003700 Ga0316582_0003700_4444_4956 162
439 3300036647 Ga0316582_0057783 Ga0316582_0057783_918_1430 162
440 3300036647 Ga0316582_0177996 Ga0316582_0177996_229_726 162
441 3300036647 Ga0316582_0238321 Ga0316582_0238321_719_1207 162
442 3300036647 Ga0316582_0252809 Ga0316582_0252809_317_808 162
443 3300036647 Ga0316582_0342740 Ga0316582_0342740_389_886 162
444 3300036712 Ga0316584_0003414 Ga0316584_0003414_7214_7720 162
445 3300036712 Ga0316584_0016916 Ga0316584_0016916_2135_2623 162
446 3300036712 Ga0316584_0054179 Ga0316584_0054179_1026_1517 162
447 3300036712 Ga0316584_0091429 Ga0316584_0091429_355_852 162
448 3300036712 Ga0316584_0246277 Ga0316584_0246277_132_620 162
449 3300036712 Ga0316584_0331456 Ga0316584_0331456_430_921 162
450 3300036712 Ga0316584_0503591 Ga0316584_0503591_298_810 162
451 3300037588 Ga0316581_0004584 Ga0316581_0004584_2606_3118 162
452 3300038726 Ga0400490_29105 Ga0400490_29105_259_771 162
453 3300038726 Ga0400490_29447 Ga0400490_29447_310_804 162
454 3300038735 Ga0400485_12953 Ga0400485_12953_6325_6816 162
455 3300038741 Ga0400488_09257 Ga0400488_09257_988_1479 162
456 3300038741 Ga0400488_20927 Ga0400488_20927_3936_4427 162
457 3300038741 Ga0400488_61560 Ga0400488_61560_4807_5298 162
458 3300038742 Ga0400486_25600 Ga0400486_25600_8770_9261 162
459 3300039062 Ga0400483_010828 Ga0400483_010828_11258_11749 162
460 3300039062 Ga0400483_016329 Ga0400483_016329_1087_1575 162
461 3300039062 Ga0400483_035847 Ga0400483_035847_2695_3198 162
462 3300039062 Ga0400483_167725 Ga0400483_167725_772_1260 162
463 3300039062 Ga0400483_255949 Ga0400483_255949_445_933 162
464 3300039110 Ga0400487_28190 Ga0400487_28190_194_685 162
465 3300042876 Ga0451577_0728998 Ga0451577_0728998_16_513 162
466 3300044673 Ga0453683_0476983 Ga0453683_0476983_191_694 162
467 3300044712 Ga0453684_0550832 Ga0453684_0550832_739_1236 162
468 3300050507 nmdc:mga05p37_934570_c1 nmdc:mga05p37_934570_c1_320_814 162
469 3300050512 nmdc:mga0n895_206331_c1 nmdc:mga0n895_206331_c1_715_1203 162
470 3300050514 nmdc:mga08x19_21369_c1 nmdc:mga08x19_21369_c1_2217_2705 162
471 3300050515 nmdc:mga0a205_741249_c1 nmdc:mga0a205_741249_c1_211_699 162
472 3300005455 Ga0070663_100939935 Ga0070663_1009399352 163
473 3300006846 Ga0075430_100180754 Ga0075430_1001807542 163
474 3300006880 Ga0075429_100253869 Ga0075429_1002538692 163
475 3300031995 Ga0307409_101105587 Ga0307409_1011055871 163
476 3300041999 Ga0439433_0002782 Ga0439433_0002782_577_1101 163
477 3300042015 Ga0439462_0032086 Ga0439462_0032086_347_871 163
478 3300045051 Ga0451576_0217196 Ga0451576_0217196_429_932 163
479 3300049591 Ga0501075_0272398 Ga0501075_0272398_718_1227 163
480 3300049822 Ga0501035_0282968 Ga0501035_0282968_305_796 163
481 3300049824 Ga0501045_0847667 Ga0501045_0847667_135_644 163
482 3300050510 nmdc:mga06r32_446280_c1 nmdc:mga06r32_446280_c1_422_931 163
483 3300060353 Ga0501082_0404475 Ga0501082_0404475_284_778 163
484 3300006163 Ga0070715_10096971 Ga0070715_100969712 164
485 3300026075 Ga0207708_10439024 Ga0207708_104390242 164
486 3300031733 Ga0316577_10003406 Ga0316577_100034067 164
487 3300032002 Ga0307416_101239182 Ga0307416_1012391821 164
488 3300046454 Ga0495592_0149168 Ga0495592_0149168_636_1130 164
489 3300047320 Ga0495672_0024901 Ga0495672_0024901_301_798 164
490 3300047322 Ga0495680_0130196 Ga0495680_0130196_235_729 164
491 3300049742 Ga0501080_1203404 Ga0501080_1203404_20_550 164
492 3300053103 Ga0500555_000372 Ga0500555_000372_14503_14997 164
493 3300053116 Ga0500592_040023 Ga0500592_040023_237_731 164
494 3300053139 Ga0500568_0003417 Ga0500568_0003417_6903_7400 164
495 3300053153 Ga0500616_0002270 Ga0500616_0002270_5380_5874 164
496 3300053731 Ga0500609_047236 Ga0500609_047236_19_513 164
497 3300059424 Ga0590075_027686 Ga0590075_027686_246_776 164
498 3300059426 Ga0590077_076776 Ga0590077_076776_126_656 164
499 3300005367 Ga0070667_100480464 Ga0070667_1004804642 165
500 3300005457 Ga0070662_100054119 Ga0070662_1000541193 165
501 3300005466 Ga0070685_10736612 Ga0070685_107366122 165
502 3300005539 Ga0068853_100489001 Ga0068853_1004890011 165
503 3300005564 Ga0070664_100030898 Ga0070664_1000308985 165
504 3300005616 Ga0068852_100076611 Ga0068852_1000766113 165
505 3300005842 Ga0068858_100235042 Ga0068858_1002350422 165
506 3300006195 Ga0075366_10553156 Ga0075366_105531562 165
507 3300006237 Ga0097621_100041740 Ga0097621_1000417402 165
508 3300006358 Ga0068871_100109118 Ga0068871_1001091183 165
509 3300006844 Ga0075428_101181011 Ga0075428_1011810112 165
510 3300006846 Ga0075430_100134791 Ga0075430_1001347913 165
511 3300006847 Ga0075431_100558505 Ga0075431_1005585052 165
512 3300006881 Ga0068865_100162246 Ga0068865_1001622461 165
513 3300009147 Ga0114129_10849020 Ga0114129_108490202 165
514 3300009148 Ga0105243_10098573 Ga0105243_100985733 165
515 3300009176 Ga0105242_10139317 Ga0105242_101393173 165
516 3300009176 Ga0105242_10329383 Ga0105242_103293832 165
517 3300009176 Ga0105242_11450394 Ga0105242_114503942 165
518 3300009177 Ga0105248_10467242 Ga0105248_104672422 165
519 3300009177 Ga0105248_11453137 Ga0105248_114531372 165
520 3300010375 Ga0105239_10350821 Ga0105239_103508213 165
521 3300013297 Ga0157378_10800102 Ga0157378_108001022 165
522 3300013306 Ga0163162_11929475 Ga0163162_119294752 165
523 3300013307 Ga0157372_12149589 Ga0157372_121495892 165
524 3300014968 Ga0157379_10474634 Ga0157379_104746342 165
525 3300017792 Ga0163161_10020936 Ga0163161_100209365 165
526 3300025903 Ga0207680_10995913 Ga0207680_109959131 165
527 3300025907 Ga0207645_10017428 Ga0207645_100174283 165
528 3300025911 Ga0207654_10263843 Ga0207654_102638432 165
529 3300025925 Ga0207650_10108818 Ga0207650_101088183 165
530 3300025933 Ga0207706_10089304 Ga0207706_100893042 165
531 3300025934 Ga0207686_10555384 Ga0207686_105553842 165
532 3300025935 Ga0207709_10150320 Ga0207709_101503202 165
533 3300025938 Ga0207704_10326423 Ga0207704_103264232 165
534 3300025938 Ga0207704_10745405 Ga0207704_107454051 165
535 3300025940 Ga0207691_10142021 Ga0207691_101420212 165
536 3300025944 Ga0207661_10218080 Ga0207661_102180802 165
537 3300025986 Ga0207658_11030391 Ga0207658_110303912 165
538 3300026023 Ga0207677_10095799 Ga0207677_100957992 165
539 3300026088 Ga0207641_10199963 Ga0207641_101999632 165
540 3300026089 Ga0207648_10080772 Ga0207648_100807722 165
541 3300026095 Ga0207676_11920204 Ga0207676_119202041 165
542 3300026121 Ga0207683_10239430 Ga0207683_102394302 165
543 3300026142 Ga0207698_10214635 Ga0207698_102146353 165
544 3300028381 Ga0268264_10871185 Ga0268264_108711852 165
545 3300031344 Ga0265316_10120765 Ga0265316_101207653 165
546 3300031665 Ga0316575_10176569 Ga0316575_101765691 165
547 3300031728 Ga0316578_10036238 Ga0316578_100362382 165
548 3300032137 Ga0316585_10043724 Ga0316585_100437241 165
549 3300036647 Ga0316582_0001511 Ga0316582_0001511_7309_7815 165
550 3300036647 Ga0316582_0032367 Ga0316582_0032367_951_1457 165
551 3300036647 Ga0316582_0256018 Ga0316582_0256018_490_996 165
552 3300036647 Ga0316582_0430475 Ga0316582_0430475_45_554 165
553 3300036712 Ga0316584_0046916 Ga0316584_0046916_145_651 165
554 3300036712 Ga0316584_0097107 Ga0316584_0097107_69_578 165
555 3300036712 Ga0316584_0254697 Ga0316584_0254697_467_973 165
556 3300037588 Ga0316581_0057481 Ga0316581_0057481_677_1183 165
557 3300039062 Ga0400483_034219 Ga0400483_034219_6739_7239 165
558 3300048903 Ga0496100_0532047 Ga0496100_0532047_246_743 165
559 3300048904 Ga0496101_0316482 Ga0496101_0316482_494_991 165
560 3300048909 Ga0496106_0521570 Ga0496106_0521570_152_649 165
561 3300048911 Ga0496108_0197696 Ga0496108_0197696_1130_1627 165
562 3300048912 Ga0496109_0218451 Ga0496109_0218451_349_846 165
563 3300048914 Ga0496111_0133642 Ga0496111_0133642_1283_1780 165
564 3300048917 Ga0496114_0008895 Ga0496114_0008895_4047_4544 165
565 3300048917 Ga0496114_0099260 Ga0496114_0099260_730_1227 165
566 3300048918 Ga0496115_0086623 Ga0496115_0086623_721_1218 165
567 3300048918 Ga0496115_0461975 Ga0496115_0461975_461_958 165
568 3300049824 Ga0501045_0495946 Ga0501045_0495946_22_552 165
569 3300050491 nmdc:mga00v17_214036_c1 nmdc:mga00v17_214036_c1_164_679 165
570 3300050493 nmdc:mga0k408_62255_c1 nmdc:mga0k408_62255_c1_16_516 165
571 3300050507 nmdc:mga05p37_1134093_c1 nmdc:mga05p37_1134093_c1_96_629 165
572 3300050510 nmdc:mga06r32_288005_c1 nmdc:mga06r32_288005_c1_791_1324 165
573 3300054114 Ga0501084_0086510 Ga0501084_0086510_1506_2036 165
574 3300060353 Ga0501082_0461451 Ga0501082_0461451_27_557 165
575 3300005293 Ga0065715_10144946 Ga0065715_101449462 166
576 3300005293 Ga0065715_10227519 Ga0065715_102275191 166
577 3300005441 Ga0070700_100290856 Ga0070700_1002908562 166
578 3300009177 Ga0105248_11669217 Ga0105248_116692172 166
579 3300025941 Ga0207711_10412483 Ga0207711_104124832 166
580 3300026075 Ga0207708_10210300 Ga0207708_102103002 166
581 3300038727 Ga0400491_29415 Ga0400491_29415_2438_2971 166
582 3300042184 Ga0450908_001456 Ga0450908_001456_88_621 166
583 3300049588 Ga0501072_0492218 Ga0501072_0492218_18_551 166
584 3300050510 nmdc:mga06r32_484667_c1 nmdc:mga06r32_484667_c1_379_912 166
585 3300054114 Ga0501084_0156341 Ga0501084_0156341_1196_1729 166
586 3300039062 Ga0400483_061632 Ga0400483_061632_7744_8310 168
587 3300044712 Ga0453684_0445850 Ga0453684_0445850_611_1183 168
588 3300005293 Ga0065715_10502506 Ga0065715_105025062 169
589 3300005295 Ga0065707_10106345 Ga0065707_101063452 169
590 3300025933 Ga0207706_11077868 Ga0207706_110778681 169
591 3300037471 Ga0395905_0110478 Ga0395905_0110478_1167_1682 169
592 3300042012 Ga0439455_0061706 Ga0439455_0061706_96_611 169
593 3300042439 Ga0439464_0003729 Ga0439464_0003729_169_684 169
594 3300005518 Ga0070699_101137803 Ga0070699_1011378031 171
595 3300005549 Ga0070704_100492093 Ga0070704_1004920932 171
596 3300014326 Ga0157380_12255688 Ga0157380_122556881 171
597 3300028380 Ga0268265_10957356 Ga0268265_109573562 171
598 3300042122 Ga0450920_048126 Ga0450920_048126_132_647 171
599 3300042131 Ga0450894_005829 Ga0450894_005829_161_676 171
600 3300042133 Ga0450896_001951 Ga0450896_001951_1304_1819 171
601 3300042531 Ga0450918_016535 Ga0450918_016535_459_974 171
602 2162886011 MRS1b_contig_5547123 MRS1b_0334.00001900 172
603 3300005293 Ga0065715_10005160 Ga0065715_100051603 172
604 3300005331 Ga0070670_100008752 Ga0070670_1000087525 172
605 3300005353 Ga0070669_100081037 Ga0070669_1000810372 172
606 3300005354 Ga0070675_100033155 Ga0070675_1000331553 172
607 3300005355 Ga0070671_100728976 Ga0070671_1007289762 172
608 3300005356 Ga0070674_100107356 Ga0070674_1001073562 172
609 3300005365 Ga0070688_100018132 Ga0070688_1000181324 172
610 3300005459 Ga0068867_100430239 Ga0068867_1004302392 172
611 3300005466 Ga0070685_10076878 Ga0070685_100768782 172
612 3300005543 Ga0070672_100003964 Ga0070672_1000039643 172
613 3300005544 Ga0070686_100058831 Ga0070686_1000588312 172
614 3300005548 Ga0070665_100076194 Ga0070665_1000761943 172
615 3300005564 Ga0070664_100861406 Ga0070664_1008614062 172
616 3300005618 Ga0068864_100008813 Ga0068864_1000088134 172
617 3300005719 Ga0068861_100185407 Ga0068861_1001854073 172
618 3300005840 Ga0068870_10216016 Ga0068870_102160162 172
619 3300005843 Ga0068860_100165429 Ga0068860_1001654292 172
620 3300006237 Ga0097621_100382798 Ga0097621_1003827982 172
621 3300006358 Ga0068871_100254285 Ga0068871_1002542853 172
622 3300009098 Ga0105245_10269974 Ga0105245_102699742 172
623 3300009176 Ga0105242_10148776 Ga0105242_101487763 172
624 3300009177 Ga0105248_10014811 Ga0105248_100148112 172
625 3300009545 Ga0105237_11214851 Ga0105237_112148512 172
626 3300009553 Ga0105249_10016809 Ga0105249_100168095 172
627 3300010375 Ga0105239_10609676 Ga0105239_106096762 172
628 3300013306 Ga0163162_10062145 Ga0163162_100621453 172
629 3300013308 Ga0157375_11171752 Ga0157375_111717522 172
630 3300025899 Ga0207642_10032915 Ga0207642_100329152 172
631 3300025908 Ga0207643_10033609 Ga0207643_100336093 172
632 3300025923 Ga0207681_10735088 Ga0207681_107350882 172
633 3300025925 Ga0207650_10134031 Ga0207650_101340312 172
634 3300025926 Ga0207659_10004392 Ga0207659_100043929 172
635 3300025931 Ga0207644_10077512 Ga0207644_100775123 172
636 3300025934 Ga0207686_10403801 Ga0207686_104038011 172
637 3300025940 Ga0207691_10008714 Ga0207691_1000871410 172
638 3300025941 Ga0207711_10089417 Ga0207711_100894173 172
639 3300025945 Ga0207679_10092276 Ga0207679_100922762 172
640 3300025961 Ga0207712_10948692 Ga0207712_109486922 172
641 3300026089 Ga0207648_10348635 Ga0207648_103486352 172
642 3300026095 Ga0207676_10134202 Ga0207676_101342023 172
643 3300026118 Ga0207675_100242896 Ga0207675_1002428963 172
644 3300026121 Ga0207683_10080735 Ga0207683_100807352 172
645 3300028379 Ga0268266_10063251 Ga0268266_100632513 172
646 3300048904 Ga0496101_0243653 Ga0496101_0243653_864_1382 172
647 3300048907 Ga0496104_0006688 Ga0496104_0006688_8076_8594 172
648 3300048908 Ga0496105_0064903 Ga0496105_0064903_1030_1548 172
649 3300048909 Ga0496106_0284405 Ga0496106_0284405_110_628 172
650 3300048909 Ga0496106_0940108 Ga0496106_0940108_84_602 172
651 3300048912 Ga0496109_0020083 Ga0496109_0020083_1484_2002 172
652 3300048915 Ga0496112_0033300 Ga0496112_0033300_531_1049 172
653 3300048916 Ga0496113_0057491 Ga0496113_0057491_2238_2756 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

11

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9891 10 163
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9851 10 164
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9799 10 163
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9788 9 163
1qjc-assembly1.cif.gz_B phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine 0.9775 10 163
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9851 10 164 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9686 10 161 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9617 10 163 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9617 8 163 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9587 9 163 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A317HKL8-F1-model_v4 Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) 0.99 9 165 GO:0004595
GO:0005737
GO:0015937
AF-A0A3R6UXW5-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9899 10 161 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2H1XZY7-F1-model_v4 deleted 0.9885 10 157
AF-A0A0R1T341-F1-model_v4 deleted 0.9878 10 163
AF-B1WS35-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9876 11 163 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
91.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map