F472776
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 653 | 310 | 650 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_101239182|Ga0307416_1012391821 |
| Length | 190 |
| Sequence | MPSSQPPHVAVFPGSFDPLTSGHVDIIERGRYIFDKVIVAVLINRTKVPLFTTDERVAMIREVFRDQADVEVDTFDGLLVEYAAHKGAHALIRGLRAVSDFEYEFQMAAMNRRLDASVDTVFLMASESQQFISSRFVKEIARLGGDISPFVSPRVAQHVRQAIARGGEAAKPDDDGVGTTMPAPAGRKPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 3 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 4 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 154 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 158 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 159 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 163 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 164 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 165 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 185 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 186 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 187 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 188 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 189 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 190 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 191 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 192 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 193 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 194 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 195 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 196 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 197 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 198 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 199 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 202 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 203 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 204 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 205 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 206 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 207 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 210 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 213 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 303 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 304 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 306 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 309 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.77 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.99 |
| Nodule | 0 |
| Rhizoplane | 4.59 |
| Rhizosphere | 89.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_5547123 | 2162886011 | Bacteria | 913 |
| 2 | Ga0065712_10022087 | 3300005290 | Unclassified | 1547 |
| 3 | Ga0065712_10126316 | 3300005290 | Bacteria | 1603 |
| 4 | Ga0065712_10188467 | 3300005290 | Bacteria | 1159 |
| 5 | Ga0065715_10005160 | 3300005293 | Bacteria | 3544 |
| 6 | Ga0065715_10144946 | 3300005293 | Bacteria | 1801 |
| 7 | Ga0065715_10227519 | 3300005293 | Bacteria | 1238 |
| 8 | Ga0065715_10235947 | 3300005293 | Bacteria | 1217 |
| 9 | Ga0065715_10346250 | 3300005293 | Bacteria | 958 |
| 10 | Ga0065715_10502506 | 3300005293 | Bacteria | 778 |
| 11 | Ga0065715_10508785 | 3300005293 | Unclassified | 762 |
| 12 | Ga0065715_10949294 | 3300005293 | Bacteria | 560 |
| 13 | Ga0065707_10000711 | 3300005295 | Bacteria | 16357 |
| 14 | Ga0065707_10106345 | 3300005295 | Bacteria | 2600 |
| 15 | Ga0065707_10113287 | 3300005295 | Bacteria | 2333 |
| 16 | Ga0070670_100003718 | 3300005331 | Bacteria | 12699 |
| 17 | Ga0070670_100008752 | 3300005331 | Bacteria | 8644 |
| 18 | Ga0070677_10110750 | 3300005333 | Bacteria | 1225 |
| 19 | Ga0070660_100007604 | 3300005339 | Bacteria | 7552 |
| 20 | Ga0070669_100007815 | 3300005353 | Bacteria | 7642 |
| 21 | Ga0070669_100076401 | 3300005353 | Bacteria | 2486 |
| 22 | Ga0070669_100081037 | 3300005353 | Bacteria | 2417 |
| 23 | Ga0070669_100295257 | 3300005353 | Bacteria | 1302 |
| 24 | Ga0070675_100024928 | 3300005354 | Bacteria | 4794 |
| 25 | Ga0070675_100033155 | 3300005354 | Bacteria | 4185 |
| 26 | Ga0070675_100207374 | 3300005354 | Bacteria | 1703 |
| 27 | Ga0070675_100243452 | 3300005354 | Bacteria | 1572 |
| 28 | Ga0070675_100337905 | 3300005354 | Bacteria | 1333 |
| 29 | Ga0070671_100728976 | 3300005355 | Bacteria | 861 |
| 30 | Ga0070674_100107356 | 3300005356 | Bacteria | 2044 |
| 31 | Ga0070673_100581056 | 3300005364 | Bacteria | 1020 |
| 32 | Ga0070673_100799038 | 3300005364 | Bacteria | 871 |
| 33 | Ga0070688_100018132 | 3300005365 | Bacteria | 4056 |
| 34 | Ga0070659_100198953 | 3300005366 | Bacteria | 1649 |
| 35 | Ga0070667_100308307 | 3300005367 | Bacteria | 1426 |
| 36 | Ga0070667_100480464 | 3300005367 | Bacteria | 1137 |
| 37 | Ga0070667_100650899 | 3300005367 | Bacteria | 973 |
| 38 | Ga0070703_10079911 | 3300005406 | Bacteria | 1111 |
| 39 | Ga0070709_10257787 | 3300005434 | Bacteria | 1259 |
| 40 | Ga0070714_100071785 | 3300005435 | Bacteria | 2995 |
| 41 | Ga0070713_100004167 | 3300005436 | Bacteria | 9646 |
| 42 | Ga0070713_100546882 | 3300005436 | Bacteria | 1096 |
| 43 | Ga0070710_10256412 | 3300005437 | Bacteria | 1126 |
| 44 | Ga0070701_10224384 | 3300005438 | Bacteria | 1122 |
| 45 | Ga0070711_101051916 | 3300005439 | Bacteria | 700 |
| 46 | Ga0070705_100452019 | 3300005440 | Bacteria | 964 |
| 47 | Ga0070700_100290856 | 3300005441 | Bacteria | 1189 |
| 48 | Ga0070663_100939935 | 3300005455 | Bacteria | 749 |
| 49 | Ga0070662_100054119 | 3300005457 | Bacteria | 2908 |
| 50 | Ga0070662_100447266 | 3300005457 | Bacteria | 1072 |
| 51 | Ga0070681_10101934 | 3300005458 | Bacteria | 2815 |
| 52 | Ga0070681_10150160 | 3300005458 | Bacteria | 2257 |
| 53 | Ga0068867_100430239 | 3300005459 | Bacteria | 1120 |
| 54 | Ga0070685_10076878 | 3300005466 | Bacteria | 1992 |
| 55 | Ga0070685_10736612 | 3300005466 | Bacteria | 722 |
| 56 | Ga0070699_101137803 | 3300005518 | Bacteria | 716 |
| 57 | Ga0070679_100033557 | 3300005530 | Bacteria | 5082 |
| 58 | Ga0070679_100070971 | 3300005530 | Bacteria | 3474 |
| 59 | Ga0070679_100596072 | 3300005530 | Unclassified | 1048 |
| 60 | Ga0070684_100555217 | 3300005535 | Bacteria | 1066 |
| 61 | Ga0070684_100953268 | 3300005535 | Bacteria | 805 |
| 62 | Ga0068853_100489001 | 3300005539 | Unclassified | 1161 |
| 63 | Ga0070672_100003964 | 3300005543 | Bacteria | 9654 |
| 64 | Ga0070672_100209788 | 3300005543 | Bacteria | 1631 |
| 65 | Ga0070686_100058831 | 3300005544 | Bacteria | 2474 |
| 66 | Ga0070695_100401599 | 3300005545 | Bacteria | 1039 |
| 67 | Ga0070696_100433236 | 3300005546 | Bacteria | 1035 |
| 68 | Ga0070665_100076194 | 3300005548 | Bacteria | 3361 |
| 69 | Ga0070665_100159829 | 3300005548 | Bacteria | 2255 |
| 70 | Ga0070665_100462537 | 3300005548 | Archaea | 1279 |
| 71 | Ga0070704_100492093 | 3300005549 | Bacteria | 1063 |
| 72 | Ga0070704_100574194 | 3300005549 | Bacteria | 988 |
| 73 | Ga0068855_100010055 | 3300005563 | Bacteria | 11402 |
| 74 | Ga0068855_100731020 | 3300005563 | Bacteria | 1057 |
| 75 | Ga0070664_100030898 | 3300005564 | Bacteria | 4471 |
| 76 | Ga0070664_100264778 | 3300005564 | Bacteria | 1547 |
| 77 | Ga0070664_100861406 | 3300005564 | Bacteria | 849 |
| 78 | Ga0068857_100010719 | 3300005577 | Bacteria | 7976 |
| 79 | Ga0068852_100076611 | 3300005616 | Bacteria | 2953 |
| 80 | Ga0068864_100008813 | 3300005618 | Bacteria | 8317 |
| 81 | Ga0068864_100121533 | 3300005618 | Bacteria | 2335 |
| 82 | Ga0068864_101789605 | 3300005618 | Bacteria | 619 |
| 83 | Ga0068861_100185407 | 3300005719 | Bacteria | 1735 |
| 84 | Ga0068870_10216016 | 3300005840 | Bacteria | 1171 |
| 85 | Ga0068858_100050154 | 3300005842 | Bacteria | 3863 |
| 86 | Ga0068858_100235042 | 3300005842 | Bacteria | 1738 |
| 87 | Ga0068860_100165429 | 3300005843 | Bacteria | 2135 |
| 88 | Ga0068860_100401680 | 3300005843 | Bacteria | 1356 |
| 89 | Ga0068860_101267610 | 3300005843 | Bacteria | 758 |
| 90 | Ga0068860_101635902 | 3300005843 | Bacteria | 666 |
| 91 | Ga0068862_100034975 | 3300005844 | Bacteria | 4252 |
| 92 | Ga0068862_100535767 | 3300005844 | Bacteria | 1116 |
| 93 | Ga0068862_101462950 | 3300005844 | Bacteria | 688 |
| 94 | Ga0081455_10118733 | 3300005937 | Bacteria | 2087 |
| 95 | Ga0070717_10064218 | 3300006028 | Bacteria | 3049 |
| 96 | Ga0070715_10096971 | 3300006163 | Bacteria | 1368 |
| 97 | Ga0070716_100117678 | 3300006173 | Bacteria | 1658 |
| 98 | Ga0070712_100894674 | 3300006175 | Bacteria | 765 |
| 99 | Ga0070712_101121770 | 3300006175 | Bacteria | 683 |
| 100 | Ga0075367_10034089 | 3300006178 | Bacteria | 2938 |
| 101 | Ga0075367_10211489 | 3300006178 | Bacteria | 1213 |
| 102 | Ga0075366_10250608 | 3300006195 | Bacteria | 1080 |
| 103 | Ga0075366_10553156 | 3300006195 | Bacteria | 713 |
| 104 | Ga0097621_100041740 | 3300006237 | Bacteria | 3694 |
| 105 | Ga0097621_100382798 | 3300006237 | Bacteria | 1257 |
| 106 | Ga0097621_100673271 | 3300006237 | Bacteria | 951 |
| 107 | Ga0068871_100109118 | 3300006358 | Bacteria | 2326 |
| 108 | Ga0068871_100254285 | 3300006358 | Bacteria | 1531 |
| 109 | Ga0068871_100529985 | 3300006358 | Bacteria | 1065 |
| 110 | Ga0075428_100000010 | 3300006844 | Bacteria | 213631 |
| 111 | Ga0075428_100060560 | 3300006844 | Bacteria | 4145 |
| 112 | Ga0075428_100316927 | 3300006844 | Bacteria | 1676 |
| 113 | Ga0075428_101181011 | 3300006844 | Bacteria | 807 |
| 114 | Ga0075430_100033278 | 3300006846 | Bacteria | 4375 |
| 115 | Ga0075430_100134791 | 3300006846 | Bacteria | 2058 |
| 116 | Ga0075430_100180754 | 3300006846 | Bacteria | 1754 |
| 117 | Ga0075431_100016240 | 3300006847 | Bacteria | 7553 |
| 118 | Ga0075431_100047948 | 3300006847 | Bacteria | 4406 |
| 119 | Ga0075431_100140965 | 3300006847 | Bacteria | 2485 |
| 120 | Ga0075431_100558505 | 3300006847 | Bacteria | 1132 |
| 121 | Ga0075433_10026230 | 3300006852 | Bacteria | 4932 |
| 122 | Ga0075433_10094811 | 3300006852 | Bacteria | 2641 |
| 123 | Ga0075434_100024773 | 3300006871 | Bacteria | 5866 |
| 124 | Ga0075434_100273290 | 3300006871 | Bacteria | 1709 |
| 125 | Ga0075434_100868685 | 3300006871 | Bacteria | 917 |
| 126 | Ga0075429_100141020 | 3300006880 | Bacteria | 2110 |
| 127 | Ga0075429_100157523 | 3300006880 | Bacteria | 1988 |
| 128 | Ga0075429_100253869 | 3300006880 | Bacteria | 1540 |
| 129 | Ga0068865_100162246 | 3300006881 | Bacteria | 1706 |
| 130 | Ga0075436_100122921 | 3300006914 | Bacteria | 1817 |
| 131 | Ga0075435_100051016 | 3300007076 | Bacteria | 3331 |
| 132 | Ga0075435_100072662 | 3300007076 | Bacteria | 2810 |
| 133 | Ga0075435_101232732 | 3300007076 | Bacteria | 655 |
| 134 | Ga0105251_10052654 | 3300009011 | Bacteria | 1937 |
| 135 | Ga0105240_10211148 | 3300009093 | Bacteria | 2268 |
| 136 | Ga0105240_10690082 | 3300009093 | Bacteria | 1115 |
| 137 | Ga0111539_10000001 | 3300009094 | Bacteria | 1035431 |
| 138 | Ga0111539_10220842 | 3300009094 | Bacteria | 2207 |
| 139 | Ga0105245_10269974 | 3300009098 | Bacteria | 1659 |
| 140 | Ga0105247_10010871 | 3300009101 | Bacteria | 5499 |
| 141 | Ga0105247_10046659 | 3300009101 | Bacteria | 2660 |
| 142 | Ga0105247_10068387 | 3300009101 | Bacteria | 2215 |
| 143 | Ga0114129_10008349 | 3300009147 | Bacteria | 14765 |
| 144 | Ga0114129_10042823 | 3300009147 | Bacteria | 6371 |
| 145 | Ga0114129_10077442 | 3300009147 | Bacteria | 4625 |
| 146 | Ga0114129_10849020 | 3300009147 | Unclassified | 1161 |
| 147 | Ga0105243_10098573 | 3300009148 | Bacteria | 2421 |
| 148 | Ga0105243_10505157 | 3300009148 | Bacteria | 1146 |
| 149 | Ga0105243_12414682 | 3300009148 | Bacteria | 564 |
| 150 | Ga0105241_10683636 | 3300009174 | Bacteria | 935 |
| 151 | Ga0105242_10139317 | 3300009176 | Bacteria | 2103 |
| 152 | Ga0105242_10148776 | 3300009176 | Bacteria | 2040 |
| 153 | Ga0105242_10329383 | 3300009176 | Bacteria | 1403 |
| 154 | Ga0105242_10887331 | 3300009176 | Bacteria | 890 |
| 155 | Ga0105242_11450394 | 3300009176 | Unclassified | 715 |
| 156 | Ga0105248_10002926 | 3300009177 | Bacteria | 18953 |
| 157 | Ga0105248_10014811 | 3300009177 | Bacteria | 8590 |
| 158 | Ga0105248_10232301 | 3300009177 | Bacteria | 2076 |
| 159 | Ga0105248_10260777 | 3300009177 | Bacteria | 1951 |
| 160 | Ga0105248_10366110 | 3300009177 | Bacteria | 1623 |
| 161 | Ga0105248_10467242 | 3300009177 | Bacteria | 1422 |
| 162 | Ga0105248_11453137 | 3300009177 | Unclassified | 776 |
| 163 | Ga0105248_11669217 | 3300009177 | Bacteria | 722 |
| 164 | Ga0105237_11214851 | 3300009545 | Bacteria | 760 |
| 165 | Ga0105238_10519926 | 3300009551 | Bacteria | 1193 |
| 166 | Ga0105249_10001189 | 3300009553 | Bacteria | 22992 |
| 167 | Ga0105249_10016809 | 3300009553 | Bacteria | 6491 |
| 168 | Ga0105249_10089504 | 3300009553 | Bacteria | 2876 |
| 169 | Ga0105249_10265080 | 3300009553 | Bacteria | 1709 |
| 170 | Ga0105239_10350821 | 3300010375 | Bacteria | 1666 |
| 171 | Ga0105239_10609676 | 3300010375 | Bacteria | 1245 |
| 172 | Ga0105239_10701976 | 3300010375 | Bacteria | 1157 |
| 173 | Ga0105239_11807558 | 3300010375 | Bacteria | 708 |
| 174 | Ga0105239_12153638 | 3300010375 | Bacteria | 648 |
| 175 | Ga0105246_11082982 | 3300011119 | Bacteria | 731 |
| 176 | Ga0157378_10015911 | 3300013297 | Bacteria | 6587 |
| 177 | Ga0157378_10129721 | 3300013297 | Bacteria | 2333 |
| 178 | Ga0157378_10800102 | 3300013297 | Bacteria | 968 |
| 179 | Ga0163162_10062145 | 3300013306 | Bacteria | 3775 |
| 180 | Ga0163162_10662633 | 3300013306 | Bacteria | 1167 |
| 181 | Ga0163162_11929475 | 3300013306 | Bacteria | 676 |
| 182 | Ga0157372_12149589 | 3300013307 | Bacteria | 641 |
| 183 | Ga0157375_10659836 | 3300013308 | Bacteria | 1202 |
| 184 | Ga0157375_11171752 | 3300013308 | Bacteria | 901 |
| 185 | Ga0163163_10010034 | 3300014325 | Bacteria | 8496 |
| 186 | Ga0163163_10022050 | 3300014325 | Bacteria | 6022 |
| 187 | Ga0157380_10024634 | 3300014326 | Bacteria | 4556 |
| 188 | Ga0157380_10136005 | 3300014326 | Bacteria | 2104 |
| 189 | Ga0157380_10145526 | 3300014326 | Bacteria | 2042 |
| 190 | Ga0157380_10251187 | 3300014326 | Bacteria | 1601 |
| 191 | Ga0157380_12255688 | 3300014326 | Bacteria | 609 |
| 192 | Ga0157379_10005817 | 3300014968 | Bacteria | 10602 |
| 193 | Ga0157379_10100223 | 3300014968 | Bacteria | 2600 |
| 194 | Ga0157379_10474634 | 3300014968 | Bacteria | 1157 |
| 195 | Ga0157376_10665930 | 3300014969 | Bacteria | 1043 |
| 196 | Ga0163161_10020936 | 3300017792 | Bacteria | 4595 |
| 197 | Ga0207697_10128368 | 3300025315 | Bacteria | 1095 |
| 198 | Ga0207653_10083380 | 3300025885 | Bacteria | 1110 |
| 199 | Ga0207692_10426633 | 3300025898 | Bacteria | 831 |
| 200 | Ga0207642_10032915 | 3300025899 | Bacteria | 2188 |
| 201 | Ga0207710_10004642 | 3300025900 | Bacteria | 5964 |
| 202 | Ga0207710_10032468 | 3300025900 | Bacteria | 2286 |
| 203 | Ga0207680_10995913 | 3300025903 | Bacteria | 600 |
| 204 | Ga0207685_10091381 | 3300025905 | Bacteria | 1282 |
| 205 | Ga0207699_10166694 | 3300025906 | Bacteria | 1471 |
| 206 | Ga0207699_10420624 | 3300025906 | Bacteria | 954 |
| 207 | Ga0207645_10017428 | 3300025907 | Bacteria | 4740 |
| 208 | Ga0207643_10033609 | 3300025908 | Bacteria | 2870 |
| 209 | Ga0207654_10263843 | 3300025911 | Bacteria | 1159 |
| 210 | Ga0207707_10323488 | 3300025912 | Bacteria | 1331 |
| 211 | Ga0207707_10447358 | 3300025912 | Bacteria | 1106 |
| 212 | Ga0207707_10583847 | 3300025912 | Bacteria | 947 |
| 213 | Ga0207695_10479453 | 3300025913 | Bacteria | 1126 |
| 214 | Ga0207693_10559790 | 3300025915 | Bacteria | 891 |
| 215 | Ga0207663_10467043 | 3300025916 | Bacteria | 975 |
| 216 | Ga0207660_10070688 | 3300025917 | Bacteria | 2538 |
| 217 | Ga0207660_10104025 | 3300025917 | Bacteria | 2125 |
| 218 | Ga0207657_10031590 | 3300025919 | Bacteria | 4795 |
| 219 | Ga0207649_10312992 | 3300025920 | Bacteria | 1151 |
| 220 | Ga0207652_10018925 | 3300025921 | Bacteria | 5654 |
| 221 | Ga0207652_10746898 | 3300025921 | Bacteria | 871 |
| 222 | Ga0207646_11117823 | 3300025922 | Bacteria | 693 |
| 223 | Ga0207646_11466181 | 3300025922 | Bacteria | 592 |
| 224 | Ga0207681_10003121 | 3300025923 | Bacteria | 10423 |
| 225 | Ga0207681_10201022 | 3300025923 | Bacteria | 1530 |
| 226 | Ga0207681_10274900 | 3300025923 | Bacteria | 1324 |
| 227 | Ga0207681_10735088 | 3300025923 | Bacteria | 822 |
| 228 | Ga0207694_10379926 | 3300025924 | Bacteria | 1172 |
| 229 | Ga0207650_10108818 | 3300025925 | Bacteria | 2143 |
| 230 | Ga0207650_10134031 | 3300025925 | Bacteria | 1941 |
| 231 | Ga0207650_10514985 | 3300025925 | Bacteria | 1001 |
| 232 | Ga0207659_10004392 | 3300025926 | Bacteria | 8521 |
| 233 | Ga0207659_10220753 | 3300025926 | Unclassified | 1524 |
| 234 | Ga0207659_10297299 | 3300025926 | Bacteria | 1325 |
| 235 | Ga0207659_10299936 | 3300025926 | Bacteria | 1319 |
| 236 | Ga0207659_10368812 | 3300025926 | Unclassified | 1195 |
| 237 | Ga0207700_10008345 | 3300025928 | Bacteria | 6411 |
| 238 | Ga0207700_10112583 | 3300025928 | Bacteria | 2192 |
| 239 | Ga0207664_10377825 | 3300025929 | Bacteria | 1257 |
| 240 | Ga0207644_10077512 | 3300025931 | Bacteria | 2448 |
| 241 | Ga0207690_10309947 | 3300025932 | Bacteria | 1238 |
| 242 | Ga0207690_10567846 | 3300025932 | Bacteria | 924 |
| 243 | Ga0207706_10089304 | 3300025933 | Bacteria | 2709 |
| 244 | Ga0207706_10144639 | 3300025933 | Bacteria | 2092 |
| 245 | Ga0207706_10348743 | 3300025933 | Bacteria | 1287 |
| 246 | Ga0207706_11077868 | 3300025933 | Unclassified | 672 |
| 247 | Ga0207686_10403801 | 3300025934 | Bacteria | 1041 |
| 248 | Ga0207686_10555384 | 3300025934 | Bacteria | 898 |
| 249 | Ga0207709_10150320 | 3300025935 | Bacteria | 1612 |
| 250 | Ga0207709_10835945 | 3300025935 | Bacteria | 745 |
| 251 | Ga0207704_10326423 | 3300025938 | Bacteria | 1186 |
| 252 | Ga0207704_10348950 | 3300025938 | Bacteria | 1151 |
| 253 | Ga0207704_10745405 | 3300025938 | Unclassified | 814 |
| 254 | Ga0207665_10285383 | 3300025939 | Bacteria | 1230 |
| 255 | Ga0207691_10008714 | 3300025940 | Bacteria | 9728 |
| 256 | Ga0207691_10142021 | 3300025940 | Bacteria | 2115 |
| 257 | Ga0207691_10279983 | 3300025940 | Bacteria | 1435 |
| 258 | Ga0207711_10089417 | 3300025941 | Bacteria | 2706 |
| 259 | Ga0207711_10412483 | 3300025941 | Bacteria | 1256 |
| 260 | Ga0207711_10661511 | 3300025941 | Bacteria | 974 |
| 261 | Ga0207661_10218080 | 3300025944 | Bacteria | 1685 |
| 262 | Ga0207679_10090586 | 3300025945 | Bacteria | 2365 |
| 263 | Ga0207679_10092276 | 3300025945 | Bacteria | 2346 |
| 264 | Ga0207679_10177072 | 3300025945 | Bacteria | 1761 |
| 265 | Ga0207667_10009099 | 3300025949 | Bacteria | 11739 |
| 266 | Ga0207667_10413336 | 3300025949 | Bacteria | 1373 |
| 267 | Ga0207712_10127104 | 3300025961 | Bacteria | 1937 |
| 268 | Ga0207712_10202195 | 3300025961 | Bacteria | 1576 |
| 269 | Ga0207712_10349216 | 3300025961 | Bacteria | 1229 |
| 270 | Ga0207712_10924861 | 3300025961 | Bacteria | 772 |
| 271 | Ga0207712_10948692 | 3300025961 | Bacteria | 762 |
| 272 | Ga0207668_10749206 | 3300025972 | Bacteria | 862 |
| 273 | Ga0207658_11030391 | 3300025986 | Bacteria | 751 |
| 274 | Ga0207677_10095799 | 3300026023 | Bacteria | 2170 |
| 275 | Ga0207703_10023896 | 3300026035 | Bacteria | 4806 |
| 276 | Ga0207703_10666245 | 3300026035 | Bacteria | 988 |
| 277 | Ga0207639_10509150 | 3300026041 | Bacteria | 1101 |
| 278 | Ga0207708_10210300 | 3300026075 | Bacteria | 1555 |
| 279 | Ga0207708_10439024 | 3300026075 | Bacteria | 1085 |
| 280 | Ga0207641_10199963 | 3300026088 | Bacteria | 1842 |
| 281 | Ga0207648_10080772 | 3300026089 | Bacteria | 2836 |
| 282 | Ga0207648_10348635 | 3300026089 | Bacteria | 1334 |
| 283 | Ga0207676_10134202 | 3300026095 | Bacteria | 2109 |
| 284 | Ga0207676_10706588 | 3300026095 | Bacteria | 977 |
| 285 | Ga0207676_11920204 | 3300026095 | Bacteria | 591 |
| 286 | Ga0207674_10025110 | 3300026116 | Bacteria | 6358 |
| 287 | Ga0207674_10136535 | 3300026116 | Bacteria | 2414 |
| 288 | Ga0207675_100242896 | 3300026118 | Bacteria | 1740 |
| 289 | Ga0207675_100449555 | 3300026118 | Bacteria | 1277 |
| 290 | Ga0207683_10080735 | 3300026121 | Bacteria | 2885 |
| 291 | Ga0207683_10231999 | 3300026121 | Bacteria | 1683 |
| 292 | Ga0207683_10239430 | 3300026121 | Bacteria | 1655 |
| 293 | Ga0207698_10214635 | 3300026142 | Bacteria | 1734 |
| 294 | Ga0207428_10000002 | 3300027907 | Bacteria | 854851 |
| 295 | Ga0207428_10060191 | 3300027907 | Bacteria | 3009 |
| 296 | Ga0268266_10063251 | 3300028379 | Bacteria | 3195 |
| 297 | Ga0268266_10175315 | 3300028379 | Bacteria | 1949 |
| 298 | Ga0268265_10010459 | 3300028380 | Bacteria | 6267 |
| 299 | Ga0268265_10351733 | 3300028380 | Bacteria | 1346 |
| 300 | Ga0268265_10957356 | 3300028380 | Bacteria | 844 |
| 301 | Ga0268265_11363259 | 3300028380 | Bacteria | 711 |
| 302 | Ga0268264_10400061 | 3300028381 | Bacteria | 1319 |
| 303 | Ga0268264_10846659 | 3300028381 | Bacteria | 916 |
| 304 | Ga0268264_10871185 | 3300028381 | Bacteria | 903 |
| 305 | Ga0265316_10120765 | 3300031344 | Bacteria | 1979 |
| 306 | Ga0307408_101119854 | 3300031548 | Bacteria | 731 |
| 307 | Ga0316575_10000035 | 3300031665 | Bacteria | 32977 |
| 308 | Ga0316575_10000389 | 3300031665 | Bacteria | 12533 |
| 309 | Ga0316575_10009884 | 3300031665 | Bacteria | 3497 |
| 310 | Ga0316575_10051071 | 3300031665 | Bacteria | 1646 |
| 311 | Ga0316575_10110746 | 3300031665 | Bacteria | 1120 |
| 312 | Ga0316575_10176569 | 3300031665 | Bacteria | 886 |
| 313 | Ga0316575_10241777 | 3300031665 | Bacteria | 756 |
| 314 | Ga0316579_10000957 | 3300031691 | Bacteria | 10106 |
| 315 | Ga0316579_10001214 | 3300031691 | Bacteria | 9247 |
| 316 | Ga0316579_10003017 | 3300031691 | Bacteria | 6472 |
| 317 | Ga0316579_10015725 | 3300031691 | Bacteria | 3291 |
| 318 | Ga0316579_10031056 | 3300031691 | Bacteria | 2443 |
| 319 | Ga0265314_10022431 | 3300031711 | Bacteria | 4836 |
| 320 | Ga0316576_10000046 | 3300031727 | Bacteria | 37895 |
| 321 | Ga0316576_10004420 | 3300031727 | Bacteria | 8423 |
| 322 | Ga0316576_10009067 | 3300031727 | Bacteria | 6401 |
| 323 | Ga0316576_10019400 | 3300031727 | Unclassified | 4659 |
| 324 | Ga0316576_10025025 | 3300031727 | Bacteria | 4175 |
| 325 | Ga0316576_10035360 | 3300031727 | Bacteria | 3565 |
| 326 | Ga0316576_10071072 | 3300031727 | Bacteria | 2567 |
| 327 | Ga0316576_10084356 | 3300031727 | Bacteria | 2361 |
| 328 | Ga0316576_10140119 | 3300031727 | Bacteria | 1821 |
| 329 | Ga0316576_10147999 | 3300031727 | Bacteria | 1769 |
| 330 | Ga0316576_10173861 | 3300031727 | Bacteria | 1625 |
| 331 | Ga0316576_10262882 | 3300031727 | Bacteria | 1294 |
| 332 | Ga0316576_10396128 | 3300031727 | Bacteria | 1023 |
| 333 | Ga0316576_10570479 | 3300031727 | Bacteria | 828 |
| 334 | Ga0316576_10633020 | 3300031727 | Bacteria | 779 |
| 335 | Ga0316576_10649650 | 3300031727 | Bacteria | 767 |
| 336 | Ga0316576_10736988 | 3300031727 | Bacteria | 712 |
| 337 | Ga0316576_10890620 | 3300031727 | Bacteria | 638 |
| 338 | Ga0316578_10000655 | 3300031728 | Bacteria | 12269 |
| 339 | Ga0316578_10011920 | 3300031728 | Bacteria | 4568 |
| 340 | Ga0316578_10014047 | 3300031728 | Bacteria | 4264 |
| 341 | Ga0316578_10036238 | 3300031728 | Bacteria | 2839 |
| 342 | Ga0316578_10041677 | 3300031728 | Bacteria | 2659 |
| 343 | Ga0316578_10052157 | 3300031728 | Bacteria | 2396 |
| 344 | Ga0316578_10145635 | 3300031728 | Bacteria | 1427 |
| 345 | Ga0316578_10149855 | 3300031728 | Bacteria | 1405 |
| 346 | Ga0316578_10285871 | 3300031728 | Bacteria | 987 |
| 347 | Ga0316578_10509657 | 3300031728 | Bacteria | 708 |
| 348 | Ga0316578_10610440 | 3300031728 | Bacteria | 639 |
| 349 | Ga0316577_10003406 | 3300031733 | Bacteria | 8025 |
| 350 | Ga0316577_10047642 | 3300031733 | Bacteria | 2393 |
| 351 | Ga0316577_10089362 | 3300031733 | Bacteria | 1724 |
| 352 | Ga0316577_10109267 | 3300031733 | Bacteria | 1551 |
| 353 | Ga0316577_10149983 | 3300031733 | Bacteria | 1314 |
| 354 | Ga0307409_100224447 | 3300031995 | Bacteria | 1698 |
| 355 | Ga0307409_101105587 | 3300031995 | Bacteria | 814 |
| 356 | Ga0307416_100620234 | 3300032002 | Bacteria | 1163 |
| 357 | Ga0307416_101239182 | 3300032002 | Bacteria | 852 |
| 358 | Ga0307411_10897495 | 3300032005 | Unclassified | 787 |
| 359 | Ga0316583_10000182 | 3300032133 | Bacteria | 16037 |
| 360 | Ga0316583_10001812 | 3300032133 | Bacteria | 7272 |
| 361 | Ga0316583_10001854 | 3300032133 | Bacteria | 7200 |
| 362 | Ga0316583_10005415 | 3300032133 | Bacteria | 4581 |
| 363 | Ga0316583_10009721 | 3300032133 | Bacteria | 3466 |
| 364 | Ga0316583_10023089 | 3300032133 | Bacteria | 2224 |
| 365 | Ga0316583_10030002 | 3300032133 | Bacteria | 1936 |
| 366 | Ga0316583_10072408 | 3300032133 | Bacteria | 1205 |
| 367 | Ga0316585_10000030 | 3300032137 | Bacteria | 21335 |
| 368 | Ga0316585_10001618 | 3300032137 | Bacteria | 5970 |
| 369 | Ga0316585_10002641 | 3300032137 | Bacteria | 4855 |
| 370 | Ga0316585_10012291 | 3300032137 | Bacteria | 2534 |
| 371 | Ga0316585_10043724 | 3300032137 | Bacteria | 1430 |
| 372 | Ga0316580_10000056 | 3300032139 | Bacteria | 18370 |
| 373 | Ga0316580_10006824 | 3300032139 | Bacteria | 3380 |
| 374 | Ga0316580_10029294 | 3300032139 | Bacteria | 1703 |
| 375 | Ga0316580_10038867 | 3300032139 | Bacteria | 1470 |
| 376 | Ga0316592_1009087 | 3300033524 | Bacteria | 1983 |
| 377 | Ga0316592_1020412 | 3300033524 | Bacteria | 1407 |
| 378 | Ga0316596_1022872 | 3300033541 | Bacteria | 1599 |
| 379 | Ga0316596_1042629 | 3300033541 | Bacteria | 1194 |
| 380 | Ga0316596_1045808 | 3300033541 | Bacteria | 1154 |
| 381 | Ga0373934_0257531 | 3300035086 | Bacteria | 722 |
| 382 | Ga0373945_0194463 | 3300035116 | Bacteria | 840 |
| 383 | Ga0373956_0117696 | 3300035119 | Bacteria | 1240 |
| 384 | Ga0373956_0260952 | 3300035119 | Bacteria | 824 |
| 385 | Ga0373957_0142310 | 3300035120 | Bacteria | 981 |
| 386 | Ga0373943_0000587 | 3300035170 | Bacteria | 15773 |
| 387 | Ga0316574_0000522 | 3300035398 | Bacteria | 15704 |
| 388 | Ga0316574_0002176 | 3300035398 | Bacteria | 9716 |
| 389 | Ga0316574_0014587 | 3300035398 | Bacteria | 4542 |
| 390 | Ga0316574_0105245 | 3300035398 | Unclassified | 1807 |
| 391 | Ga0316574_0245932 | 3300035398 | Bacteria | 1143 |
| 392 | Ga0316574_0469679 | 3300035398 | Bacteria | 787 |
| 393 | Ga0373924_0013327 | 3300035410 | Bacteria | 3087 |
| 394 | Ga0373931_0456314 | 3300035691 | Bacteria | 818 |
| 395 | Ga0373935_0012449 | 3300035692 | Bacteria | 5118 |
| 396 | Ga0373927_0222835 | 3300035695 | Bacteria | 1239 |
| 397 | Ga0373933_0292283 | 3300035724 | Bacteria | 1054 |
| 398 | Ga0373947_0000839 | 3300035725 | Bacteria | 18556 |
| 399 | Ga0373937_0195391 | 3300036401 | Bacteria | 1901 |
| 400 | Ga0373937_1484627 | 3300036401 | Bacteria | 625 |
| 401 | Ga0316582_0000428 | 3300036647 | Bacteria | 15432 |
| 402 | Ga0316582_0001511 | 3300036647 | Bacteria | 10280 |
| 403 | Ga0316582_0002614 | 3300036647 | Bacteria | 8531 |
| 404 | Ga0316582_0003700 | 3300036647 | Bacteria | 7565 |
| 405 | Ga0316582_0032367 | 3300036647 | Bacteria | 3203 |
| 406 | Ga0316582_0057783 | 3300036647 | Bacteria | 2479 |
| 407 | Ga0316582_0102882 | 3300036647 | Bacteria | 1894 |
| 408 | Ga0316582_0177996 | 3300036647 | Bacteria | 1446 |
| 409 | Ga0316582_0188772 | 3300036647 | Bacteria | 1404 |
| 410 | Ga0316582_0238321 | 3300036647 | Bacteria | 1246 |
| 411 | Ga0316582_0252809 | 3300036647 | Unclassified | 1208 |
| 412 | Ga0316582_0256018 | 3300036647 | Bacteria | 1200 |
| 413 | Ga0316582_0342740 | 3300036647 | Bacteria | 1028 |
| 414 | Ga0316582_0430475 | 3300036647 | Bacteria | 909 |
| 415 | Ga0316584_0003414 | 3300036712 | Bacteria | 10306 |
| 416 | Ga0316584_0016916 | 3300036712 | Bacteria | 5232 |
| 417 | Ga0316584_0046916 | 3300036712 | Bacteria | 3226 |
| 418 | Ga0316584_0054179 | 3300036712 | Bacteria | 3002 |
| 419 | Ga0316584_0091429 | 3300036712 | Bacteria | 2278 |
| 420 | Ga0316584_0097107 | 3300036712 | Bacteria | 2206 |
| 421 | Ga0316584_0246277 | 3300036712 | Bacteria | 1307 |
| 422 | Ga0316584_0254697 | 3300036712 | Bacteria | 1281 |
| 423 | Ga0316584_0331456 | 3300036712 | Bacteria | 1096 |
| 424 | Ga0316584_0503591 | 3300036712 | Bacteria | 850 |
| 425 | Ga0373925_0003817 | 3300037068 | Bacteria | 11563 |
| 426 | Ga0373925_0433612 | 3300037068 | Bacteria | 1075 |
| 427 | Ga0395905_0110478 | 3300037471 | Bacteria | 2582 |
| 428 | Ga0316581_0004584 | 3300037588 | Bacteria | 3535 |
| 429 | Ga0316581_0057481 | 3300037588 | Bacteria | 1193 |
| 430 | Ga0400490_29105 | 3300038726 | Bacteria | 1049 |
| 431 | Ga0400490_29447 | 3300038726 | Bacteria | 1168 |
| 432 | Ga0400491_29415 | 3300038727 | Bacteria | 5139 |
| 433 | Ga0400485_10511 | 3300038735 | Bacteria | 11370 |
| 434 | Ga0400485_12953 | 3300038735 | Bacteria | 10256 |
| 435 | Ga0400488_09257 | 3300038741 | Bacteria | 1717 |
| 436 | Ga0400488_20927 | 3300038741 | Bacteria | 10957 |
| 437 | Ga0400488_25044 | 3300038741 | Bacteria | 1299 |
| 438 | Ga0400488_61560 | 3300038741 | Bacteria | 6519 |
| 439 | Ga0400486_25600 | 3300038742 | Bacteria | 31060 |
| 440 | Ga0400486_30854 | 3300038742 | Bacteria | 55977 |
| 441 | Ga0400483_010828 | 3300039062 | Bacteria | 25274 |
| 442 | Ga0400483_016329 | 3300039062 | Bacteria | 2882 |
| 443 | Ga0400483_034219 | 3300039062 | Bacteria | 29338 |
| 444 | Ga0400483_035847 | 3300039062 | Bacteria | 3306 |
| 445 | Ga0400483_061632 | 3300039062 | Bacteria | 9058 |
| 446 | Ga0400483_167725 | 3300039062 | Bacteria | 2775 |
| 447 | Ga0400483_255949 | 3300039062 | Unclassified | 1101 |
| 448 | Ga0400489_36589 | 3300039093 | Bacteria | 22091 |
| 449 | Ga0400487_28190 | 3300039110 | Unclassified | 1417 |
| 450 | Ga0400487_34922 | 3300039110 | Bacteria | 34543 |
| 451 | Ga0400487_66110 | 3300039110 | Bacteria | 2505 |
| 452 | Ga0439461_0011147 | 3300041410 | Unclassified | 1664 |
| 453 | Ga0439433_0002782 | 3300041999 | Bacteria | 3729 |
| 454 | Ga0439433_0039154 | 3300041999 | Bacteria | 1101 |
| 455 | Ga0439441_023931 | 3300042001 | Bacteria | 1144 |
| 456 | Ga0439445_0176357 | 3300042004 | Bacteria | 627 |
| 457 | Ga0439449_0117194 | 3300042007 | Bacteria | 988 |
| 458 | Ga0439454_005973 | 3300042011 | Bacteria | 1478 |
| 459 | Ga0439455_0061706 | 3300042012 | Bacteria | 995 |
| 460 | Ga0439462_0032086 | 3300042015 | Bacteria | 1392 |
| 461 | Ga0450920_048126 | 3300042122 | Bacteria | 853 |
| 462 | Ga0450923_050040 | 3300042125 | Unclassified | 895 |
| 463 | Ga0450894_005829 | 3300042131 | Bacteria | 1596 |
| 464 | Ga0450896_001951 | 3300042133 | Bacteria | 2620 |
| 465 | Ga0450902_047777 | 3300042137 | Bacteria | 732 |
| 466 | Ga0450889_025860 | 3300042144 | Bacteria | 670 |
| 467 | Ga0450908_001456 | 3300042184 | Bacteria | 4598 |
| 468 | Ga0450908_072150 | 3300042184 | Bacteria | 614 |
| 469 | Ga0439434_0023085 | 3300042435 | Bacteria | 1871 |
| 470 | Ga0439434_0302598 | 3300042435 | Bacteria | 553 |
| 471 | Ga0439459_0037143 | 3300042438 | Unclassified | 1019 |
| 472 | Ga0439464_0003729 | 3300042439 | Bacteria | 3866 |
| 473 | Ga0439460_0027081 | 3300042461 | Bacteria | 1608 |
| 474 | Ga0450916_011256 | 3300042530 | Bacteria | 1128 |
| 475 | Ga0450918_016535 | 3300042531 | Bacteria | 1282 |
| 476 | Ga0450918_049786 | 3300042531 | Bacteria | 762 |
| 477 | Ga0451577_0027233 | 3300042876 | Bacteria | 5173 |
| 478 | Ga0451577_0728998 | 3300042876 | Unclassified | 897 |
| 479 | Ga0453683_0476983 | 3300044673 | Bacteria | 808 |
| 480 | Ga0466963_0053935 | 3300044694 | Bacteria | 2671 |
| 481 | Ga0453684_0171621 | 3300044712 | Bacteria | 2555 |
| 482 | Ga0453684_0445850 | 3300044712 | Bacteria | 1442 |
| 483 | Ga0453684_0550832 | 3300044712 | Bacteria | 1270 |
| 484 | Ga0453684_0780281 | 3300044712 | Bacteria | 1032 |
| 485 | Ga0451576_0217196 | 3300045051 | Bacteria | 1996 |
| 486 | Ga0466958_0398315 | 3300045836 | Bacteria | 889 |
| 487 | Ga0466967_1113823 | 3300045976 | Bacteria | 787 |
| 488 | Ga0466967_1379423 | 3300045976 | Bacteria | 702 |
| 489 | Ga0495592_0149168 | 3300046454 | Bacteria | 1619 |
| 490 | Ga0495592_0378425 | 3300046454 | Bacteria | 901 |
| 491 | Ga0495603_0303166 | 3300046455 | Bacteria | 918 |
| 492 | Ga0495629_0374829 | 3300046459 | Bacteria | 969 |
| 493 | Ga0495651_0340567 | 3300046462 | Bacteria | 994 |
| 494 | Ga0495580_0849871 | 3300046472 | Bacteria | 589 |
| 495 | Ga0495664_0574905 | 3300046477 | Bacteria | 671 |
| 496 | Ga0495608_0094793 | 3300046511 | Bacteria | 1929 |
| 497 | Ga0495618_0464382 | 3300046514 | Bacteria | 767 |
| 498 | Ga0495628_0063757 | 3300046516 | Bacteria | 2887 |
| 499 | Ga0495628_0386405 | 3300046516 | Bacteria | 1024 |
| 500 | Ga0495630_0193175 | 3300046517 | Bacteria | 1553 |
| 501 | Ga0495642_0167177 | 3300046528 | Bacteria | 955 |
| 502 | Ga0495642_0328297 | 3300046528 | Bacteria | 671 |
| 503 | Ga0495665_0301068 | 3300046531 | Bacteria | 821 |
| 504 | Ga0495640_0556631 | 3300046533 | Bacteria | 695 |
| 505 | Ga0495586_0081629 | 3300046535 | Bacteria | 1777 |
| 506 | Ga0495586_0128550 | 3300046535 | Bacteria | 1418 |
| 507 | Ga0495586_0280028 | 3300046535 | Bacteria | 954 |
| 508 | Ga0495634_0428327 | 3300046642 | Unclassified | 783 |
| 509 | Ga0495634_0576068 | 3300046642 | Bacteria | 655 |
| 510 | Ga0495635_0169710 | 3300046663 | Bacteria | 1484 |
| 511 | Ga0495635_0171417 | 3300046663 | Bacteria | 1476 |
| 512 | Ga0495599_0072930 | 3300046678 | Bacteria | 2143 |
| 513 | Ga0495599_0212389 | 3300046678 | Bacteria | 1186 |
| 514 | Ga0495599_0292361 | 3300046678 | Unclassified | 985 |
| 515 | Ga0495647_0036553 | 3300046681 | Bacteria | 1849 |
| 516 | Ga0495658_0237166 | 3300046683 | Bacteria | 1145 |
| 517 | Ga0495658_0412615 | 3300046683 | Bacteria | 861 |
| 518 | Ga0495613_0349644 | 3300046689 | Bacteria | 1015 |
| 519 | Ga0495613_0404132 | 3300046689 | Bacteria | 931 |
| 520 | Ga0495624_0747324 | 3300046690 | Unclassified | 579 |
| 521 | Ga0495600_0417460 | 3300046809 | Bacteria | 833 |
| 522 | Ga0495604_0057611 | 3300047317 | Bacteria | 2987 |
| 523 | Ga0495674_0276313 | 3300047319 | Bacteria | 1377 |
| 524 | Ga0495674_0379046 | 3300047319 | Bacteria | 1145 |
| 525 | Ga0495674_0540909 | 3300047319 | Unclassified | 928 |
| 526 | Ga0495672_0024901 | 3300047320 | Bacteria | 3844 |
| 527 | Ga0495680_0124893 | 3300047322 | Bacteria | 1897 |
| 528 | Ga0495680_0130196 | 3300047322 | Bacteria | 1850 |
| 529 | Ga0495680_0401071 | 3300047322 | Bacteria | 947 |
| 530 | Ga0495684_0105885 | 3300047471 | Bacteria | 2125 |
| 531 | Ga0496100_0532047 | 3300048903 | Bacteria | 908 |
| 532 | Ga0496101_0243653 | 3300048904 | Bacteria | 1399 |
| 533 | Ga0496101_0316482 | 3300048904 | Bacteria | 1224 |
| 534 | Ga0496102_0326291 | 3300048905 | Bacteria | 1446 |
| 535 | Ga0496102_0582132 | 3300048905 | Bacteria | 1042 |
| 536 | Ga0496103_0652345 | 3300048906 | Bacteria | 669 |
| 537 | Ga0496104_0006688 | 3300048907 | Bacteria | 10145 |
| 538 | Ga0496104_0107517 | 3300048907 | Bacteria | 2673 |
| 539 | Ga0496105_0064903 | 3300048908 | Bacteria | 3013 |
| 540 | Ga0496106_0284405 | 3300048909 | Bacteria | 1325 |
| 541 | Ga0496106_0521570 | 3300048909 | Bacteria | 954 |
| 542 | Ga0496106_0940108 | 3300048909 | Bacteria | 681 |
| 543 | Ga0496108_0011048 | 3300048911 | Bacteria | 7332 |
| 544 | Ga0496108_0184912 | 3300048911 | Bacteria | 1805 |
| 545 | Ga0496108_0197696 | 3300048911 | Bacteria | 1744 |
| 546 | Ga0496109_0020083 | 3300048912 | Bacteria | 5901 |
| 547 | Ga0496109_0218451 | 3300048912 | Bacteria | 1793 |
| 548 | Ga0496109_1068544 | 3300048912 | Bacteria | 744 |
| 549 | Ga0496111_0133642 | 3300048914 | Bacteria | 1837 |
| 550 | Ga0496111_0263475 | 3300048914 | Bacteria | 1279 |
| 551 | Ga0496112_0033300 | 3300048915 | Bacteria | 5008 |
| 552 | Ga0496112_0086542 | 3300048915 | Bacteria | 3100 |
| 553 | Ga0496112_1114963 | 3300048915 | Bacteria | 707 |
| 554 | Ga0496112_1587022 | 3300048915 | Bacteria | 568 |
| 555 | Ga0496113_0057491 | 3300048916 | Bacteria | 2923 |
| 556 | Ga0496114_0008895 | 3300048917 | Bacteria | 7963 |
| 557 | Ga0496114_0099260 | 3300048917 | Bacteria | 2483 |
| 558 | Ga0496114_0397652 | 3300048917 | Bacteria | 1220 |
| 559 | Ga0496115_0086623 | 3300048918 | Bacteria | 2556 |
| 560 | Ga0496115_0461975 | 3300048918 | Bacteria | 1024 |
| 561 | Ga0501033_0322619 | 3300049570 | Bacteria | 1085 |
| 562 | Ga0501034_0127536 | 3300049571 | Bacteria | 2529 |
| 563 | Ga0501036_0035839 | 3300049572 | Bacteria | 4199 |
| 564 | Ga0501037_0339919 | 3300049573 | Bacteria | 1037 |
| 565 | Ga0501038_0366265 | 3300049574 | Bacteria | 1120 |
| 566 | Ga0501041_0163082 | 3300049577 | Bacteria | 1394 |
| 567 | Ga0501042_0435937 | 3300049578 | Bacteria | 950 |
| 568 | Ga0501042_0646003 | 3300049578 | Bacteria | 769 |
| 569 | Ga0501043_0181977 | 3300049579 | Bacteria | 1637 |
| 570 | Ga0501046_0701235 | 3300049580 | Bacteria | 713 |
| 571 | Ga0501047_0046383 | 3300049581 | Bacteria | 4200 |
| 572 | Ga0501071_0105020 | 3300049587 | Bacteria | 2085 |
| 573 | Ga0501071_0421341 | 3300049587 | Bacteria | 1020 |
| 574 | Ga0501072_0257484 | 3300049588 | Bacteria | 1389 |
| 575 | Ga0501072_0492218 | 3300049588 | Bacteria | 970 |
| 576 | Ga0501073_0285310 | 3300049589 | Bacteria | 1139 |
| 577 | Ga0501074_0316055 | 3300049590 | Bacteria | 1109 |
| 578 | Ga0501075_0015987 | 3300049591 | Bacteria | 5398 |
| 579 | Ga0501075_0020162 | 3300049591 | Bacteria | 4845 |
| 580 | Ga0501075_0199422 | 3300049591 | Bacteria | 1526 |
| 581 | Ga0501075_0272398 | 3300049591 | Bacteria | 1290 |
| 582 | Ga0501076_0025220 | 3300049592 | Bacteria | 4600 |
| 583 | Ga0501076_0098475 | 3300049592 | Bacteria | 2356 |
| 584 | Ga0501076_0480989 | 3300049592 | Bacteria | 1023 |
| 585 | Ga0501225_0142966 | 3300049705 | Bacteria | 725 |
| 586 | Ga0501079_0040549 | 3300049741 | Bacteria | 3592 |
| 587 | Ga0501079_0340193 | 3300049741 | Bacteria | 1175 |
| 588 | Ga0501080_0063036 | 3300049742 | Bacteria | 3450 |
| 589 | Ga0501080_0588049 | 3300049742 | Bacteria | 989 |
| 590 | Ga0501080_1203404 | 3300049742 | Bacteria | 651 |
| 591 | Ga0501081_0050507 | 3300049743 | Bacteria | 2865 |
| 592 | Ga0501081_0102428 | 3300049743 | Bacteria | 2025 |
| 593 | Ga0501081_0611706 | 3300049743 | Bacteria | 816 |
| 594 | Ga0501083_0024832 | 3300049744 | Bacteria | 4151 |
| 595 | Ga0501035_0282968 | 3300049822 | Bacteria | 1401 |
| 596 | Ga0501035_0470510 | 3300049822 | Bacteria | 1038 |
| 597 | Ga0501044_0024597 | 3300049823 | Bacteria | 6390 |
| 598 | Ga0501045_0033959 | 3300049824 | Bacteria | 3701 |
| 599 | Ga0501045_0083334 | 3300049824 | Bacteria | 2359 |
| 600 | Ga0501045_0495946 | 3300049824 | Bacteria | 907 |
| 601 | Ga0501045_0847667 | 3300049824 | Bacteria | 672 |
| 602 | nmdc:mga00v17_214036_c1 | 3300050491 | Bacteria | 1247 |
| 603 | nmdc:mga0yw44_316416_c1 | 3300050492 | Bacteria | 1047 |
| 604 | nmdc:mga0k408_62255_c1 | 3300050493 | Bacteria | 2169 |
| 605 | nmdc:mga05p37_1134093_c1 | 3300050507 | Bacteria | 815 |
| 606 | nmdc:mga05p37_117604_c1 | 3300050507 | Unclassified | 3266 |
| 607 | nmdc:mga05p37_7125_c1 | 3300050507 | Bacteria | 13184 |
| 608 | nmdc:mga05p37_934570_c1 | 3300050507 | Bacteria | 930 |
| 609 | nmdc:mga09592_140784_c1 | 3300050508 | Bacteria | 2079 |
| 610 | nmdc:mga09592_283813_c1 | 3300050508 | Bacteria | 1436 |
| 611 | nmdc:mga0qj67_144533_c1 | 3300050509 | Bacteria | 1929 |
| 612 | nmdc:mga06r32_1391484_c1 | 3300050510 | Bacteria | 643 |
| 613 | nmdc:mga06r32_139277_c1 | 3300050510 | Bacteria | 2402 |
| 614 | nmdc:mga06r32_20786_c1 | 3300050510 | Bacteria | 6048 |
| 615 | nmdc:mga06r32_288005_c1 | 3300050510 | Bacteria | 1629 |
| 616 | nmdc:mga06r32_446280_c1 | 3300050510 | Bacteria | 1273 |
| 617 | nmdc:mga06r32_484667_c1 | 3300050510 | Bacteria | 1214 |
| 618 | nmdc:mga06r32_65986_c1 | 3300050510 | Bacteria | 3492 |
| 619 | nmdc:mga08y16_186124_c1 | 3300050511 | Bacteria | 2155 |
| 620 | nmdc:mga08y16_3_c1 | 3300050511 | Bacteria | 936907 |
| 621 | nmdc:mga08y16_40617_c1 | 3300050511 | Bacteria | 4875 |
| 622 | nmdc:mga0n895_123088_c1 | 3300050512 | Bacteria | 2615 |
| 623 | nmdc:mga0n895_166712_c1 | 3300050512 | Bacteria | 2234 |
| 624 | nmdc:mga0n895_206331_c1 | 3300050512 | Bacteria | 1996 |
| 625 | nmdc:mga0n895_961802_c1 | 3300050512 | Bacteria | 837 |
| 626 | nmdc:mga08x19_21369_c1 | 3300050514 | Bacteria | 3995 |
| 627 | nmdc:mga0a205_25306_c1 | 3300050515 | Bacteria | 5653 |
| 628 | nmdc:mga0a205_741249_c1 | 3300050515 | Bacteria | 831 |
| 629 | Ga0495601_0118253 | 3300053077 | Bacteria | 1720 |
| 630 | Ga0495601_0338185 | 3300053077 | Bacteria | 979 |
| 631 | Ga0495601_0356771 | 3300053077 | Bacteria | 950 |
| 632 | Ga0495612_0180998 | 3300053078 | Bacteria | 926 |
| 633 | Ga0495595_0079466 | 3300053084 | Bacteria | 1560 |
| 634 | Ga0495595_0282686 | 3300053084 | Bacteria | 833 |
| 635 | Ga0495619_0007485 | 3300053085 | Bacteria | 6916 |
| 636 | Ga0495619_0088967 | 3300053085 | Bacteria | 2089 |
| 637 | Ga0500555_000372 | 3300053103 | Bacteria | 19028 |
| 638 | Ga0500592_040023 | 3300053116 | Bacteria | 758 |
| 639 | Ga0500628_058510 | 3300053129 | Bacteria | 935 |
| 640 | Ga0500568_0003417 | 3300053139 | Bacteria | 8858 |
| 641 | Ga0500616_0002270 | 3300053153 | Bacteria | 16325 |
| 642 | Ga0500609_047236 | 3300053731 | Bacteria | 597 |
| 643 | Ga0501084_0086510 | 3300054114 | Bacteria | 2632 |
| 644 | Ga0501084_0156341 | 3300054114 | Bacteria | 1923 |
| 645 | Ga0501084_0385240 | 3300054114 | Bacteria | 1185 |
| 646 | Ga0590075_027686 | 3300059424 | Bacteria | 1431 |
| 647 | Ga0590077_076776 | 3300059426 | Bacteria | 766 |
| 648 | Ga0501082_0404475 | 3300060353 | Bacteria | 1191 |
| 649 | Ga0501082_0461451 | 3300060353 | Bacteria | 1110 |
| 650 | Ga0501082_0825433 | 3300060353 | Bacteria | 811 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013308 | Ga0157375_10659836 | Ga0157375_106598362 | 148 |
| 2 | 3300014969 | Ga0157376_10665930 | Ga0157376_106659302 | 148 |
| 3 | 3300042125 | Ga0450923_050040 | Ga0450923_050040_392_847 | 151 |
| 4 | 3300035086 | Ga0373934_0257531 | Ga0373934_0257531_214_693 | 156 |
| 5 | iso_pu_bacteria | 2744054657 | 2745169134 | 157 |
| 6 | iso_pu_bacteria | 2816332336 | 2817619547 | 157 |
| 7 | 3300006852 | Ga0075433_10094811 | Ga0075433_100948112 | 158 |
| 8 | 3300009147 | Ga0114129_10008349 | Ga0114129_100083497 | 158 |
| 9 | 3300009176 | Ga0105242_10887331 | Ga0105242_108873312 | 158 |
| 10 | 3300013297 | Ga0157378_10015911 | Ga0157378_100159112 | 158 |
| 11 | 3300045976 | Ga0466967_1379423 | Ga0466967_1379423_205_690 | 158 |
| 12 | 3300046517 | Ga0495630_0193175 | Ga0495630_0193175_443_919 | 158 |
| 13 | 3300046535 | Ga0495586_0081629 | Ga0495586_0081629_697_1173 | 158 |
| 14 | 3300046642 | Ga0495634_0428327 | Ga0495634_0428327_211_687 | 158 |
| 15 | 3300046663 | Ga0495635_0169710 | Ga0495635_0169710_178_654 | 158 |
| 16 | 3300046683 | Ga0495658_0412615 | Ga0495658_0412615_110_586 | 158 |
| 17 | 3300046689 | Ga0495613_0349644 | Ga0495613_0349644_182_658 | 158 |
| 18 | 3300046690 | Ga0495624_0747324 | Ga0495624_0747324_28_504 | 158 |
| 19 | 3300047319 | Ga0495674_0276313 | Ga0495674_0276313_776_1252 | 158 |
| 20 | 3300047471 | Ga0495684_0105885 | Ga0495684_0105885_316_792 | 158 |
| 21 | 3300053077 | Ga0495601_0356771 | Ga0495601_0356771_367_843 | 158 |
| 22 | 3300053084 | Ga0495595_0079466 | Ga0495595_0079466_809_1285 | 158 |
| 23 | 3300053085 | Ga0495619_0007485 | Ga0495619_0007485_912_1388 | 158 |
| 24 | iso_pu_bacteria | 2740891818 | 2740992767 | 158 |
| 25 | 3300005295 | Ga0065707_10000711 | Ga0065707_1000071112 | 159 |
| 26 | 3300005353 | Ga0070669_100295257 | Ga0070669_1002952572 | 159 |
| 27 | 3300005354 | Ga0070675_100024928 | Ga0070675_1000249283 | 159 |
| 28 | 3300005406 | Ga0070703_10079911 | Ga0070703_100799112 | 159 |
| 29 | 3300005435 | Ga0070714_100071785 | Ga0070714_1000717853 | 159 |
| 30 | 3300005436 | Ga0070713_100546882 | Ga0070713_1005468822 | 159 |
| 31 | 3300005844 | Ga0068862_100535767 | Ga0068862_1005357672 | 159 |
| 32 | 3300006844 | Ga0075428_100000010 | Ga0075428_10000001068 | 159 |
| 33 | 3300006847 | Ga0075431_100140965 | Ga0075431_1001409653 | 159 |
| 34 | 3300009093 | Ga0105240_10211148 | Ga0105240_102111482 | 159 |
| 35 | 3300009094 | Ga0111539_10000001 | Ga0111539_10000001132 | 159 |
| 36 | 3300009553 | Ga0105249_10089504 | Ga0105249_100895043 | 159 |
| 37 | 3300014326 | Ga0157380_10024634 | Ga0157380_100246342 | 159 |
| 38 | 3300014326 | Ga0157380_10136005 | Ga0157380_101360053 | 159 |
| 39 | 3300025885 | Ga0207653_10083380 | Ga0207653_100833802 | 159 |
| 40 | 3300025913 | Ga0207695_10479453 | Ga0207695_104794532 | 159 |
| 41 | 3300025923 | Ga0207681_10274900 | Ga0207681_102749002 | 159 |
| 42 | 3300025925 | Ga0207650_10514985 | Ga0207650_105149852 | 159 |
| 43 | 3300025926 | Ga0207659_10220753 | Ga0207659_102207532 | 159 |
| 44 | 3300025926 | Ga0207659_10297299 | Ga0207659_102972992 | 159 |
| 45 | 3300025926 | Ga0207659_10299936 | Ga0207659_102999361 | 159 |
| 46 | 3300025928 | Ga0207700_10112583 | Ga0207700_101125832 | 159 |
| 47 | 3300025929 | Ga0207664_10377825 | Ga0207664_103778252 | 159 |
| 48 | 3300025940 | Ga0207691_10279983 | Ga0207691_102799832 | 159 |
| 49 | 3300025961 | Ga0207712_10202195 | Ga0207712_102021952 | 159 |
| 50 | 3300026121 | Ga0207683_10231999 | Ga0207683_102319992 | 159 |
| 51 | 3300027907 | Ga0207428_10000002 | Ga0207428_10000002145 | 159 |
| 52 | 3300032002 | Ga0307416_100620234 | Ga0307416_1006202342 | 159 |
| 53 | 3300036647 | Ga0316582_0188772 | Ga0316582_0188772_369_848 | 159 |
| 54 | 3300039110 | Ga0400487_66110 | Ga0400487_66110_1015_1494 | 159 |
| 55 | 3300042184 | Ga0450908_072150 | Ga0450908_072150_51_545 | 159 |
| 56 | 3300042438 | Ga0439459_0037143 | Ga0439459_0037143_433_927 | 159 |
| 57 | 3300042531 | Ga0450918_049786 | Ga0450918_049786_83_577 | 159 |
| 58 | 3300044694 | Ga0466963_0053935 | Ga0466963_0053935_1845_2324 | 159 |
| 59 | 3300044712 | Ga0453684_0171621 | Ga0453684_0171621_959_1438 | 159 |
| 60 | 3300045836 | Ga0466958_0398315 | Ga0466958_0398315_249_728 | 159 |
| 61 | 3300045976 | Ga0466967_1113823 | Ga0466967_1113823_192_680 | 159 |
| 62 | 3300049580 | Ga0501046_0701235 | Ga0501046_0701235_197_685 | 159 |
| 63 | 3300049587 | Ga0501071_0105020 | Ga0501071_0105020_508_996 | 159 |
| 64 | 3300049590 | Ga0501074_0316055 | Ga0501074_0316055_248_736 | 159 |
| 65 | 3300049591 | Ga0501075_0020162 | Ga0501075_0020162_1672_2160 | 159 |
| 66 | 3300049592 | Ga0501076_0098475 | Ga0501076_0098475_42_530 | 159 |
| 67 | 3300049741 | Ga0501079_0040549 | Ga0501079_0040549_44_532 | 159 |
| 68 | 3300049743 | Ga0501081_0102428 | Ga0501081_0102428_1504_1992 | 159 |
| 69 | 3300049744 | Ga0501083_0024832 | Ga0501083_0024832_3291_3788 | 159 |
| 70 | 3300049824 | Ga0501045_0033959 | Ga0501045_0033959_1328_1816 | 159 |
| 71 | 3300050510 | nmdc:mga06r32_1391484_c1 | nmdc:mga06r32_1391484_c1_68_547 | 159 |
| 72 | 3300050510 | nmdc:mga06r32_139277_c1 | nmdc:mga06r32_139277_c1_972_1466 | 159 |
| 73 | 3300050511 | nmdc:mga08y16_3_c1 | nmdc:mga08y16_3_c1_156139_156633 | 159 |
| 74 | 3300054114 | Ga0501084_0385240 | Ga0501084_0385240_438_926 | 159 |
| 75 | 3300060353 | Ga0501082_0825433 | Ga0501082_0825433_49_537 | 159 |
| 76 | 3300005333 | Ga0070677_10110750 | Ga0070677_101107502 | 160 |
| 77 | 3300005364 | Ga0070673_100581056 | Ga0070673_1005810562 | 160 |
| 78 | 3300005367 | Ga0070667_100308307 | Ga0070667_1003083073 | 160 |
| 79 | 3300005843 | Ga0068860_101267610 | Ga0068860_1012676102 | 160 |
| 80 | 3300006178 | Ga0075367_10211489 | Ga0075367_102114892 | 160 |
| 81 | 3300006358 | Ga0068871_100529985 | Ga0068871_1005299852 | 160 |
| 82 | 3300009101 | Ga0105247_10046659 | Ga0105247_100466594 | 160 |
| 83 | 3300009177 | Ga0105248_10232301 | Ga0105248_102323011 | 160 |
| 84 | 3300013297 | Ga0157378_10129721 | Ga0157378_101297213 | 160 |
| 85 | 3300014326 | Ga0157380_10145526 | Ga0157380_101455263 | 160 |
| 86 | 3300025900 | Ga0207710_10032468 | Ga0207710_100324683 | 160 |
| 87 | 3300031711 | Ga0265314_10022431 | Ga0265314_100224317 | 160 |
| 88 | 3300031727 | Ga0316576_10004420 | Ga0316576_100044208 | 160 |
| 89 | 3300031727 | Ga0316576_10009067 | Ga0316576_100090675 | 160 |
| 90 | 3300031727 | Ga0316576_10071072 | Ga0316576_100710722 | 160 |
| 91 | 3300031727 | Ga0316576_10084356 | Ga0316576_100843562 | 160 |
| 92 | 3300035116 | Ga0373945_0194463 | Ga0373945_0194463_240_731 | 160 |
| 93 | 3300035119 | Ga0373956_0117696 | Ga0373956_0117696_551_1042 | 160 |
| 94 | 3300035120 | Ga0373957_0142310 | Ga0373957_0142310_408_899 | 160 |
| 95 | 3300035724 | Ga0373933_0292283 | Ga0373933_0292283_410_901 | 160 |
| 96 | 3300036401 | Ga0373937_1484627 | Ga0373937_1484627_78_569 | 160 |
| 97 | 3300037068 | Ga0373925_0433612 | Ga0373925_0433612_233_724 | 160 |
| 98 | 3300042001 | Ga0439441_023931 | Ga0439441_023931_626_1108 | 160 |
| 99 | 3300042137 | Ga0450902_047777 | Ga0450902_047777_33_515 | 160 |
| 100 | 3300042144 | Ga0450889_025860 | Ga0450889_025860_165_647 | 160 |
| 101 | 3300042435 | Ga0439434_0302598 | Ga0439434_0302598_48_530 | 160 |
| 102 | 3300042461 | Ga0439460_0027081 | Ga0439460_0027081_1103_1585 | 160 |
| 103 | 3300042530 | Ga0450916_011256 | Ga0450916_011256_197_679 | 160 |
| 104 | 3300046459 | Ga0495629_0374829 | Ga0495629_0374829_447_938 | 160 |
| 105 | 3300046472 | Ga0495580_0849871 | Ga0495580_0849871_28_519 | 160 |
| 106 | 3300046477 | Ga0495664_0574905 | Ga0495664_0574905_150_641 | 160 |
| 107 | 3300046516 | Ga0495628_0063757 | Ga0495628_0063757_153_644 | 160 |
| 108 | 3300046531 | Ga0495665_0301068 | Ga0495665_0301068_288_779 | 160 |
| 109 | 3300046535 | Ga0495586_0128550 | Ga0495586_0128550_53_544 | 160 |
| 110 | 3300046642 | Ga0495634_0576068 | Ga0495634_0576068_153_644 | 160 |
| 111 | 3300046663 | Ga0495635_0171417 | Ga0495635_0171417_801_1292 | 160 |
| 112 | 3300046678 | Ga0495599_0292361 | Ga0495599_0292361_342_833 | 160 |
| 113 | 3300046681 | Ga0495647_0036553 | Ga0495647_0036553_1186_1677 | 160 |
| 114 | 3300046683 | Ga0495658_0237166 | Ga0495658_0237166_535_1026 | 160 |
| 115 | 3300046689 | Ga0495613_0404132 | Ga0495613_0404132_11_502 | 160 |
| 116 | 3300046809 | Ga0495600_0417460 | Ga0495600_0417460_236_727 | 160 |
| 117 | 3300047319 | Ga0495674_0540909 | Ga0495674_0540909_386_877 | 160 |
| 118 | 3300047322 | Ga0495680_0124893 | Ga0495680_0124893_782_1273 | 160 |
| 119 | 3300049592 | Ga0501076_0480989 | Ga0501076_0480989_227_709 | 160 |
| 120 | 3300049705 | Ga0501225_0142966 | Ga0501225_0142966_97_579 | 160 |
| 121 | 3300049743 | Ga0501081_0611706 | Ga0501081_0611706_113_595 | 160 |
| 122 | 3300050492 | nmdc:mga0yw44_316416_c1 | nmdc:mga0yw44_316416_c1_81_566 | 160 |
| 123 | 3300053077 | Ga0495601_0338185 | Ga0495601_0338185_209_700 | 160 |
| 124 | 3300053084 | Ga0495595_0282686 | Ga0495595_0282686_155_646 | 160 |
| 125 | 3300053085 | Ga0495619_0088967 | Ga0495619_0088967_47_538 | 160 |
| 126 | 3300005290 | Ga0065712_10022087 | Ga0065712_100220872 | 161 |
| 127 | 3300005290 | Ga0065712_10126316 | Ga0065712_101263162 | 161 |
| 128 | 3300005290 | Ga0065712_10188467 | Ga0065712_101884671 | 161 |
| 129 | 3300005293 | Ga0065715_10235947 | Ga0065715_102359472 | 161 |
| 130 | 3300005293 | Ga0065715_10346250 | Ga0065715_103462502 | 161 |
| 131 | 3300005293 | Ga0065715_10508785 | Ga0065715_105087852 | 161 |
| 132 | 3300005295 | Ga0065707_10113287 | Ga0065707_101132873 | 161 |
| 133 | 3300005331 | Ga0070670_100003718 | Ga0070670_10000371815 | 161 |
| 134 | 3300005339 | Ga0070660_100007604 | Ga0070660_1000076047 | 161 |
| 135 | 3300005353 | Ga0070669_100007815 | Ga0070669_1000078153 | 161 |
| 136 | 3300005353 | Ga0070669_100076401 | Ga0070669_1000764013 | 161 |
| 137 | 3300005354 | Ga0070675_100207374 | Ga0070675_1002073743 | 161 |
| 138 | 3300005354 | Ga0070675_100243452 | Ga0070675_1002434522 | 161 |
| 139 | 3300005354 | Ga0070675_100337905 | Ga0070675_1003379052 | 161 |
| 140 | 3300005366 | Ga0070659_100198953 | Ga0070659_1001989532 | 161 |
| 141 | 3300005367 | Ga0070667_100650899 | Ga0070667_1006508992 | 161 |
| 142 | 3300005434 | Ga0070709_10257787 | Ga0070709_102577872 | 161 |
| 143 | 3300005436 | Ga0070713_100004167 | Ga0070713_1000041673 | 161 |
| 144 | 3300005437 | Ga0070710_10256412 | Ga0070710_102564122 | 161 |
| 145 | 3300005439 | Ga0070711_101051916 | Ga0070711_1010519162 | 161 |
| 146 | 3300005440 | Ga0070705_100452019 | Ga0070705_1004520191 | 161 |
| 147 | 3300005457 | Ga0070662_100447266 | Ga0070662_1004472662 | 161 |
| 148 | 3300005458 | Ga0070681_10101934 | Ga0070681_101019342 | 161 |
| 149 | 3300005458 | Ga0070681_10150160 | Ga0070681_101501602 | 161 |
| 150 | 3300005530 | Ga0070679_100033557 | Ga0070679_1000335572 | 161 |
| 151 | 3300005530 | Ga0070679_100070971 | Ga0070679_1000709713 | 161 |
| 152 | 3300005530 | Ga0070679_100596072 | Ga0070679_1005960722 | 161 |
| 153 | 3300005535 | Ga0070684_100555217 | Ga0070684_1005552172 | 161 |
| 154 | 3300005535 | Ga0070684_100953268 | Ga0070684_1009532681 | 161 |
| 155 | 3300005543 | Ga0070672_100209788 | Ga0070672_1002097882 | 161 |
| 156 | 3300005545 | Ga0070695_100401599 | Ga0070695_1004015992 | 161 |
| 157 | 3300005546 | Ga0070696_100433236 | Ga0070696_1004332361 | 161 |
| 158 | 3300005548 | Ga0070665_100159829 | Ga0070665_1001598292 | 161 |
| 159 | 3300005549 | Ga0070704_100574194 | Ga0070704_1005741941 | 161 |
| 160 | 3300005563 | Ga0068855_100010055 | Ga0068855_1000100552 | 161 |
| 161 | 3300005563 | Ga0068855_100731020 | Ga0068855_1007310202 | 161 |
| 162 | 3300005564 | Ga0070664_100264778 | Ga0070664_1002647782 | 161 |
| 163 | 3300005577 | Ga0068857_100010719 | Ga0068857_1000107193 | 161 |
| 164 | 3300005618 | Ga0068864_100121533 | Ga0068864_1001215334 | 161 |
| 165 | 3300005618 | Ga0068864_101789605 | Ga0068864_1017896051 | 161 |
| 166 | 3300005842 | Ga0068858_100050154 | Ga0068858_1000501543 | 161 |
| 167 | 3300005843 | Ga0068860_100401680 | Ga0068860_1004016802 | 161 |
| 168 | 3300005844 | Ga0068862_100034975 | Ga0068862_1000349752 | 161 |
| 169 | 3300005844 | Ga0068862_101462950 | Ga0068862_1014629501 | 161 |
| 170 | 3300005937 | Ga0081455_10118733 | Ga0081455_101187332 | 161 |
| 171 | 3300006028 | Ga0070717_10064218 | Ga0070717_100642182 | 161 |
| 172 | 3300006173 | Ga0070716_100117678 | Ga0070716_1001176782 | 161 |
| 173 | 3300006175 | Ga0070712_100894674 | Ga0070712_1008946741 | 161 |
| 174 | 3300006175 | Ga0070712_101121770 | Ga0070712_1011217701 | 161 |
| 175 | 3300006844 | Ga0075428_100060560 | Ga0075428_1000605604 | 161 |
| 176 | 3300006844 | Ga0075428_100316927 | Ga0075428_1003169272 | 161 |
| 177 | 3300006846 | Ga0075430_100033278 | Ga0075430_1000332783 | 161 |
| 178 | 3300006847 | Ga0075431_100016240 | Ga0075431_1000162403 | 161 |
| 179 | 3300006847 | Ga0075431_100047948 | Ga0075431_1000479483 | 161 |
| 180 | 3300006852 | Ga0075433_10026230 | Ga0075433_100262303 | 161 |
| 181 | 3300006871 | Ga0075434_100273290 | Ga0075434_1002732902 | 161 |
| 182 | 3300006871 | Ga0075434_100868685 | Ga0075434_1008686852 | 161 |
| 183 | 3300006880 | Ga0075429_100141020 | Ga0075429_1001410202 | 161 |
| 184 | 3300006880 | Ga0075429_100157523 | Ga0075429_1001575232 | 161 |
| 185 | 3300007076 | Ga0075435_100072662 | Ga0075435_1000726623 | 161 |
| 186 | 3300007076 | Ga0075435_101232732 | Ga0075435_1012327321 | 161 |
| 187 | 3300009011 | Ga0105251_10052654 | Ga0105251_100526542 | 161 |
| 188 | 3300009093 | Ga0105240_10690082 | Ga0105240_106900822 | 161 |
| 189 | 3300009094 | Ga0111539_10220842 | Ga0111539_102208422 | 161 |
| 190 | 3300009101 | Ga0105247_10010871 | Ga0105247_100108713 | 161 |
| 191 | 3300009101 | Ga0105247_10068387 | Ga0105247_100683872 | 161 |
| 192 | 3300009147 | Ga0114129_10042823 | Ga0114129_100428232 | 161 |
| 193 | 3300009147 | Ga0114129_10077442 | Ga0114129_100774423 | 161 |
| 194 | 3300009148 | Ga0105243_10505157 | Ga0105243_105051572 | 161 |
| 195 | 3300009148 | Ga0105243_12414682 | Ga0105243_124146821 | 161 |
| 196 | 3300009174 | Ga0105241_10683636 | Ga0105241_106836362 | 161 |
| 197 | 3300009177 | Ga0105248_10002926 | Ga0105248_1000292619 | 161 |
| 198 | 3300009177 | Ga0105248_10260777 | Ga0105248_102607772 | 161 |
| 199 | 3300009177 | Ga0105248_10366110 | Ga0105248_103661102 | 161 |
| 200 | 3300009551 | Ga0105238_10519926 | Ga0105238_105199262 | 161 |
| 201 | 3300009553 | Ga0105249_10001189 | Ga0105249_1000118923 | 161 |
| 202 | 3300010375 | Ga0105239_10701976 | Ga0105239_107019762 | 161 |
| 203 | 3300010375 | Ga0105239_11807558 | Ga0105239_118075581 | 161 |
| 204 | 3300011119 | Ga0105246_11082982 | Ga0105246_110829821 | 161 |
| 205 | 3300013306 | Ga0163162_10662633 | Ga0163162_106626332 | 161 |
| 206 | 3300014325 | Ga0163163_10010034 | Ga0163163_100100349 | 161 |
| 207 | 3300014325 | Ga0163163_10022050 | Ga0163163_100220502 | 161 |
| 208 | 3300014326 | Ga0157380_10251187 | Ga0157380_102511872 | 161 |
| 209 | 3300014968 | Ga0157379_10005817 | Ga0157379_100058174 | 161 |
| 210 | 3300014968 | Ga0157379_10100223 | Ga0157379_101002232 | 161 |
| 211 | 3300025315 | Ga0207697_10128368 | Ga0207697_101283682 | 161 |
| 212 | 3300025898 | Ga0207692_10426633 | Ga0207692_104266332 | 161 |
| 213 | 3300025900 | Ga0207710_10004642 | Ga0207710_100046424 | 161 |
| 214 | 3300025905 | Ga0207685_10091381 | Ga0207685_100913812 | 161 |
| 215 | 3300025906 | Ga0207699_10166694 | Ga0207699_101666943 | 161 |
| 216 | 3300025906 | Ga0207699_10420624 | Ga0207699_104206242 | 161 |
| 217 | 3300025912 | Ga0207707_10323488 | Ga0207707_103234882 | 161 |
| 218 | 3300025912 | Ga0207707_10583847 | Ga0207707_105838472 | 161 |
| 219 | 3300025915 | Ga0207693_10559790 | Ga0207693_105597902 | 161 |
| 220 | 3300025917 | Ga0207660_10070688 | Ga0207660_100706882 | 161 |
| 221 | 3300025917 | Ga0207660_10104025 | Ga0207660_101040252 | 161 |
| 222 | 3300025919 | Ga0207657_10031590 | Ga0207657_100315903 | 161 |
| 223 | 3300025920 | Ga0207649_10312992 | Ga0207649_103129922 | 161 |
| 224 | 3300025921 | Ga0207652_10018925 | Ga0207652_100189253 | 161 |
| 225 | 3300025921 | Ga0207652_10746898 | Ga0207652_107468982 | 161 |
| 226 | 3300025922 | Ga0207646_11117823 | Ga0207646_111178232 | 161 |
| 227 | 3300025922 | Ga0207646_11466181 | Ga0207646_114661811 | 161 |
| 228 | 3300025923 | Ga0207681_10003121 | Ga0207681_100031214 | 161 |
| 229 | 3300025923 | Ga0207681_10201022 | Ga0207681_102010222 | 161 |
| 230 | 3300025924 | Ga0207694_10379926 | Ga0207694_103799262 | 161 |
| 231 | 3300025926 | Ga0207659_10368812 | Ga0207659_103688121 | 161 |
| 232 | 3300025928 | Ga0207700_10008345 | Ga0207700_100083456 | 161 |
| 233 | 3300025932 | Ga0207690_10309947 | Ga0207690_103099472 | 161 |
| 234 | 3300025932 | Ga0207690_10567846 | Ga0207690_105678462 | 161 |
| 235 | 3300025933 | Ga0207706_10144639 | Ga0207706_101446392 | 161 |
| 236 | 3300025933 | Ga0207706_10348743 | Ga0207706_103487432 | 161 |
| 237 | 3300025935 | Ga0207709_10835945 | Ga0207709_108359452 | 161 |
| 238 | 3300025938 | Ga0207704_10348950 | Ga0207704_103489502 | 161 |
| 239 | 3300025939 | Ga0207665_10285383 | Ga0207665_102853831 | 161 |
| 240 | 3300025941 | Ga0207711_10661511 | Ga0207711_106615111 | 161 |
| 241 | 3300025945 | Ga0207679_10090586 | Ga0207679_100905863 | 161 |
| 242 | 3300025945 | Ga0207679_10177072 | Ga0207679_101770722 | 161 |
| 243 | 3300025949 | Ga0207667_10009099 | Ga0207667_1000909910 | 161 |
| 244 | 3300025949 | Ga0207667_10413336 | Ga0207667_104133362 | 161 |
| 245 | 3300025961 | Ga0207712_10127104 | Ga0207712_101271042 | 161 |
| 246 | 3300025961 | Ga0207712_10349216 | Ga0207712_103492162 | 161 |
| 247 | 3300025961 | Ga0207712_10924861 | Ga0207712_109248611 | 161 |
| 248 | 3300025972 | Ga0207668_10749206 | Ga0207668_107492062 | 161 |
| 249 | 3300026035 | Ga0207703_10023896 | Ga0207703_100238963 | 161 |
| 250 | 3300026035 | Ga0207703_10666245 | Ga0207703_106662451 | 161 |
| 251 | 3300026041 | Ga0207639_10509150 | Ga0207639_105091502 | 161 |
| 252 | 3300026095 | Ga0207676_10706588 | Ga0207676_107065882 | 161 |
| 253 | 3300026116 | Ga0207674_10025110 | Ga0207674_100251103 | 161 |
| 254 | 3300026116 | Ga0207674_10136535 | Ga0207674_101365352 | 161 |
| 255 | 3300026118 | Ga0207675_100449555 | Ga0207675_1004495552 | 161 |
| 256 | 3300027907 | Ga0207428_10060191 | Ga0207428_100601912 | 161 |
| 257 | 3300028379 | Ga0268266_10175315 | Ga0268266_101753152 | 161 |
| 258 | 3300028380 | Ga0268265_10010459 | Ga0268265_100104595 | 161 |
| 259 | 3300028380 | Ga0268265_10351733 | Ga0268265_103517333 | 161 |
| 260 | 3300028381 | Ga0268264_10400061 | Ga0268264_104000612 | 161 |
| 261 | 3300028381 | Ga0268264_10846659 | Ga0268264_108466592 | 161 |
| 262 | 3300031548 | Ga0307408_101119854 | Ga0307408_1011198542 | 161 |
| 263 | 3300031995 | Ga0307409_100224447 | Ga0307409_1002244472 | 161 |
| 264 | 3300032005 | Ga0307411_10897495 | Ga0307411_108974951 | 161 |
| 265 | 3300035119 | Ga0373956_0260952 | Ga0373956_0260952_305_793 | 161 |
| 266 | 3300035170 | Ga0373943_0000587 | Ga0373943_0000587_14026_14514 | 161 |
| 267 | 3300035410 | Ga0373924_0013327 | Ga0373924_0013327_629_1117 | 161 |
| 268 | 3300035691 | Ga0373931_0456314 | Ga0373931_0456314_53_565 | 161 |
| 269 | 3300035692 | Ga0373935_0012449 | Ga0373935_0012449_1377_1865 | 161 |
| 270 | 3300035695 | Ga0373927_0222835 | Ga0373927_0222835_291_779 | 161 |
| 271 | 3300035725 | Ga0373947_0000839 | Ga0373947_0000839_6992_7480 | 161 |
| 272 | 3300036401 | Ga0373937_0195391 | Ga0373937_0195391_335_820 | 161 |
| 273 | 3300036647 | Ga0316582_0102882 | Ga0316582_0102882_449_937 | 161 |
| 274 | 3300037068 | Ga0373925_0003817 | Ga0373925_0003817_8993_9481 | 161 |
| 275 | 3300038735 | Ga0400485_10511 | Ga0400485_10511_8160_8645 | 161 |
| 276 | 3300038741 | Ga0400488_25044 | Ga0400488_25044_73_558 | 161 |
| 277 | 3300038742 | Ga0400486_30854 | Ga0400486_30854_2762_3247 | 161 |
| 278 | 3300039093 | Ga0400489_36589 | Ga0400489_36589_5449_5934 | 161 |
| 279 | 3300039110 | Ga0400487_34922 | Ga0400487_34922_15242_15727 | 161 |
| 280 | 3300041410 | Ga0439461_0011147 | Ga0439461_0011147_778_1281 | 161 |
| 281 | 3300041999 | Ga0439433_0039154 | Ga0439433_0039154_571_1074 | 161 |
| 282 | 3300042004 | Ga0439445_0176357 | Ga0439445_0176357_56_559 | 161 |
| 283 | 3300042007 | Ga0439449_0117194 | Ga0439449_0117194_445_948 | 161 |
| 284 | 3300042011 | Ga0439454_005973 | Ga0439454_005973_137_640 | 161 |
| 285 | 3300042435 | Ga0439434_0023085 | Ga0439434_0023085_1290_1793 | 161 |
| 286 | 3300042876 | Ga0451577_0027233 | Ga0451577_0027233_319_822 | 161 |
| 287 | 3300044712 | Ga0453684_0780281 | Ga0453684_0780281_61_564 | 161 |
| 288 | 3300046454 | Ga0495592_0378425 | Ga0495592_0378425_196_681 | 161 |
| 289 | 3300046455 | Ga0495603_0303166 | Ga0495603_0303166_151_642 | 161 |
| 290 | 3300046462 | Ga0495651_0340567 | Ga0495651_0340567_261_746 | 161 |
| 291 | 3300046511 | Ga0495608_0094793 | Ga0495608_0094793_107_592 | 161 |
| 292 | 3300046514 | Ga0495618_0464382 | Ga0495618_0464382_120_605 | 161 |
| 293 | 3300046516 | Ga0495628_0386405 | Ga0495628_0386405_271_756 | 161 |
| 294 | 3300046528 | Ga0495642_0167177 | Ga0495642_0167177_190_681 | 161 |
| 295 | 3300046528 | Ga0495642_0328297 | Ga0495642_0328297_86_592 | 161 |
| 296 | 3300046533 | Ga0495640_0556631 | Ga0495640_0556631_83_574 | 161 |
| 297 | 3300046535 | Ga0495586_0280028 | Ga0495586_0280028_143_628 | 161 |
| 298 | 3300046678 | Ga0495599_0072930 | Ga0495599_0072930_458_946 | 161 |
| 299 | 3300046678 | Ga0495599_0212389 | Ga0495599_0212389_642_1127 | 161 |
| 300 | 3300047317 | Ga0495604_0057611 | Ga0495604_0057611_934_1419 | 161 |
| 301 | 3300047319 | Ga0495674_0379046 | Ga0495674_0379046_576_1061 | 161 |
| 302 | 3300047322 | Ga0495680_0401071 | Ga0495680_0401071_250_735 | 161 |
| 303 | 3300048905 | Ga0496102_0326291 | Ga0496102_0326291_940_1431 | 161 |
| 304 | 3300048905 | Ga0496102_0582132 | Ga0496102_0582132_332_835 | 161 |
| 305 | 3300048906 | Ga0496103_0652345 | Ga0496103_0652345_129_632 | 161 |
| 306 | 3300048907 | Ga0496104_0107517 | Ga0496104_0107517_1772_2260 | 161 |
| 307 | 3300048911 | Ga0496108_0011048 | Ga0496108_0011048_5596_6084 | 161 |
| 308 | 3300048911 | Ga0496108_0184912 | Ga0496108_0184912_318_803 | 161 |
| 309 | 3300048912 | Ga0496109_1068544 | Ga0496109_1068544_189_674 | 161 |
| 310 | 3300048914 | Ga0496111_0263475 | Ga0496111_0263475_276_764 | 161 |
| 311 | 3300048915 | Ga0496112_0086542 | Ga0496112_0086542_677_1165 | 161 |
| 312 | 3300048915 | Ga0496112_1114963 | Ga0496112_1114963_26_517 | 161 |
| 313 | 3300048915 | Ga0496112_1587022 | Ga0496112_1587022_37_528 | 161 |
| 314 | 3300048917 | Ga0496114_0397652 | Ga0496114_0397652_40_537 | 161 |
| 315 | 3300049570 | Ga0501033_0322619 | Ga0501033_0322619_519_1022 | 161 |
| 316 | 3300049571 | Ga0501034_0127536 | Ga0501034_0127536_1242_1736 | 161 |
| 317 | 3300049572 | Ga0501036_0035839 | Ga0501036_0035839_2992_3495 | 161 |
| 318 | 3300049573 | Ga0501037_0339919 | Ga0501037_0339919_508_1002 | 161 |
| 319 | 3300049574 | Ga0501038_0366265 | Ga0501038_0366265_165_659 | 161 |
| 320 | 3300049577 | Ga0501041_0163082 | Ga0501041_0163082_858_1361 | 161 |
| 321 | 3300049578 | Ga0501042_0435937 | Ga0501042_0435937_303_806 | 161 |
| 322 | 3300049578 | Ga0501042_0646003 | Ga0501042_0646003_38_523 | 161 |
| 323 | 3300049579 | Ga0501043_0181977 | Ga0501043_0181977_903_1397 | 161 |
| 324 | 3300049581 | Ga0501047_0046383 | Ga0501047_0046383_1649_2143 | 161 |
| 325 | 3300049587 | Ga0501071_0421341 | Ga0501071_0421341_172_675 | 161 |
| 326 | 3300049588 | Ga0501072_0257484 | Ga0501072_0257484_715_1218 | 161 |
| 327 | 3300049589 | Ga0501073_0285310 | Ga0501073_0285310_61_564 | 161 |
| 328 | 3300049591 | Ga0501075_0015987 | Ga0501075_0015987_1539_2042 | 161 |
| 329 | 3300049591 | Ga0501075_0199422 | Ga0501075_0199422_334_837 | 161 |
| 330 | 3300049592 | Ga0501076_0025220 | Ga0501076_0025220_1136_1639 | 161 |
| 331 | 3300049741 | Ga0501079_0340193 | Ga0501079_0340193_58_561 | 161 |
| 332 | 3300049742 | Ga0501080_0063036 | Ga0501080_0063036_665_1168 | 161 |
| 333 | 3300049742 | Ga0501080_0588049 | Ga0501080_0588049_76_579 | 161 |
| 334 | 3300049743 | Ga0501081_0050507 | Ga0501081_0050507_1429_1932 | 161 |
| 335 | 3300049822 | Ga0501035_0470510 | Ga0501035_0470510_464_967 | 161 |
| 336 | 3300049823 | Ga0501044_0024597 | Ga0501044_0024597_3348_3842 | 161 |
| 337 | 3300049824 | Ga0501045_0083334 | Ga0501045_0083334_152_655 | 161 |
| 338 | 3300050507 | nmdc:mga05p37_117604_c1 | nmdc:mga05p37_117604_c1_2161_2664 | 161 |
| 339 | 3300050507 | nmdc:mga05p37_7125_c1 | nmdc:mga05p37_7125_c1_5529_6056 | 161 |
| 340 | 3300050508 | nmdc:mga09592_140784_c1 | nmdc:mga09592_140784_c1_1257_1760 | 161 |
| 341 | 3300050508 | nmdc:mga09592_283813_c1 | nmdc:mga09592_283813_c1_283_786 | 161 |
| 342 | 3300050509 | nmdc:mga0qj67_144533_c1 | nmdc:mga0qj67_144533_c1_337_840 | 161 |
| 343 | 3300050510 | nmdc:mga06r32_20786_c1 | nmdc:mga06r32_20786_c1_4697_5200 | 161 |
| 344 | 3300050510 | nmdc:mga06r32_65986_c1 | nmdc:mga06r32_65986_c1_1324_1827 | 161 |
| 345 | 3300050511 | nmdc:mga08y16_186124_c1 | nmdc:mga08y16_186124_c1_1346_1849 | 161 |
| 346 | 3300050511 | nmdc:mga08y16_40617_c1 | nmdc:mga08y16_40617_c1_968_1471 | 161 |
| 347 | 3300050512 | nmdc:mga0n895_123088_c1 | nmdc:mga0n895_123088_c1_1034_1519 | 161 |
| 348 | 3300050512 | nmdc:mga0n895_166712_c1 | nmdc:mga0n895_166712_c1_286_789 | 161 |
| 349 | 3300050512 | nmdc:mga0n895_961802_c1 | nmdc:mga0n895_961802_c1_225_728 | 161 |
| 350 | 3300050515 | nmdc:mga0a205_25306_c1 | nmdc:mga0a205_25306_c1_3664_4167 | 161 |
| 351 | 3300053077 | Ga0495601_0118253 | Ga0495601_0118253_996_1481 | 161 |
| 352 | 3300053078 | Ga0495612_0180998 | Ga0495612_0180998_406_894 | 161 |
| 353 | 3300053129 | Ga0500628_058510 | Ga0500628_058510_14_499 | 161 |
| 354 | 3300005293 | Ga0065715_10949294 | Ga0065715_109492941 | 162 |
| 355 | 3300005364 | Ga0070673_100799038 | Ga0070673_1007990382 | 162 |
| 356 | 3300005438 | Ga0070701_10224384 | Ga0070701_102243842 | 162 |
| 357 | 3300005548 | Ga0070665_100462537 | Ga0070665_1004625371 | 162 |
| 358 | 3300005843 | Ga0068860_101635902 | Ga0068860_1016359021 | 162 |
| 359 | 3300006178 | Ga0075367_10034089 | Ga0075367_100340893 | 162 |
| 360 | 3300006195 | Ga0075366_10250608 | Ga0075366_102506082 | 162 |
| 361 | 3300006237 | Ga0097621_100673271 | Ga0097621_1006732712 | 162 |
| 362 | 3300006871 | Ga0075434_100024773 | Ga0075434_1000247732 | 162 |
| 363 | 3300006914 | Ga0075436_100122921 | Ga0075436_1001229212 | 162 |
| 364 | 3300007076 | Ga0075435_100051016 | Ga0075435_1000510162 | 162 |
| 365 | 3300009553 | Ga0105249_10265080 | Ga0105249_102650802 | 162 |
| 366 | 3300010375 | Ga0105239_12153638 | Ga0105239_121536381 | 162 |
| 367 | 3300025912 | Ga0207707_10447358 | Ga0207707_104473582 | 162 |
| 368 | 3300025916 | Ga0207663_10467043 | Ga0207663_104670431 | 162 |
| 369 | 3300028380 | Ga0268265_11363259 | Ga0268265_113632592 | 162 |
| 370 | 3300031665 | Ga0316575_10000035 | Ga0316575_1000003529 | 162 |
| 371 | 3300031665 | Ga0316575_10000389 | Ga0316575_100003899 | 162 |
| 372 | 3300031665 | Ga0316575_10009884 | Ga0316575_100098843 | 162 |
| 373 | 3300031665 | Ga0316575_10051071 | Ga0316575_100510712 | 162 |
| 374 | 3300031665 | Ga0316575_10110746 | Ga0316575_101107461 | 162 |
| 375 | 3300031665 | Ga0316575_10241777 | Ga0316575_102417772 | 162 |
| 376 | 3300031691 | Ga0316579_10000957 | Ga0316579_100009572 | 162 |
| 377 | 3300031691 | Ga0316579_10001214 | Ga0316579_100012149 | 162 |
| 378 | 3300031691 | Ga0316579_10003017 | Ga0316579_100030173 | 162 |
| 379 | 3300031691 | Ga0316579_10015725 | Ga0316579_100157252 | 162 |
| 380 | 3300031691 | Ga0316579_10031056 | Ga0316579_100310564 | 162 |
| 381 | 3300031727 | Ga0316576_10000046 | Ga0316576_1000004621 | 162 |
| 382 | 3300031727 | Ga0316576_10019400 | Ga0316576_100194006 | 162 |
| 383 | 3300031727 | Ga0316576_10025025 | Ga0316576_100250254 | 162 |
| 384 | 3300031727 | Ga0316576_10035360 | Ga0316576_100353604 | 162 |
| 385 | 3300031727 | Ga0316576_10140119 | Ga0316576_101401193 | 162 |
| 386 | 3300031727 | Ga0316576_10147999 | Ga0316576_101479994 | 162 |
| 387 | 3300031727 | Ga0316576_10173861 | Ga0316576_101738613 | 162 |
| 388 | 3300031727 | Ga0316576_10262882 | Ga0316576_102628822 | 162 |
| 389 | 3300031727 | Ga0316576_10396128 | Ga0316576_103961282 | 162 |
| 390 | 3300031727 | Ga0316576_10570479 | Ga0316576_105704792 | 162 |
| 391 | 3300031727 | Ga0316576_10633020 | Ga0316576_106330202 | 162 |
| 392 | 3300031727 | Ga0316576_10649650 | Ga0316576_106496501 | 162 |
| 393 | 3300031727 | Ga0316576_10736988 | Ga0316576_107369882 | 162 |
| 394 | 3300031727 | Ga0316576_10890620 | Ga0316576_108906202 | 162 |
| 395 | 3300031728 | Ga0316578_10000655 | Ga0316578_100006554 | 162 |
| 396 | 3300031728 | Ga0316578_10011920 | Ga0316578_100119204 | 162 |
| 397 | 3300031728 | Ga0316578_10014047 | Ga0316578_100140476 | 162 |
| 398 | 3300031728 | Ga0316578_10041677 | Ga0316578_100416772 | 162 |
| 399 | 3300031728 | Ga0316578_10052157 | Ga0316578_100521572 | 162 |
| 400 | 3300031728 | Ga0316578_10145635 | Ga0316578_101456352 | 162 |
| 401 | 3300031728 | Ga0316578_10149855 | Ga0316578_101498553 | 162 |
| 402 | 3300031728 | Ga0316578_10285871 | Ga0316578_102858711 | 162 |
| 403 | 3300031728 | Ga0316578_10509657 | Ga0316578_105096571 | 162 |
| 404 | 3300031728 | Ga0316578_10610440 | Ga0316578_106104401 | 162 |
| 405 | 3300031733 | Ga0316577_10047642 | Ga0316577_100476422 | 162 |
| 406 | 3300031733 | Ga0316577_10089362 | Ga0316577_100893622 | 162 |
| 407 | 3300031733 | Ga0316577_10109267 | Ga0316577_101092672 | 162 |
| 408 | 3300031733 | Ga0316577_10149983 | Ga0316577_101499832 | 162 |
| 409 | 3300032133 | Ga0316583_10000182 | Ga0316583_100001828 | 162 |
| 410 | 3300032133 | Ga0316583_10001812 | Ga0316583_100018125 | 162 |
| 411 | 3300032133 | Ga0316583_10001854 | Ga0316583_100018546 | 162 |
| 412 | 3300032133 | Ga0316583_10005415 | Ga0316583_100054152 | 162 |
| 413 | 3300032133 | Ga0316583_10009721 | Ga0316583_100097213 | 162 |
| 414 | 3300032133 | Ga0316583_10023089 | Ga0316583_100230892 | 162 |
| 415 | 3300032133 | Ga0316583_10030002 | Ga0316583_100300023 | 162 |
| 416 | 3300032133 | Ga0316583_10072408 | Ga0316583_100724083 | 162 |
| 417 | 3300032137 | Ga0316585_10000030 | Ga0316585_100000305 | 162 |
| 418 | 3300032137 | Ga0316585_10001618 | Ga0316585_100016184 | 162 |
| 419 | 3300032137 | Ga0316585_10002641 | Ga0316585_100026416 | 162 |
| 420 | 3300032137 | Ga0316585_10012291 | Ga0316585_100122914 | 162 |
| 421 | 3300032139 | Ga0316580_10000056 | Ga0316580_1000005621 | 162 |
| 422 | 3300032139 | Ga0316580_10006824 | Ga0316580_100068244 | 162 |
| 423 | 3300032139 | Ga0316580_10029294 | Ga0316580_100292942 | 162 |
| 424 | 3300032139 | Ga0316580_10038867 | Ga0316580_100388672 | 162 |
| 425 | 3300033524 | Ga0316592_1009087 | Ga0316592_10090874 | 162 |
| 426 | 3300033524 | Ga0316592_1020412 | Ga0316592_10204121 | 162 |
| 427 | 3300033541 | Ga0316596_1022872 | Ga0316596_10228722 | 162 |
| 428 | 3300033541 | Ga0316596_1042629 | Ga0316596_10426292 | 162 |
| 429 | 3300033541 | Ga0316596_1045808 | Ga0316596_10458083 | 162 |
| 430 | 3300035398 | Ga0316574_0000522 | Ga0316574_0000522_5811_6299 | 162 |
| 431 | 3300035398 | Ga0316574_0002176 | Ga0316574_0002176_2951_3448 | 162 |
| 432 | 3300035398 | Ga0316574_0014587 | Ga0316574_0014587_482_988 | 162 |
| 433 | 3300035398 | Ga0316574_0105245 | Ga0316574_0105245_118_609 | 162 |
| 434 | 3300035398 | Ga0316574_0245932 | Ga0316574_0245932_323_814 | 162 |
| 435 | 3300035398 | Ga0316574_0469679 | Ga0316574_0469679_48_536 | 162 |
| 436 | 3300036647 | Ga0316582_0000428 | Ga0316582_0000428_8881_9369 | 162 |
| 437 | 3300036647 | Ga0316582_0002614 | Ga0316582_0002614_2022_2528 | 162 |
| 438 | 3300036647 | Ga0316582_0003700 | Ga0316582_0003700_4444_4956 | 162 |
| 439 | 3300036647 | Ga0316582_0057783 | Ga0316582_0057783_918_1430 | 162 |
| 440 | 3300036647 | Ga0316582_0177996 | Ga0316582_0177996_229_726 | 162 |
| 441 | 3300036647 | Ga0316582_0238321 | Ga0316582_0238321_719_1207 | 162 |
| 442 | 3300036647 | Ga0316582_0252809 | Ga0316582_0252809_317_808 | 162 |
| 443 | 3300036647 | Ga0316582_0342740 | Ga0316582_0342740_389_886 | 162 |
| 444 | 3300036712 | Ga0316584_0003414 | Ga0316584_0003414_7214_7720 | 162 |
| 445 | 3300036712 | Ga0316584_0016916 | Ga0316584_0016916_2135_2623 | 162 |
| 446 | 3300036712 | Ga0316584_0054179 | Ga0316584_0054179_1026_1517 | 162 |
| 447 | 3300036712 | Ga0316584_0091429 | Ga0316584_0091429_355_852 | 162 |
| 448 | 3300036712 | Ga0316584_0246277 | Ga0316584_0246277_132_620 | 162 |
| 449 | 3300036712 | Ga0316584_0331456 | Ga0316584_0331456_430_921 | 162 |
| 450 | 3300036712 | Ga0316584_0503591 | Ga0316584_0503591_298_810 | 162 |
| 451 | 3300037588 | Ga0316581_0004584 | Ga0316581_0004584_2606_3118 | 162 |
| 452 | 3300038726 | Ga0400490_29105 | Ga0400490_29105_259_771 | 162 |
| 453 | 3300038726 | Ga0400490_29447 | Ga0400490_29447_310_804 | 162 |
| 454 | 3300038735 | Ga0400485_12953 | Ga0400485_12953_6325_6816 | 162 |
| 455 | 3300038741 | Ga0400488_09257 | Ga0400488_09257_988_1479 | 162 |
| 456 | 3300038741 | Ga0400488_20927 | Ga0400488_20927_3936_4427 | 162 |
| 457 | 3300038741 | Ga0400488_61560 | Ga0400488_61560_4807_5298 | 162 |
| 458 | 3300038742 | Ga0400486_25600 | Ga0400486_25600_8770_9261 | 162 |
| 459 | 3300039062 | Ga0400483_010828 | Ga0400483_010828_11258_11749 | 162 |
| 460 | 3300039062 | Ga0400483_016329 | Ga0400483_016329_1087_1575 | 162 |
| 461 | 3300039062 | Ga0400483_035847 | Ga0400483_035847_2695_3198 | 162 |
| 462 | 3300039062 | Ga0400483_167725 | Ga0400483_167725_772_1260 | 162 |
| 463 | 3300039062 | Ga0400483_255949 | Ga0400483_255949_445_933 | 162 |
| 464 | 3300039110 | Ga0400487_28190 | Ga0400487_28190_194_685 | 162 |
| 465 | 3300042876 | Ga0451577_0728998 | Ga0451577_0728998_16_513 | 162 |
| 466 | 3300044673 | Ga0453683_0476983 | Ga0453683_0476983_191_694 | 162 |
| 467 | 3300044712 | Ga0453684_0550832 | Ga0453684_0550832_739_1236 | 162 |
| 468 | 3300050507 | nmdc:mga05p37_934570_c1 | nmdc:mga05p37_934570_c1_320_814 | 162 |
| 469 | 3300050512 | nmdc:mga0n895_206331_c1 | nmdc:mga0n895_206331_c1_715_1203 | 162 |
| 470 | 3300050514 | nmdc:mga08x19_21369_c1 | nmdc:mga08x19_21369_c1_2217_2705 | 162 |
| 471 | 3300050515 | nmdc:mga0a205_741249_c1 | nmdc:mga0a205_741249_c1_211_699 | 162 |
| 472 | 3300005455 | Ga0070663_100939935 | Ga0070663_1009399352 | 163 |
| 473 | 3300006846 | Ga0075430_100180754 | Ga0075430_1001807542 | 163 |
| 474 | 3300006880 | Ga0075429_100253869 | Ga0075429_1002538692 | 163 |
| 475 | 3300031995 | Ga0307409_101105587 | Ga0307409_1011055871 | 163 |
| 476 | 3300041999 | Ga0439433_0002782 | Ga0439433_0002782_577_1101 | 163 |
| 477 | 3300042015 | Ga0439462_0032086 | Ga0439462_0032086_347_871 | 163 |
| 478 | 3300045051 | Ga0451576_0217196 | Ga0451576_0217196_429_932 | 163 |
| 479 | 3300049591 | Ga0501075_0272398 | Ga0501075_0272398_718_1227 | 163 |
| 480 | 3300049822 | Ga0501035_0282968 | Ga0501035_0282968_305_796 | 163 |
| 481 | 3300049824 | Ga0501045_0847667 | Ga0501045_0847667_135_644 | 163 |
| 482 | 3300050510 | nmdc:mga06r32_446280_c1 | nmdc:mga06r32_446280_c1_422_931 | 163 |
| 483 | 3300060353 | Ga0501082_0404475 | Ga0501082_0404475_284_778 | 163 |
| 484 | 3300006163 | Ga0070715_10096971 | Ga0070715_100969712 | 164 |
| 485 | 3300026075 | Ga0207708_10439024 | Ga0207708_104390242 | 164 |
| 486 | 3300031733 | Ga0316577_10003406 | Ga0316577_100034067 | 164 |
| 487 | 3300032002 | Ga0307416_101239182 | Ga0307416_1012391821 | 164 |
| 488 | 3300046454 | Ga0495592_0149168 | Ga0495592_0149168_636_1130 | 164 |
| 489 | 3300047320 | Ga0495672_0024901 | Ga0495672_0024901_301_798 | 164 |
| 490 | 3300047322 | Ga0495680_0130196 | Ga0495680_0130196_235_729 | 164 |
| 491 | 3300049742 | Ga0501080_1203404 | Ga0501080_1203404_20_550 | 164 |
| 492 | 3300053103 | Ga0500555_000372 | Ga0500555_000372_14503_14997 | 164 |
| 493 | 3300053116 | Ga0500592_040023 | Ga0500592_040023_237_731 | 164 |
| 494 | 3300053139 | Ga0500568_0003417 | Ga0500568_0003417_6903_7400 | 164 |
| 495 | 3300053153 | Ga0500616_0002270 | Ga0500616_0002270_5380_5874 | 164 |
| 496 | 3300053731 | Ga0500609_047236 | Ga0500609_047236_19_513 | 164 |
| 497 | 3300059424 | Ga0590075_027686 | Ga0590075_027686_246_776 | 164 |
| 498 | 3300059426 | Ga0590077_076776 | Ga0590077_076776_126_656 | 164 |
| 499 | 3300005367 | Ga0070667_100480464 | Ga0070667_1004804642 | 165 |
| 500 | 3300005457 | Ga0070662_100054119 | Ga0070662_1000541193 | 165 |
| 501 | 3300005466 | Ga0070685_10736612 | Ga0070685_107366122 | 165 |
| 502 | 3300005539 | Ga0068853_100489001 | Ga0068853_1004890011 | 165 |
| 503 | 3300005564 | Ga0070664_100030898 | Ga0070664_1000308985 | 165 |
| 504 | 3300005616 | Ga0068852_100076611 | Ga0068852_1000766113 | 165 |
| 505 | 3300005842 | Ga0068858_100235042 | Ga0068858_1002350422 | 165 |
| 506 | 3300006195 | Ga0075366_10553156 | Ga0075366_105531562 | 165 |
| 507 | 3300006237 | Ga0097621_100041740 | Ga0097621_1000417402 | 165 |
| 508 | 3300006358 | Ga0068871_100109118 | Ga0068871_1001091183 | 165 |
| 509 | 3300006844 | Ga0075428_101181011 | Ga0075428_1011810112 | 165 |
| 510 | 3300006846 | Ga0075430_100134791 | Ga0075430_1001347913 | 165 |
| 511 | 3300006847 | Ga0075431_100558505 | Ga0075431_1005585052 | 165 |
| 512 | 3300006881 | Ga0068865_100162246 | Ga0068865_1001622461 | 165 |
| 513 | 3300009147 | Ga0114129_10849020 | Ga0114129_108490202 | 165 |
| 514 | 3300009148 | Ga0105243_10098573 | Ga0105243_100985733 | 165 |
| 515 | 3300009176 | Ga0105242_10139317 | Ga0105242_101393173 | 165 |
| 516 | 3300009176 | Ga0105242_10329383 | Ga0105242_103293832 | 165 |
| 517 | 3300009176 | Ga0105242_11450394 | Ga0105242_114503942 | 165 |
| 518 | 3300009177 | Ga0105248_10467242 | Ga0105248_104672422 | 165 |
| 519 | 3300009177 | Ga0105248_11453137 | Ga0105248_114531372 | 165 |
| 520 | 3300010375 | Ga0105239_10350821 | Ga0105239_103508213 | 165 |
| 521 | 3300013297 | Ga0157378_10800102 | Ga0157378_108001022 | 165 |
| 522 | 3300013306 | Ga0163162_11929475 | Ga0163162_119294752 | 165 |
| 523 | 3300013307 | Ga0157372_12149589 | Ga0157372_121495892 | 165 |
| 524 | 3300014968 | Ga0157379_10474634 | Ga0157379_104746342 | 165 |
| 525 | 3300017792 | Ga0163161_10020936 | Ga0163161_100209365 | 165 |
| 526 | 3300025903 | Ga0207680_10995913 | Ga0207680_109959131 | 165 |
| 527 | 3300025907 | Ga0207645_10017428 | Ga0207645_100174283 | 165 |
| 528 | 3300025911 | Ga0207654_10263843 | Ga0207654_102638432 | 165 |
| 529 | 3300025925 | Ga0207650_10108818 | Ga0207650_101088183 | 165 |
| 530 | 3300025933 | Ga0207706_10089304 | Ga0207706_100893042 | 165 |
| 531 | 3300025934 | Ga0207686_10555384 | Ga0207686_105553842 | 165 |
| 532 | 3300025935 | Ga0207709_10150320 | Ga0207709_101503202 | 165 |
| 533 | 3300025938 | Ga0207704_10326423 | Ga0207704_103264232 | 165 |
| 534 | 3300025938 | Ga0207704_10745405 | Ga0207704_107454051 | 165 |
| 535 | 3300025940 | Ga0207691_10142021 | Ga0207691_101420212 | 165 |
| 536 | 3300025944 | Ga0207661_10218080 | Ga0207661_102180802 | 165 |
| 537 | 3300025986 | Ga0207658_11030391 | Ga0207658_110303912 | 165 |
| 538 | 3300026023 | Ga0207677_10095799 | Ga0207677_100957992 | 165 |
| 539 | 3300026088 | Ga0207641_10199963 | Ga0207641_101999632 | 165 |
| 540 | 3300026089 | Ga0207648_10080772 | Ga0207648_100807722 | 165 |
| 541 | 3300026095 | Ga0207676_11920204 | Ga0207676_119202041 | 165 |
| 542 | 3300026121 | Ga0207683_10239430 | Ga0207683_102394302 | 165 |
| 543 | 3300026142 | Ga0207698_10214635 | Ga0207698_102146353 | 165 |
| 544 | 3300028381 | Ga0268264_10871185 | Ga0268264_108711852 | 165 |
| 545 | 3300031344 | Ga0265316_10120765 | Ga0265316_101207653 | 165 |
| 546 | 3300031665 | Ga0316575_10176569 | Ga0316575_101765691 | 165 |
| 547 | 3300031728 | Ga0316578_10036238 | Ga0316578_100362382 | 165 |
| 548 | 3300032137 | Ga0316585_10043724 | Ga0316585_100437241 | 165 |
| 549 | 3300036647 | Ga0316582_0001511 | Ga0316582_0001511_7309_7815 | 165 |
| 550 | 3300036647 | Ga0316582_0032367 | Ga0316582_0032367_951_1457 | 165 |
| 551 | 3300036647 | Ga0316582_0256018 | Ga0316582_0256018_490_996 | 165 |
| 552 | 3300036647 | Ga0316582_0430475 | Ga0316582_0430475_45_554 | 165 |
| 553 | 3300036712 | Ga0316584_0046916 | Ga0316584_0046916_145_651 | 165 |
| 554 | 3300036712 | Ga0316584_0097107 | Ga0316584_0097107_69_578 | 165 |
| 555 | 3300036712 | Ga0316584_0254697 | Ga0316584_0254697_467_973 | 165 |
| 556 | 3300037588 | Ga0316581_0057481 | Ga0316581_0057481_677_1183 | 165 |
| 557 | 3300039062 | Ga0400483_034219 | Ga0400483_034219_6739_7239 | 165 |
| 558 | 3300048903 | Ga0496100_0532047 | Ga0496100_0532047_246_743 | 165 |
| 559 | 3300048904 | Ga0496101_0316482 | Ga0496101_0316482_494_991 | 165 |
| 560 | 3300048909 | Ga0496106_0521570 | Ga0496106_0521570_152_649 | 165 |
| 561 | 3300048911 | Ga0496108_0197696 | Ga0496108_0197696_1130_1627 | 165 |
| 562 | 3300048912 | Ga0496109_0218451 | Ga0496109_0218451_349_846 | 165 |
| 563 | 3300048914 | Ga0496111_0133642 | Ga0496111_0133642_1283_1780 | 165 |
| 564 | 3300048917 | Ga0496114_0008895 | Ga0496114_0008895_4047_4544 | 165 |
| 565 | 3300048917 | Ga0496114_0099260 | Ga0496114_0099260_730_1227 | 165 |
| 566 | 3300048918 | Ga0496115_0086623 | Ga0496115_0086623_721_1218 | 165 |
| 567 | 3300048918 | Ga0496115_0461975 | Ga0496115_0461975_461_958 | 165 |
| 568 | 3300049824 | Ga0501045_0495946 | Ga0501045_0495946_22_552 | 165 |
| 569 | 3300050491 | nmdc:mga00v17_214036_c1 | nmdc:mga00v17_214036_c1_164_679 | 165 |
| 570 | 3300050493 | nmdc:mga0k408_62255_c1 | nmdc:mga0k408_62255_c1_16_516 | 165 |
| 571 | 3300050507 | nmdc:mga05p37_1134093_c1 | nmdc:mga05p37_1134093_c1_96_629 | 165 |
| 572 | 3300050510 | nmdc:mga06r32_288005_c1 | nmdc:mga06r32_288005_c1_791_1324 | 165 |
| 573 | 3300054114 | Ga0501084_0086510 | Ga0501084_0086510_1506_2036 | 165 |
| 574 | 3300060353 | Ga0501082_0461451 | Ga0501082_0461451_27_557 | 165 |
| 575 | 3300005293 | Ga0065715_10144946 | Ga0065715_101449462 | 166 |
| 576 | 3300005293 | Ga0065715_10227519 | Ga0065715_102275191 | 166 |
| 577 | 3300005441 | Ga0070700_100290856 | Ga0070700_1002908562 | 166 |
| 578 | 3300009177 | Ga0105248_11669217 | Ga0105248_116692172 | 166 |
| 579 | 3300025941 | Ga0207711_10412483 | Ga0207711_104124832 | 166 |
| 580 | 3300026075 | Ga0207708_10210300 | Ga0207708_102103002 | 166 |
| 581 | 3300038727 | Ga0400491_29415 | Ga0400491_29415_2438_2971 | 166 |
| 582 | 3300042184 | Ga0450908_001456 | Ga0450908_001456_88_621 | 166 |
| 583 | 3300049588 | Ga0501072_0492218 | Ga0501072_0492218_18_551 | 166 |
| 584 | 3300050510 | nmdc:mga06r32_484667_c1 | nmdc:mga06r32_484667_c1_379_912 | 166 |
| 585 | 3300054114 | Ga0501084_0156341 | Ga0501084_0156341_1196_1729 | 166 |
| 586 | 3300039062 | Ga0400483_061632 | Ga0400483_061632_7744_8310 | 168 |
| 587 | 3300044712 | Ga0453684_0445850 | Ga0453684_0445850_611_1183 | 168 |
| 588 | 3300005293 | Ga0065715_10502506 | Ga0065715_105025062 | 169 |
| 589 | 3300005295 | Ga0065707_10106345 | Ga0065707_101063452 | 169 |
| 590 | 3300025933 | Ga0207706_11077868 | Ga0207706_110778681 | 169 |
| 591 | 3300037471 | Ga0395905_0110478 | Ga0395905_0110478_1167_1682 | 169 |
| 592 | 3300042012 | Ga0439455_0061706 | Ga0439455_0061706_96_611 | 169 |
| 593 | 3300042439 | Ga0439464_0003729 | Ga0439464_0003729_169_684 | 169 |
| 594 | 3300005518 | Ga0070699_101137803 | Ga0070699_1011378031 | 171 |
| 595 | 3300005549 | Ga0070704_100492093 | Ga0070704_1004920932 | 171 |
| 596 | 3300014326 | Ga0157380_12255688 | Ga0157380_122556881 | 171 |
| 597 | 3300028380 | Ga0268265_10957356 | Ga0268265_109573562 | 171 |
| 598 | 3300042122 | Ga0450920_048126 | Ga0450920_048126_132_647 | 171 |
| 599 | 3300042131 | Ga0450894_005829 | Ga0450894_005829_161_676 | 171 |
| 600 | 3300042133 | Ga0450896_001951 | Ga0450896_001951_1304_1819 | 171 |
| 601 | 3300042531 | Ga0450918_016535 | Ga0450918_016535_459_974 | 171 |
| 602 | 2162886011 | MRS1b_contig_5547123 | MRS1b_0334.00001900 | 172 |
| 603 | 3300005293 | Ga0065715_10005160 | Ga0065715_100051603 | 172 |
| 604 | 3300005331 | Ga0070670_100008752 | Ga0070670_1000087525 | 172 |
| 605 | 3300005353 | Ga0070669_100081037 | Ga0070669_1000810372 | 172 |
| 606 | 3300005354 | Ga0070675_100033155 | Ga0070675_1000331553 | 172 |
| 607 | 3300005355 | Ga0070671_100728976 | Ga0070671_1007289762 | 172 |
| 608 | 3300005356 | Ga0070674_100107356 | Ga0070674_1001073562 | 172 |
| 609 | 3300005365 | Ga0070688_100018132 | Ga0070688_1000181324 | 172 |
| 610 | 3300005459 | Ga0068867_100430239 | Ga0068867_1004302392 | 172 |
| 611 | 3300005466 | Ga0070685_10076878 | Ga0070685_100768782 | 172 |
| 612 | 3300005543 | Ga0070672_100003964 | Ga0070672_1000039643 | 172 |
| 613 | 3300005544 | Ga0070686_100058831 | Ga0070686_1000588312 | 172 |
| 614 | 3300005548 | Ga0070665_100076194 | Ga0070665_1000761943 | 172 |
| 615 | 3300005564 | Ga0070664_100861406 | Ga0070664_1008614062 | 172 |
| 616 | 3300005618 | Ga0068864_100008813 | Ga0068864_1000088134 | 172 |
| 617 | 3300005719 | Ga0068861_100185407 | Ga0068861_1001854073 | 172 |
| 618 | 3300005840 | Ga0068870_10216016 | Ga0068870_102160162 | 172 |
| 619 | 3300005843 | Ga0068860_100165429 | Ga0068860_1001654292 | 172 |
| 620 | 3300006237 | Ga0097621_100382798 | Ga0097621_1003827982 | 172 |
| 621 | 3300006358 | Ga0068871_100254285 | Ga0068871_1002542853 | 172 |
| 622 | 3300009098 | Ga0105245_10269974 | Ga0105245_102699742 | 172 |
| 623 | 3300009176 | Ga0105242_10148776 | Ga0105242_101487763 | 172 |
| 624 | 3300009177 | Ga0105248_10014811 | Ga0105248_100148112 | 172 |
| 625 | 3300009545 | Ga0105237_11214851 | Ga0105237_112148512 | 172 |
| 626 | 3300009553 | Ga0105249_10016809 | Ga0105249_100168095 | 172 |
| 627 | 3300010375 | Ga0105239_10609676 | Ga0105239_106096762 | 172 |
| 628 | 3300013306 | Ga0163162_10062145 | Ga0163162_100621453 | 172 |
| 629 | 3300013308 | Ga0157375_11171752 | Ga0157375_111717522 | 172 |
| 630 | 3300025899 | Ga0207642_10032915 | Ga0207642_100329152 | 172 |
| 631 | 3300025908 | Ga0207643_10033609 | Ga0207643_100336093 | 172 |
| 632 | 3300025923 | Ga0207681_10735088 | Ga0207681_107350882 | 172 |
| 633 | 3300025925 | Ga0207650_10134031 | Ga0207650_101340312 | 172 |
| 634 | 3300025926 | Ga0207659_10004392 | Ga0207659_100043929 | 172 |
| 635 | 3300025931 | Ga0207644_10077512 | Ga0207644_100775123 | 172 |
| 636 | 3300025934 | Ga0207686_10403801 | Ga0207686_104038011 | 172 |
| 637 | 3300025940 | Ga0207691_10008714 | Ga0207691_1000871410 | 172 |
| 638 | 3300025941 | Ga0207711_10089417 | Ga0207711_100894173 | 172 |
| 639 | 3300025945 | Ga0207679_10092276 | Ga0207679_100922762 | 172 |
| 640 | 3300025961 | Ga0207712_10948692 | Ga0207712_109486922 | 172 |
| 641 | 3300026089 | Ga0207648_10348635 | Ga0207648_103486352 | 172 |
| 642 | 3300026095 | Ga0207676_10134202 | Ga0207676_101342023 | 172 |
| 643 | 3300026118 | Ga0207675_100242896 | Ga0207675_1002428963 | 172 |
| 644 | 3300026121 | Ga0207683_10080735 | Ga0207683_100807352 | 172 |
| 645 | 3300028379 | Ga0268266_10063251 | Ga0268266_100632513 | 172 |
| 646 | 3300048904 | Ga0496101_0243653 | Ga0496101_0243653_864_1382 | 172 |
| 647 | 3300048907 | Ga0496104_0006688 | Ga0496104_0006688_8076_8594 | 172 |
| 648 | 3300048908 | Ga0496105_0064903 | Ga0496105_0064903_1030_1548 | 172 |
| 649 | 3300048909 | Ga0496106_0284405 | Ga0496106_0284405_110_628 | 172 |
| 650 | 3300048909 | Ga0496106_0940108 | Ga0496106_0940108_84_602 | 172 |
| 651 | 3300048912 | Ga0496109_0020083 | Ga0496109_0020083_1484_2002 | 172 |
| 652 | 3300048915 | Ga0496112_0033300 | Ga0496112_0033300_531_1049 | 172 |
| 653 | 3300048916 | Ga0496113_0057491 | Ga0496113_0057491_2238_2756 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9891 | 10 | 163 |
| 6qmi-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. | 0.9851 | 10 | 164 |
| 5o0a-assembly1.cif.gz_B | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) | 0.9799 | 10 | 163 |
| 6b7b-assembly1.cif.gz_A | crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole | 0.9788 | 9 | 163 |
| 1qjc-assembly1.cif.gz_B | phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine | 0.9775 | 10 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9851 | 10 | 164 | 3.40.50.620 |
| 4f3rC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9686 | 10 | 161 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9617 | 10 | 163 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9617 | 8 | 163 | 3.40.50.620 |
| 3nd7D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9587 | 9 | 163 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A317HKL8-F1-model_v4 | Pantetheine-phosphate adenylyltransferase (EC 2.7.7.3) | 0.99 | 9 | 165 |
GO:0004595
GO:0005737 GO:0015937 |
| AF-A0A3R6UXW5-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9899 | 10 | 161 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A2H1XZY7-F1-model_v4 | deleted | 0.9885 | 10 | 157 |
|
| AF-A0A0R1T341-F1-model_v4 | deleted | 0.9878 | 10 | 163 |
|
| AF-B1WS35-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9876 | 11 | 163 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar