F473203
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 316 | 1316 | 465 |
Family's Representative Sequence
| Representative Sequence | 3300046642|Ga0495634_0007216|Ga0495634_0007216_29_1609 |
| Length | 517 |
| Sequence | MIKSEQHSVDRRNFLKITAGTAAALVASAPRAGGQENSDRPSNKQTSGERKTKVDAPAGERTAERSANNPYTQGMAAFISGLRYEQIPAEVIDRIKLLMLDSLGCAIYGVDLEWSRILMRTLKELDSSNSCGVWGTSLRLSAPHAALVNGTLVHGFELDDIHRLGVMHVGAVTLPSLLAVTEIKPGISGRDFLTAAVAGYEIGPRVGRCMGEEHIGQGWHSAATVGVFSRLSREQTVHALGIAGTQSAGLMAAEYGSMVLRMHTGRSAQSGLYGGLLAAKGFTGIVNVFESTYGGFCTTFSRSQDRFDLAELTSGLGTRFETMQVSLKFYSCVSSNHTTLDAIRAIRARRSFSVGEVDHIIVHGSQVTVDHVGWKYRPDGISAAQLNLPFCVATLLLDGDVFVDQFTALKIVDPVRIALADKVEVVADPEIVARGSEFRQMVRAEIFLKDGTVLTETIETPRGSERNFASKSDVVGKFENLAGHAIPRARAAAIQEAVLNLETLPDSSRLANLLTKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 303 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 304 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 305 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 306 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 307 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 308 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 309 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 310 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 311 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 312 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 313 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 314 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 315 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 316 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.72 |
| Metatranscriptomes | 0 |
| Isolates | 2.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.67 |
| Nodule | 0.76 |
| Rhizoplane | 6.84 |
| Rhizosphere | 87.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495634_0007216 | 3300046642 | Bacteria | 8378 |
| 2 | JGI24750J21931_1001266 | 3300002070 | Bacteria | 3194 |
| 3 | JGI24742J22300_10000928 | 3300002244 | Bacteria | 4472 |
| 4 | JGI25151J46595_10003207 | 3300003187 | Bacteria | 9164 |
| 5 | rootH1_10097723 | 3300003323 | Bacteria | 3805 |
| 6 | Ga0065712_10010748 | 3300005290 | Bacteria | 2155 |
| 7 | Ga0065712_10105777 | 3300005290 | Bacteria | 1920 |
| 8 | Ga0070658_10014828 | 3300005327 | Bacteria | 6245 |
| 9 | Ga0070658_10032865 | 3300005327 | Bacteria | 4172 |
| 10 | Ga0070658_10063027 | 3300005327 | Bacteria | 3022 |
| 11 | Ga0070676_10027837 | 3300005328 | Bacteria | 3208 |
| 12 | Ga0070683_100001114 | 3300005329 | Bacteria | 20301 |
| 13 | Ga0070683_100001248 | 3300005329 | Bacteria | 19351 |
| 14 | Ga0070690_100024232 | 3300005330 | Bacteria | 3730 |
| 15 | Ga0070670_100001277 | 3300005331 | Bacteria | 20065 |
| 16 | Ga0070670_100002839 | 3300005331 | Bacteria | 14325 |
| 17 | Ga0070670_100003204 | 3300005331 | Bacteria | 13509 |
| 18 | Ga0070670_100061716 | 3300005331 | Bacteria | 3217 |
| 19 | Ga0070670_100077089 | 3300005331 | Bacteria | 2864 |
| 20 | Ga0070670_100095271 | 3300005331 | Bacteria | 2560 |
| 21 | Ga0070677_10003682 | 3300005333 | Bacteria | 4953 |
| 22 | Ga0070677_10023089 | 3300005333 | Bacteria | 2299 |
| 23 | Ga0070677_10056765 | 3300005333 | Bacteria | 1602 |
| 24 | Ga0070666_10057991 | 3300005335 | Bacteria | 2617 |
| 25 | Ga0070680_100017231 | 3300005336 | Bacteria | 5693 |
| 26 | Ga0068868_100000410 | 3300005338 | Bacteria | 28968 |
| 27 | Ga0068868_100001321 | 3300005338 | Bacteria | 17082 |
| 28 | Ga0068868_100063223 | 3300005338 | Bacteria | 2936 |
| 29 | Ga0070689_100055569 | 3300005340 | Bacteria | 3068 |
| 30 | Ga0070687_100005754 | 3300005343 | Bacteria | 5032 |
| 31 | Ga0070661_100000923 | 3300005344 | Bacteria | 21058 |
| 32 | Ga0070661_100003988 | 3300005344 | Bacteria | 10154 |
| 33 | Ga0070661_100061340 | 3300005344 | Bacteria | 2760 |
| 34 | Ga0070669_100171565 | 3300005353 | Bacteria | 1691 |
| 35 | Ga0070675_100000071 | 3300005354 | Bacteria | 59417 |
| 36 | Ga0070675_100000793 | 3300005354 | Bacteria | 22161 |
| 37 | Ga0070671_100001499 | 3300005355 | Bacteria | 17468 |
| 38 | Ga0070674_100063360 | 3300005356 | Bacteria | 2587 |
| 39 | Ga0070674_100103655 | 3300005356 | Bacteria | 2077 |
| 40 | Ga0070673_100000149 | 3300005364 | Bacteria | 33510 |
| 41 | Ga0070673_100065651 | 3300005364 | Bacteria | 2896 |
| 42 | Ga0070673_100149443 | 3300005364 | Bacteria | 1977 |
| 43 | Ga0070673_100179422 | 3300005364 | Bacteria | 1812 |
| 44 | Ga0070659_100016067 | 3300005366 | Bacteria | 5616 |
| 45 | Ga0070667_100051010 | 3300005367 | Bacteria | 3487 |
| 46 | Ga0070667_100075575 | 3300005367 | Bacteria | 2876 |
| 47 | Ga0070713_100000870 | 3300005436 | Bacteria | 19329 |
| 48 | Ga0070713_100006605 | 3300005436 | Bacteria | 8061 |
| 49 | Ga0070713_100136935 | 3300005436 | Bacteria | 2165 |
| 50 | Ga0070710_10016803 | 3300005437 | Bacteria | 3731 |
| 51 | Ga0070711_100015513 | 3300005439 | Bacteria | 4825 |
| 52 | Ga0070700_100010063 | 3300005441 | Bacteria | 5206 |
| 53 | Ga0070694_100073118 | 3300005444 | Bacteria | 2367 |
| 54 | Ga0070708_100242222 | 3300005445 | Unclassified | 1693 |
| 55 | Ga0070663_100014372 | 3300005455 | Bacteria | 5081 |
| 56 | Ga0070678_100000010 | 3300005456 | Bacteria | 58577 |
| 57 | Ga0070678_100000373 | 3300005456 | Bacteria | 20912 |
| 58 | Ga0070678_100052822 | 3300005456 | Bacteria | 2952 |
| 59 | Ga0070681_10009601 | 3300005458 | Bacteria | 9513 |
| 60 | Ga0070681_10054888 | 3300005458 | Bacteria | 3969 |
| 61 | Ga0068867_100018813 | 3300005459 | Bacteria | 4914 |
| 62 | Ga0068867_100037683 | 3300005459 | Bacteria | 3515 |
| 63 | Ga0070685_10009635 | 3300005466 | Bacteria | 4999 |
| 64 | Ga0070707_100040082 | 3300005468 | Bacteria | 4479 |
| 65 | Ga0070699_100038745 | 3300005518 | Bacteria | 4127 |
| 66 | Ga0070697_100042401 | 3300005536 | Bacteria | 3683 |
| 67 | Ga0070672_100000312 | 3300005543 | Bacteria | 27513 |
| 68 | Ga0070672_100000909 | 3300005543 | Bacteria | 17718 |
| 69 | Ga0070672_100106850 | 3300005543 | Bacteria | 2277 |
| 70 | Ga0070695_100019408 | 3300005545 | Bacteria | 4140 |
| 71 | Ga0070695_100066573 | 3300005545 | Unclassified | 2348 |
| 72 | Ga0070704_100190634 | 3300005549 | Bacteria | 1648 |
| 73 | Ga0068855_100029244 | 3300005563 | Bacteria | 6590 |
| 74 | Ga0068855_100029314 | 3300005563 | Bacteria | 6580 |
| 75 | Ga0068855_100199259 | 3300005563 | Bacteria | 2255 |
| 76 | Ga0068855_100216522 | 3300005563 | Bacteria | 2150 |
| 77 | Ga0070664_100000179 | 3300005564 | Bacteria | 44681 |
| 78 | Ga0070664_100002026 | 3300005564 | Bacteria | 16244 |
| 79 | Ga0068854_100040322 | 3300005578 | Bacteria | 3295 |
| 80 | Ga0068852_100000828 | 3300005616 | Bacteria | 20438 |
| 81 | Ga0068852_100002798 | 3300005616 | Bacteria | 12085 |
| 82 | Ga0068852_100014313 | 3300005616 | Bacteria | 6101 |
| 83 | Ga0068852_100036862 | 3300005616 | Bacteria | 4096 |
| 84 | Ga0068859_100177933 | 3300005617 | Bacteria | 2209 |
| 85 | Ga0068864_100001555 | 3300005618 | Bacteria | 18895 |
| 86 | Ga0068864_100026648 | 3300005618 | Bacteria | 4874 |
| 87 | Ga0068864_100105263 | 3300005618 | Bacteria | 2507 |
| 88 | Ga0068864_100123609 | 3300005618 | Bacteria | 2316 |
| 89 | Ga0068851_10000460 | 3300005834 | Bacteria | 17963 |
| 90 | Ga0068870_10003702 | 3300005840 | Bacteria | 6496 |
| 91 | Ga0068863_100008612 | 3300005841 | Bacteria | 9970 |
| 92 | Ga0068863_100028706 | 3300005841 | Bacteria | 5312 |
| 93 | Ga0068863_100113454 | 3300005841 | Bacteria | 2581 |
| 94 | Ga0068858_100076882 | 3300005842 | Bacteria | 3100 |
| 95 | Ga0068858_100109782 | 3300005842 | Bacteria | 2575 |
| 96 | Ga0068860_100195206 | 3300005843 | Bacteria | 1960 |
| 97 | Ga0068860_100209543 | 3300005843 | Bacteria | 1890 |
| 98 | Ga0081455_10006987 | 3300005937 | Bacteria | 11993 |
| 99 | Ga0081540_1000015 | 3300005983 | Bacteria | 178704 |
| 100 | Ga0070717_10025797 | 3300006028 | Bacteria | 4681 |
| 101 | Ga0075365_10000662 | 3300006038 | Bacteria | 13766 |
| 102 | Ga0075363_100004310 | 3300006048 | Bacteria | 6194 |
| 103 | Ga0097621_100000056 | 3300006237 | Bacteria | 59138 |
| 104 | Ga0097621_100000761 | 3300006237 | Bacteria | 22608 |
| 105 | Ga0097621_100059374 | 3300006237 | Bacteria | 3131 |
| 106 | Ga0075370_10026536 | 3300006353 | Bacteria | 3209 |
| 107 | Ga0075370_10041441 | 3300006353 | Bacteria | 2599 |
| 108 | Ga0068871_100000774 | 3300006358 | Bacteria | 21535 |
| 109 | Ga0068871_100030458 | 3300006358 | Bacteria | 4249 |
| 110 | Ga0068871_100140432 | 3300006358 | Bacteria | 2054 |
| 111 | Ga0075428_100002507 | 3300006844 | Bacteria | 19942 |
| 112 | Ga0075428_100148536 | 3300006844 | Bacteria | 2547 |
| 113 | Ga0075428_100152086 | 3300006844 | Bacteria | 2514 |
| 114 | Ga0075430_100000747 | 3300006846 | Bacteria | 25006 |
| 115 | Ga0075431_100037913 | 3300006847 | Bacteria | 4963 |
| 116 | Ga0075431_100093494 | 3300006847 | Bacteria | 3103 |
| 117 | Ga0075434_100076792 | 3300006871 | Bacteria | 3335 |
| 118 | Ga0075434_100201361 | 3300006871 | Bacteria | 2011 |
| 119 | Ga0075429_100044461 | 3300006880 | Bacteria | 3863 |
| 120 | Ga0075429_100046477 | 3300006880 | Bacteria | 3777 |
| 121 | Ga0075436_100004335 | 3300006914 | Bacteria | 9736 |
| 122 | Ga0075436_100011918 | 3300006914 | Bacteria | 5964 |
| 123 | Ga0097620_100177927 | 3300006931 | Bacteria | 2209 |
| 124 | Ga0075435_100078885 | 3300007076 | Bacteria | 2701 |
| 125 | Ga0075435_100145458 | 3300007076 | Bacteria | 1991 |
| 126 | Ga0099795_10000578 | 3300007788 | Bacteria | 6961 |
| 127 | Ga0105240_10024423 | 3300009093 | Bacteria | 7965 |
| 128 | Ga0111539_10068503 | 3300009094 | Bacteria | 4189 |
| 129 | Ga0111539_10112275 | 3300009094 | Bacteria | 3197 |
| 130 | Ga0111539_10171590 | 3300009094 | Bacteria | 2534 |
| 131 | Ga0114129_10029908 | 3300009147 | Bacteria | 7713 |
| 132 | Ga0114129_10073179 | 3300009147 | Bacteria | 4775 |
| 133 | Ga0114129_10088023 | 3300009147 | Bacteria | 4306 |
| 134 | Ga0114129_10293365 | 3300009147 | Bacteria | 2169 |
| 135 | Ga0105248_10023630 | 3300009177 | Bacteria | 6829 |
| 136 | Ga0105248_10030350 | 3300009177 | Bacteria | 6035 |
| 137 | Ga0105248_10181994 | 3300009177 | Bacteria | 2368 |
| 138 | Ga0105248_10325795 | 3300009177 | Bacteria | 1730 |
| 139 | Ga0099796_10020942 | 3300010159 | Bacteria | 2006 |
| 140 | Ga0157374_10000729 | 3300013296 | Bacteria | 28724 |
| 141 | Ga0157374_10001930 | 3300013296 | Bacteria | 17393 |
| 142 | Ga0157374_10070369 | 3300013296 | Bacteria | 3297 |
| 143 | Ga0157378_10003430 | 3300013297 | Bacteria | 14070 |
| 144 | Ga0157378_10007916 | 3300013297 | Bacteria | 9272 |
| 145 | Ga0157378_10164516 | 3300013297 | Bacteria | 2077 |
| 146 | Ga0163162_10001281 | 3300013306 | Bacteria | 23539 |
| 147 | Ga0163162_10007039 | 3300013306 | Bacteria | 10904 |
| 148 | Ga0163162_10026510 | 3300013306 | Bacteria | 5727 |
| 149 | Ga0157372_10175542 | 3300013307 | Bacteria | 2480 |
| 150 | Ga0157372_10194490 | 3300013307 | Bacteria | 2349 |
| 151 | Ga0157375_10002204 | 3300013308 | Bacteria | 16840 |
| 152 | Ga0157375_10003743 | 3300013308 | Bacteria | 13196 |
| 153 | Ga0157375_10030147 | 3300013308 | Bacteria | 5111 |
| 154 | Ga0157375_10110257 | 3300013308 | Bacteria | 2849 |
| 155 | Ga0163163_10014783 | 3300014325 | Bacteria | 7184 |
| 156 | Ga0163163_10150452 | 3300014325 | Bacteria | 2372 |
| 157 | Ga0157379_10026622 | 3300014968 | Bacteria | 5148 |
| 158 | Ga0157376_10010135 | 3300014969 | Bacteria | 6882 |
| 159 | Ga0157376_10019293 | 3300014969 | Bacteria | 5251 |
| 160 | Ga0157376_10050250 | 3300014969 | Bacteria | 3459 |
| 161 | Ga0157376_10069317 | 3300014969 | Bacteria | 2989 |
| 162 | Ga0213875_10004743 | 3300021388 | Bacteria | 7395 |
| 163 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 164 | Ga0207697_10005175 | 3300025315 | Bacteria | 6088 |
| 165 | Ga0207656_10000449 | 3300025321 | Bacteria | 13758 |
| 166 | Ga0207682_10004778 | 3300025893 | Bacteria | 5613 |
| 167 | Ga0207682_10005745 | 3300025893 | Bacteria | 5031 |
| 168 | Ga0207682_10006398 | 3300025893 | Bacteria | 4746 |
| 169 | Ga0207692_10032563 | 3300025898 | Bacteria | 2506 |
| 170 | Ga0207688_10005568 | 3300025901 | Bacteria | 6849 |
| 171 | Ga0207688_10031318 | 3300025901 | Bacteria | 2936 |
| 172 | Ga0207680_10031812 | 3300025903 | Bacteria | 2993 |
| 173 | Ga0207645_10026467 | 3300025907 | Bacteria | 3748 |
| 174 | Ga0207645_10027285 | 3300025907 | Bacteria | 3689 |
| 175 | Ga0207645_10040519 | 3300025907 | Bacteria | 2982 |
| 176 | Ga0207643_10002035 | 3300025908 | Bacteria | 11158 |
| 177 | Ga0207705_10011650 | 3300025909 | Bacteria | 6352 |
| 178 | Ga0207684_10087908 | 3300025910 | Bacteria | 2648 |
| 179 | Ga0207707_10097415 | 3300025912 | Bacteria | 2570 |
| 180 | Ga0207707_10103866 | 3300025912 | Bacteria | 2483 |
| 181 | Ga0207663_10129564 | 3300025916 | Unclassified | 1741 |
| 182 | Ga0207660_10035713 | 3300025917 | Bacteria | 3452 |
| 183 | Ga0207660_10180079 | 3300025917 | Bacteria | 1641 |
| 184 | Ga0207662_10005039 | 3300025918 | Bacteria | 6996 |
| 185 | Ga0207662_10014029 | 3300025918 | Bacteria | 4488 |
| 186 | Ga0207662_10055906 | 3300025918 | Bacteria | 2356 |
| 187 | Ga0207662_10057093 | 3300025918 | Bacteria | 2332 |
| 188 | Ga0207657_10049054 | 3300025919 | Bacteria | 3682 |
| 189 | Ga0207657_10059744 | 3300025919 | Bacteria | 3274 |
| 190 | Ga0207657_10113392 | 3300025919 | Bacteria | 2236 |
| 191 | Ga0207649_10004827 | 3300025920 | Bacteria | 7292 |
| 192 | Ga0207649_10071121 | 3300025920 | Bacteria | 2221 |
| 193 | Ga0207649_10144829 | 3300025920 | Bacteria | 1630 |
| 194 | Ga0207646_10054665 | 3300025922 | Bacteria | 3571 |
| 195 | Ga0207681_10073295 | 3300025923 | Bacteria | 2394 |
| 196 | Ga0207650_10001859 | 3300025925 | Bacteria | 14883 |
| 197 | Ga0207650_10002001 | 3300025925 | Bacteria | 14277 |
| 198 | Ga0207650_10003953 | 3300025925 | Bacteria | 10141 |
| 199 | Ga0207650_10004434 | 3300025925 | Bacteria | 9589 |
| 200 | Ga0207650_10115869 | 3300025925 | Bacteria | 2080 |
| 201 | Ga0207659_10000756 | 3300025926 | Bacteria | 19182 |
| 202 | Ga0207659_10047343 | 3300025926 | Bacteria | 3041 |
| 203 | Ga0207659_10064728 | 3300025926 | Bacteria | 2647 |
| 204 | Ga0207700_10107367 | 3300025928 | Bacteria | 2240 |
| 205 | Ga0207644_10000182 | 3300025931 | Bacteria | 44971 |
| 206 | Ga0207644_10001114 | 3300025931 | Bacteria | 17235 |
| 207 | Ga0207644_10064408 | 3300025931 | Bacteria | 2663 |
| 208 | Ga0207706_10012119 | 3300025933 | Bacteria | 7853 |
| 209 | Ga0207706_10061191 | 3300025933 | Bacteria | 3315 |
| 210 | Ga0207670_10064533 | 3300025936 | Bacteria | 2510 |
| 211 | Ga0207669_10077955 | 3300025937 | Bacteria | 2109 |
| 212 | Ga0207669_10097614 | 3300025937 | Bacteria | 1932 |
| 213 | Ga0207704_10076465 | 3300025938 | Bacteria | 2145 |
| 214 | Ga0207704_10087305 | 3300025938 | Bacteria | 2037 |
| 215 | Ga0207691_10000678 | 3300025940 | Bacteria | 33621 |
| 216 | Ga0207691_10001156 | 3300025940 | Bacteria | 26211 |
| 217 | Ga0207691_10064030 | 3300025940 | Bacteria | 3333 |
| 218 | Ga0207711_10012082 | 3300025941 | Bacteria | 7177 |
| 219 | Ga0207711_10025993 | 3300025941 | Bacteria | 4911 |
| 220 | Ga0207711_10051184 | 3300025941 | Bacteria | 3537 |
| 221 | Ga0207711_10098834 | 3300025941 | Bacteria | 2579 |
| 222 | Ga0207689_10038282 | 3300025942 | Bacteria | 3973 |
| 223 | Ga0207661_10001359 | 3300025944 | Bacteria | 16398 |
| 224 | Ga0207661_10094719 | 3300025944 | Bacteria | 2495 |
| 225 | Ga0207679_10023955 | 3300025945 | Bacteria | 4181 |
| 226 | Ga0207679_10134818 | 3300025945 | Bacteria | 1987 |
| 227 | Ga0207667_10071075 | 3300025949 | Bacteria | 3620 |
| 228 | Ga0207667_10167063 | 3300025949 | Bacteria | 2262 |
| 229 | Ga0207651_10021614 | 3300025960 | Bacteria | 3914 |
| 230 | Ga0207651_10069604 | 3300025960 | Bacteria | 2485 |
| 231 | Ga0207668_10162177 | 3300025972 | Bacteria | 1743 |
| 232 | Ga0207640_10039827 | 3300025981 | Bacteria | 2977 |
| 233 | Ga0207658_10017093 | 3300025986 | Bacteria | 4996 |
| 234 | Ga0207677_10002173 | 3300026023 | Bacteria | 10305 |
| 235 | Ga0207677_10150407 | 3300026023 | Unclassified | 1795 |
| 236 | Ga0207703_10031279 | 3300026035 | Bacteria | 4207 |
| 237 | Ga0207703_10087115 | 3300026035 | Bacteria | 2617 |
| 238 | Ga0207703_10140468 | 3300026035 | Bacteria | 2095 |
| 239 | Ga0207678_10009696 | 3300026067 | Bacteria | 8469 |
| 240 | Ga0207708_10001367 | 3300026075 | Bacteria | 18341 |
| 241 | Ga0207708_10006646 | 3300026075 | Bacteria | 8555 |
| 242 | Ga0207708_10015205 | 3300026075 | Bacteria | 5770 |
| 243 | Ga0207702_10114055 | 3300026078 | Bacteria | 2408 |
| 244 | Ga0207641_10030033 | 3300026088 | Bacteria | 4499 |
| 245 | Ga0207641_10034677 | 3300026088 | Bacteria | 4200 |
| 246 | Ga0207648_10013037 | 3300026089 | Bacteria | 7752 |
| 247 | Ga0207648_10019977 | 3300026089 | Bacteria | 6044 |
| 248 | Ga0207648_10028751 | 3300026089 | Bacteria | 4928 |
| 249 | Ga0207648_10034648 | 3300026089 | Bacteria | 4450 |
| 250 | Ga0207648_10053083 | 3300026089 | Bacteria | 3544 |
| 251 | Ga0207676_10003358 | 3300026095 | Bacteria | 11343 |
| 252 | Ga0207676_10008867 | 3300026095 | Bacteria | 7155 |
| 253 | Ga0207676_10009977 | 3300026095 | Bacteria | 6756 |
| 254 | Ga0207676_10017400 | 3300026095 | Bacteria | 5208 |
| 255 | Ga0207676_10070764 | 3300026095 | Bacteria | 2798 |
| 256 | Ga0207676_10073864 | 3300026095 | Bacteria | 2745 |
| 257 | Ga0207674_10161610 | 3300026116 | Bacteria | 2194 |
| 258 | Ga0207675_100011762 | 3300026118 | Bacteria | 8180 |
| 259 | Ga0207675_100012361 | 3300026118 | Bacteria | 7974 |
| 260 | Ga0207675_100016943 | 3300026118 | Bacteria | 6809 |
| 261 | Ga0207683_10000381 | 3300026121 | Bacteria | 40910 |
| 262 | Ga0207683_10000429 | 3300026121 | Bacteria | 38858 |
| 263 | Ga0207683_10131784 | 3300026121 | Bacteria | 2249 |
| 264 | Ga0207683_10245887 | 3300026121 | Bacteria | 1632 |
| 265 | Ga0207698_10000528 | 3300026142 | Bacteria | 22203 |
| 266 | Ga0207698_10008747 | 3300026142 | Bacteria | 6421 |
| 267 | Ga0207698_10023268 | 3300026142 | Bacteria | 4325 |
| 268 | Ga0209969_1000749 | 3300027360 | Bacteria | 4355 |
| 269 | Ga0210000_1000409 | 3300027462 | Bacteria | 5959 |
| 270 | Ga0209995_1002001 | 3300027471 | Bacteria | 3194 |
| 271 | Ga0209970_1004110 | 3300027614 | Bacteria | 2425 |
| 272 | Ga0209588_1014496 | 3300027671 | Bacteria | 2414 |
| 273 | Ga0209974_10001292 | 3300027876 | Bacteria | 9011 |
| 274 | Ga0268265_10061143 | 3300028380 | Bacteria | 2890 |
| 275 | Ga0268264_10048040 | 3300028381 | Bacteria | 3549 |
| 276 | Ga0265337_1005978 | 3300028556 | Bacteria | 4751 |
| 277 | Ga0265318_10000775 | 3300028577 | Bacteria | 21191 |
| 278 | Ga0265318_10012647 | 3300028577 | Bacteria | 3584 |
| 279 | Ga0265318_10038829 | 3300028577 | Bacteria | 1818 |
| 280 | Ga0265338_10000644 | 3300028800 | Bacteria | 60398 |
| 281 | Ga0265338_10006542 | 3300028800 | Bacteria | 14807 |
| 282 | Ga0265338_10089938 | 3300028800 | Bacteria | 2542 |
| 283 | Ga0265330_10016917 | 3300031235 | Bacteria | 3362 |
| 284 | Ga0265330_10034699 | 3300031235 | Bacteria | 2252 |
| 285 | Ga0265332_10002343 | 3300031238 | Bacteria | 9666 |
| 286 | Ga0265332_10002820 | 3300031238 | Bacteria | 8626 |
| 287 | Ga0265328_10007093 | 3300031239 | Bacteria | 4695 |
| 288 | Ga0265328_10017265 | 3300031239 | Bacteria | 2795 |
| 289 | Ga0265320_10016073 | 3300031240 | Bacteria | 4205 |
| 290 | Ga0265320_10020231 | 3300031240 | Bacteria | 3614 |
| 291 | Ga0265325_10008895 | 3300031241 | Bacteria | 5900 |
| 292 | Ga0265325_10010857 | 3300031241 | Bacteria | 5250 |
| 293 | Ga0265329_10003801 | 3300031242 | Bacteria | 6485 |
| 294 | Ga0265339_10000133 | 3300031249 | Bacteria | 60726 |
| 295 | Ga0265339_10041324 | 3300031249 | Bacteria | 2561 |
| 296 | Ga0265331_10005523 | 3300031250 | Bacteria | 7622 |
| 297 | Ga0265331_10006226 | 3300031250 | Bacteria | 7078 |
| 298 | Ga0265331_10048336 | 3300031250 | Bacteria | 2045 |
| 299 | Ga0265316_10003811 | 3300031344 | Bacteria | 15143 |
| 300 | Ga0265313_10000491 | 3300031595 | Bacteria | 41687 |
| 301 | Ga0265313_10017071 | 3300031595 | Bacteria | 4143 |
| 302 | Ga0265313_10023906 | 3300031595 | Bacteria | 3280 |
| 303 | Ga0265314_10001327 | 3300031711 | Bacteria | 28028 |
| 304 | Ga0265314_10004625 | 3300031711 | Bacteria | 12676 |
| 305 | Ga0265314_10009507 | 3300031711 | Bacteria | 8196 |
| 306 | Ga0265314_10021442 | 3300031711 | Bacteria | 4966 |
| 307 | Ga0265342_10003079 | 3300031712 | Bacteria | 13936 |
| 308 | Ga0265342_10009617 | 3300031712 | Bacteria | 6788 |
| 309 | Ga0307507_10041293 | 3300033179 | Bacteria | 4619 |
| 310 | Ga0373944_0014757 | 3300035089 | Bacteria | 2184 |
| 311 | Ga0373936_0000414 | 3300035113 | Bacteria | 14400 |
| 312 | Ga0373936_0037673 | 3300035113 | Bacteria | 1932 |
| 313 | Ga0373945_0025942 | 3300035116 | Bacteria | 2039 |
| 314 | Ga0373954_0003714 | 3300035118 | Bacteria | 6502 |
| 315 | Ga0373957_0028120 | 3300035120 | Bacteria | 2047 |
| 316 | Ga0373943_0000765 | 3300035170 | Bacteria | 14011 |
| 317 | Ga0373943_0002746 | 3300035170 | Bacteria | 8010 |
| 318 | Ga0373943_0003109 | 3300035170 | Bacteria | 7539 |
| 319 | Ga0373943_0015662 | 3300035170 | Bacteria | 3449 |
| 320 | Ga0373943_0051268 | 3300035170 | Bacteria | 2031 |
| 321 | Ga0373946_0003963 | 3300035171 | Bacteria | 5267 |
| 322 | Ga0373955_0000940 | 3300035172 | Bacteria | 12458 |
| 323 | Ga0373955_0015680 | 3300035172 | Bacteria | 3716 |
| 324 | Ga0373924_0039618 | 3300035410 | Bacteria | 1925 |
| 325 | Ga0373935_0000227 | 3300035692 | Bacteria | 27455 |
| 326 | Ga0373935_0007148 | 3300035692 | Bacteria | 6664 |
| 327 | Ga0373927_0003928 | 3300035695 | Bacteria | 10541 |
| 328 | Ga0373927_0010806 | 3300035695 | Bacteria | 6083 |
| 329 | Ga0373927_0029729 | 3300035695 | Bacteria | 3563 |
| 330 | Ga0373933_0008736 | 3300035724 | Bacteria | 5524 |
| 331 | Ga0373947_0000216 | 3300035725 | Bacteria | 32290 |
| 332 | Ga0373947_0006128 | 3300035725 | Bacteria | 6996 |
| 333 | Ga0373947_0006147 | 3300035725 | Bacteria | 6985 |
| 334 | Ga0373947_0013899 | 3300035725 | Bacteria | 4615 |
| 335 | Ga0373937_0000003 | 3300036401 | Bacteria | 235408 |
| 336 | Ga0373937_0018622 | 3300036401 | Bacteria | 6203 |
| 337 | Ga0373937_0045582 | 3300036401 | Bacteria | 4007 |
| 338 | Ga0373937_0189744 | 3300036401 | Bacteria | 1931 |
| 339 | Ga0373925_0000118 | 3300037068 | Bacteria | 85072 |
| 340 | Ga0373925_0003524 | 3300037068 | Bacteria | 12079 |
| 341 | Ga0373925_0011384 | 3300037068 | Bacteria | 6450 |
| 342 | Ga0373925_0045742 | 3300037068 | Bacteria | 3252 |
| 343 | Ga0373925_0082956 | 3300037068 | Bacteria | 2440 |
| 344 | Ga0395898_0135325 | 3300037466 | Bacteria | 2359 |
| 345 | Ga0395905_0000020 | 3300037471 | Bacteria | 337672 |
| 346 | Ga0436364_0200832 | 3300037853 | Bacteria | 50854 |
| 347 | Ga0436364_0935980 | 3300037853 | Bacteria | 9417 |
| 348 | Ga0395901_0049764 | 3300038443 | Bacteria | 4354 |
| 349 | Ga0395901_0107332 | 3300038443 | Bacteria | 2931 |
| 350 | Ga0436361_0592523 | 3300039447 | Bacteria | 2022 |
| 351 | Ga0436363_0974176 | 3300039450 | Bacteria | 4856 |
| 352 | Ga0466963_0068868 | 3300044694 | Bacteria | 2377 |
| 353 | Ga0466957_0050844 | 3300044842 | Bacteria | 2522 |
| 354 | Ga0466957_0080168 | 3300044842 | Bacteria | 2032 |
| 355 | Ga0466959_0122512 | 3300045049 | Bacteria | 1847 |
| 356 | Ga0466967_0154899 | 3300045976 | Bacteria | 2145 |
| 357 | Ga0495592_0000051 | 3300046454 | Bacteria | 111216 |
| 358 | Ga0495592_0000925 | 3300046454 | Bacteria | 20366 |
| 359 | Ga0495592_0002280 | 3300046454 | Bacteria | 13533 |
| 360 | Ga0495592_0031734 | 3300046454 | Bacteria | 3991 |
| 361 | Ga0495603_0002378 | 3300046455 | Bacteria | 11057 |
| 362 | Ga0495603_0003805 | 3300046455 | Bacteria | 8985 |
| 363 | Ga0495603_0024737 | 3300046455 | Bacteria | 3632 |
| 364 | Ga0495590_0036028 | 3300046457 | Bacteria | 1726 |
| 365 | Ga0495591_002794 | 3300046458 | Bacteria | 9400 |
| 366 | Ga0495629_0000195 | 3300046459 | Bacteria | 54287 |
| 367 | Ga0495629_0003133 | 3300046459 | Bacteria | 12533 |
| 368 | Ga0495629_0004794 | 3300046459 | Bacteria | 10144 |
| 369 | Ga0495629_0044241 | 3300046459 | Bacteria | 3125 |
| 370 | Ga0495629_0066814 | 3300046459 | Bacteria | 2510 |
| 371 | Ga0495638_0013805 | 3300046460 | Bacteria | 5484 |
| 372 | Ga0495638_0071365 | 3300046460 | Bacteria | 2124 |
| 373 | Ga0495641_0018341 | 3300046461 | Bacteria | 3614 |
| 374 | Ga0495651_0000263 | 3300046462 | Bacteria | 40725 |
| 375 | Ga0495651_0000583 | 3300046462 | Bacteria | 28302 |
| 376 | Ga0495651_0006074 | 3300046462 | Bacteria | 9224 |
| 377 | Ga0495651_0034505 | 3300046462 | Bacteria | 3943 |
| 378 | Ga0495651_0107335 | 3300046462 | Bacteria | 2069 |
| 379 | Ga0495653_0000039 | 3300046463 | Bacteria | 119840 |
| 380 | Ga0495653_0001192 | 3300046463 | Bacteria | 20136 |
| 381 | Ga0495653_0045250 | 3300046463 | Bacteria | 3413 |
| 382 | Ga0495650_0001346 | 3300046471 | Bacteria | 24430 |
| 383 | Ga0495650_0012070 | 3300046471 | Bacteria | 4673 |
| 384 | Ga0495580_0002294 | 3300046472 | Bacteria | 16699 |
| 385 | Ga0495580_0026059 | 3300046472 | Bacteria | 4266 |
| 386 | Ga0495580_0027503 | 3300046472 | Bacteria | 4138 |
| 387 | Ga0495580_0028422 | 3300046472 | Bacteria | 4063 |
| 388 | Ga0495582_0023348 | 3300046473 | Bacteria | 3384 |
| 389 | Ga0495605_0003236 | 3300046474 | Bacteria | 9777 |
| 390 | Ga0495605_0023395 | 3300046474 | Bacteria | 3250 |
| 391 | Ga0495605_0030980 | 3300046474 | Bacteria | 2736 |
| 392 | Ga0495605_0053296 | 3300046474 | Bacteria | 1963 |
| 393 | Ga0495639_0003849 | 3300046475 | Bacteria | 6447 |
| 394 | Ga0495662_0013418 | 3300046476 | Bacteria | 3987 |
| 395 | Ga0495662_0013611 | 3300046476 | Bacteria | 3960 |
| 396 | Ga0495664_0000015 | 3300046477 | Bacteria | 192569 |
| 397 | Ga0495664_0000375 | 3300046477 | Bacteria | 21707 |
| 398 | Ga0495584_0084441 | 3300046491 | Bacteria | 1599 |
| 399 | Ga0495585_0044477 | 3300046492 | Bacteria | 2481 |
| 400 | Ga0495594_0005399 | 3300046499 | Bacteria | 6566 |
| 401 | Ga0495594_0044952 | 3300046499 | Bacteria | 2423 |
| 402 | Ga0495596_0005855 | 3300046500 | Bacteria | 5748 |
| 403 | Ga0495596_0013347 | 3300046500 | Bacteria | 3487 |
| 404 | Ga0495607_0086954 | 3300046501 | Bacteria | 1703 |
| 405 | Ga0495583_0004968 | 3300046506 | Bacteria | 9230 |
| 406 | Ga0495608_0000025 | 3300046511 | Bacteria | 158132 |
| 407 | Ga0495608_0017317 | 3300046511 | Bacteria | 4985 |
| 408 | Ga0495608_0144348 | 3300046511 | Bacteria | 1518 |
| 409 | Ga0495616_0010848 | 3300046513 | Bacteria | 5250 |
| 410 | Ga0495618_0000040 | 3300046514 | Bacteria | 98012 |
| 411 | Ga0495618_0043585 | 3300046514 | Bacteria | 2830 |
| 412 | Ga0495628_0000011 | 3300046516 | Bacteria | 225267 |
| 413 | Ga0495630_0004426 | 3300046517 | Bacteria | 9858 |
| 414 | Ga0495630_0012700 | 3300046517 | Bacteria | 6119 |
| 415 | Ga0495630_0037737 | 3300046517 | Bacteria | 3613 |
| 416 | Ga0495630_0072188 | 3300046517 | Unclassified | 2598 |
| 417 | Ga0495648_0001911 | 3300046524 | Bacteria | 19892 |
| 418 | Ga0495666_0012877 | 3300046526 | Bacteria | 4169 |
| 419 | Ga0495666_0023499 | 3300046526 | Bacteria | 3048 |
| 420 | Ga0495666_0042284 | 3300046526 | Bacteria | 2204 |
| 421 | Ga0495642_0014346 | 3300046528 | Bacteria | 3069 |
| 422 | Ga0495652_0000014 | 3300046529 | Bacteria | 225484 |
| 423 | Ga0495652_0027911 | 3300046529 | Bacteria | 4972 |
| 424 | Ga0495652_0040159 | 3300046529 | Bacteria | 4044 |
| 425 | Ga0495652_0089875 | 3300046529 | Bacteria | 2514 |
| 426 | Ga0495652_0111629 | 3300046529 | Bacteria | 2198 |
| 427 | Ga0495665_0004423 | 3300046531 | Bacteria | 7589 |
| 428 | Ga0495665_0010279 | 3300046531 | Bacteria | 5065 |
| 429 | Ga0495665_0016341 | 3300046531 | Bacteria | 3999 |
| 430 | Ga0495665_0032509 | 3300046531 | Bacteria | 2791 |
| 431 | Ga0495640_0000008 | 3300046533 | Bacteria | 220320 |
| 432 | Ga0495640_0002950 | 3300046533 | Bacteria | 13700 |
| 433 | Ga0495640_0009570 | 3300046533 | Bacteria | 7538 |
| 434 | Ga0495640_0010709 | 3300046533 | Bacteria | 7074 |
| 435 | Ga0495640_0057608 | 3300046533 | Bacteria | 2651 |
| 436 | Ga0495640_0068791 | 3300046533 | Bacteria | 2382 |
| 437 | Ga0495586_0069190 | 3300046535 | Bacteria | 1926 |
| 438 | Ga0495586_0070611 | 3300046535 | Bacteria | 1907 |
| 439 | Ga0495587_0000015 | 3300046536 | Bacteria | 187415 |
| 440 | Ga0495587_0011567 | 3300046536 | Bacteria | 5587 |
| 441 | Ga0495621_0015396 | 3300046539 | Bacteria | 2439 |
| 442 | Ga0495645_0000020 | 3300046543 | Bacteria | 143867 |
| 443 | Ga0495645_0005566 | 3300046543 | Bacteria | 8663 |
| 444 | Ga0495645_0030525 | 3300046543 | Bacteria | 3925 |
| 445 | Ga0495645_0037034 | 3300046543 | Bacteria | 3556 |
| 446 | Ga0495622_0000020 | 3300046557 | Bacteria | 166839 |
| 447 | Ga0495622_0000147 | 3300046557 | Bacteria | 60460 |
| 448 | Ga0495667_0000013 | 3300046559 | Bacteria | 220294 |
| 449 | Ga0495667_0006693 | 3300046559 | Bacteria | 7819 |
| 450 | Ga0495667_0095585 | 3300046559 | Bacteria | 1924 |
| 451 | Ga0495634_0000415 | 3300046642 | Bacteria | 42260 |
| 452 | Ga0495634_0001639 | 3300046642 | Bacteria | 19477 |
| 453 | Ga0495634_0009154 | 3300046642 | Bacteria | 7313 |
| 454 | Ga0495634_0047841 | 3300046642 | Bacteria | 2881 |
| 455 | Ga0495634_0048393 | 3300046642 | Bacteria | 2862 |
| 456 | Ga0495611_0008932 | 3300046648 | Bacteria | 4239 |
| 457 | Ga0495635_0000012 | 3300046663 | Bacteria | 225271 |
| 458 | Ga0495635_0001827 | 3300046663 | Bacteria | 14391 |
| 459 | Ga0495635_0021654 | 3300046663 | Bacteria | 4481 |
| 460 | Ga0495635_0107091 | 3300046663 | Bacteria | 1909 |
| 461 | Ga0495661_0005088 | 3300046665 | Bacteria | 9379 |
| 462 | Ga0495661_0030740 | 3300046665 | Bacteria | 3417 |
| 463 | Ga0495588_0079603 | 3300046674 | Bacteria | 1710 |
| 464 | Ga0495657_0000815 | 3300046675 | Bacteria | 27667 |
| 465 | Ga0495657_0008582 | 3300046675 | Bacteria | 7802 |
| 466 | Ga0495599_0000008 | 3300046678 | Bacteria | 225534 |
| 467 | Ga0495599_0126763 | 3300046678 | Bacteria | 1586 |
| 468 | Ga0495623_0000002 | 3300046679 | Bacteria | 166669 |
| 469 | Ga0495623_0026799 | 3300046679 | Bacteria | 3709 |
| 470 | Ga0495623_0062267 | 3300046679 | Bacteria | 2339 |
| 471 | Ga0495646_0000004 | 3300046680 | Bacteria | 268993 |
| 472 | Ga0495646_0001238 | 3300046680 | Bacteria | 14975 |
| 473 | Ga0495646_0007246 | 3300046680 | Bacteria | 7047 |
| 474 | Ga0495647_0002749 | 3300046681 | Bacteria | 5580 |
| 475 | Ga0495658_0009054 | 3300046683 | Bacteria | 4950 |
| 476 | Ga0495658_0012691 | 3300046683 | Bacteria | 4274 |
| 477 | Ga0495658_0043870 | 3300046683 | Bacteria | 2503 |
| 478 | Ga0495669_0020421 | 3300046684 | Bacteria | 2867 |
| 479 | Ga0495669_0045753 | 3300046684 | Bacteria | 1952 |
| 480 | Ga0495613_0010776 | 3300046689 | Bacteria | 6783 |
| 481 | Ga0495613_0014563 | 3300046689 | Bacteria | 5833 |
| 482 | Ga0495613_0159436 | 3300046689 | Bacteria | 1606 |
| 483 | Ga0495624_0003694 | 3300046690 | Bacteria | 11307 |
| 484 | Ga0495624_0011365 | 3300046690 | Bacteria | 6119 |
| 485 | Ga0495624_0039101 | 3300046690 | Bacteria | 3043 |
| 486 | Ga0495624_0040600 | 3300046690 | Bacteria | 2979 |
| 487 | Ga0495670_0034671 | 3300046691 | Bacteria | 2515 |
| 488 | Ga0495670_0056462 | 3300046691 | Bacteria | 1970 |
| 489 | Ga0495671_0030914 | 3300046692 | Bacteria | 2740 |
| 490 | Ga0495649_0031537 | 3300046694 | Bacteria | 2922 |
| 491 | Ga0495649_0060383 | 3300046694 | Bacteria | 2039 |
| 492 | Ga0495589_0000876 | 3300046794 | Bacteria | 18703 |
| 493 | Ga0495589_0002891 | 3300046794 | Bacteria | 9502 |
| 494 | Ga0495600_0000024 | 3300046809 | Bacteria | 92414 |
| 495 | Ga0495600_0016171 | 3300046809 | Bacteria | 4731 |
| 496 | Ga0495581_0015723 | 3300047315 | Bacteria | 4393 |
| 497 | Ga0495581_0036668 | 3300047315 | Bacteria | 2837 |
| 498 | Ga0495581_0043406 | 3300047315 | Bacteria | 2601 |
| 499 | Ga0495604_0000001 | 3300047317 | Bacteria | 708627 |
| 500 | Ga0495604_0007948 | 3300047317 | Bacteria | 8403 |
| 501 | Ga0495604_0015166 | 3300047317 | Bacteria | 6151 |
| 502 | Ga0495674_0000023 | 3300047319 | Bacteria | 157443 |
| 503 | Ga0495674_0001761 | 3300047319 | Bacteria | 21319 |
| 504 | Ga0495674_0007612 | 3300047319 | Bacteria | 10349 |
| 505 | Ga0495674_0026948 | 3300047319 | Bacteria | 5256 |
| 506 | Ga0495674_0029316 | 3300047319 | Bacteria | 5013 |
| 507 | Ga0495674_0219483 | 3300047319 | Bacteria | 1572 |
| 508 | Ga0495676_0010728 | 3300047321 | Bacteria | 8293 |
| 509 | Ga0495676_0127482 | 3300047321 | Bacteria | 1842 |
| 510 | Ga0495680_0001451 | 3300047322 | Bacteria | 25557 |
| 511 | Ga0495680_0003698 | 3300047322 | Bacteria | 14944 |
| 512 | Ga0495680_0061555 | 3300047322 | Bacteria | 2887 |
| 513 | Ga0495680_0102512 | 3300047322 | Bacteria | 2130 |
| 514 | Ga0495683_0007144 | 3300047323 | Bacteria | 6058 |
| 515 | Ga0495687_028804 | 3300047443 | Bacteria | 2578 |
| 516 | Ga0495675_0000392 | 3300047444 | Bacteria | 30250 |
| 517 | Ga0495675_0004093 | 3300047444 | Bacteria | 8835 |
| 518 | Ga0495675_0042674 | 3300047444 | Unclassified | 2889 |
| 519 | Ga0495679_000036 | 3300047446 | Bacteria | 161473 |
| 520 | Ga0495679_001250 | 3300047446 | Bacteria | 15047 |
| 521 | Ga0495673_0017287 | 3300047469 | Bacteria | 3668 |
| 522 | Ga0495673_0024931 | 3300047469 | Bacteria | 2879 |
| 523 | Ga0495684_0000007 | 3300047471 | Bacteria | 225614 |
| 524 | Ga0495684_0006845 | 3300047471 | Bacteria | 8860 |
| 525 | Ga0495684_0017916 | 3300047471 | Bacteria | 5456 |
| 526 | Ga0495684_0062050 | 3300047471 | Bacteria | 2843 |
| 527 | Ga0495686_0124273 | 3300047472 | Bacteria | 1535 |
| 528 | Ga0495593_0000886 | 3300047673 | Bacteria | 17382 |
| 529 | Ga0495593_0001189 | 3300047673 | Bacteria | 15218 |
| 530 | Ga0495593_0028383 | 3300047673 | Bacteria | 3073 |
| 531 | Ga0495602_0000045 | 3300048088 | Bacteria | 118132 |
| 532 | Ga0495602_0021399 | 3300048088 | Bacteria | 6367 |
| 533 | Ga0495602_0036711 | 3300048088 | Bacteria | 4556 |
| 534 | Ga0495614_0003498 | 3300048089 | Bacteria | 7031 |
| 535 | Ga0495626_0025537 | 3300048091 | Bacteria | 2888 |
| 536 | Ga0496101_0023051 | 3300048904 | Bacteria | 4295 |
| 537 | Ga0496101_0026610 | 3300048904 | Bacteria | 4022 |
| 538 | Ga0496101_0040043 | 3300048904 | Bacteria | 3337 |
| 539 | Ga0496101_0075791 | 3300048904 | Bacteria | 2476 |
| 540 | Ga0496102_0012310 | 3300048905 | Bacteria | 7399 |
| 541 | Ga0496102_0187647 | 3300048905 | Bacteria | 1948 |
| 542 | Ga0496102_0238118 | 3300048905 | Bacteria | 1716 |
| 543 | Ga0496104_0036562 | 3300048907 | Bacteria | 4591 |
| 544 | Ga0496104_0074929 | 3300048907 | Bacteria | 3222 |
| 545 | Ga0496104_0080014 | 3300048907 | Bacteria | 3115 |
| 546 | Ga0496104_0085980 | 3300048907 | Bacteria | 3002 |
| 547 | Ga0496104_0086681 | 3300048907 | Bacteria | 2989 |
| 548 | Ga0496104_0309842 | 3300048907 | Bacteria | 1491 |
| 549 | Ga0496105_0044324 | 3300048908 | Bacteria | 3668 |
| 550 | Ga0496105_0094136 | 3300048908 | Bacteria | 2474 |
| 551 | Ga0496105_0109115 | 3300048908 | Bacteria | 2285 |
| 552 | Ga0496105_0186454 | 3300048908 | Bacteria | 1697 |
| 553 | Ga0496106_0026019 | 3300048909 | Bacteria | 4354 |
| 554 | Ga0496106_0117793 | 3300048909 | Bacteria | 2073 |
| 555 | Ga0496106_0160363 | 3300048909 | Bacteria | 1778 |
| 556 | Ga0496107_0020118 | 3300048910 | Bacteria | 4713 |
| 557 | Ga0496107_0045573 | 3300048910 | Bacteria | 3155 |
| 558 | Ga0496107_0058658 | 3300048910 | Bacteria | 2783 |
| 559 | Ga0496108_0000249 | 3300048911 | Bacteria | 47869 |
| 560 | Ga0496108_0002673 | 3300048911 | Bacteria | 14277 |
| 561 | Ga0496108_0047436 | 3300048911 | Bacteria | 3590 |
| 562 | Ga0496108_0073425 | 3300048911 | Bacteria | 2888 |
| 563 | Ga0496109_0000754 | 3300048912 | Bacteria | 26955 |
| 564 | Ga0496109_0001468 | 3300048912 | Bacteria | 19562 |
| 565 | Ga0496110_0000037 | 3300048913 | Bacteria | 64495 |
| 566 | Ga0496110_0003356 | 3300048913 | Bacteria | 12224 |
| 567 | Ga0496110_0162983 | 3300048913 | Bacteria | 2021 |
| 568 | Ga0496110_0178520 | 3300048913 | Bacteria | 1928 |
| 569 | Ga0496111_0002935 | 3300048914 | Bacteria | 10427 |
| 570 | Ga0496111_0151488 | 3300048914 | Bacteria | 1720 |
| 571 | Ga0496112_0007789 | 3300048915 | Bacteria | 9535 |
| 572 | Ga0496112_0015644 | 3300048915 | Bacteria | 7086 |
| 573 | Ga0496113_0000455 | 3300048916 | Bacteria | 19907 |
| 574 | Ga0496113_0000937 | 3300048916 | Bacteria | 15487 |
| 575 | Ga0496113_0066187 | 3300048916 | Bacteria | 2736 |
| 576 | Ga0496114_0013377 | 3300048917 | Bacteria | 6579 |
| 577 | Ga0496114_0084644 | 3300048917 | Bacteria | 2685 |
| 578 | Ga0496114_0300737 | 3300048917 | Bacteria | 1416 |
| 579 | Ga0496115_0079809 | 3300048918 | Bacteria | 2663 |
| 580 | Ga0496115_0163201 | 3300048918 | Unclassified | 1842 |
| 581 | Ga0496116_0022456 | 3300048919 | Bacteria | 4728 |
| 582 | Ga0496116_0094798 | 3300048919 | Bacteria | 1803 |
| 583 | Ga0496117_0031450 | 3300048920 | Bacteria | 4050 |
| 584 | Ga0496118_0021608 | 3300048921 | Bacteria | 5657 |
| 585 | Ga0496118_0025416 | 3300048921 | Bacteria | 5079 |
| 586 | Ga0496121_0000186 | 3300048924 | Bacteria | 138418 |
| 587 | Ga0496121_0002020 | 3300048924 | Bacteria | 32184 |
| 588 | Ga0496122_0003710 | 3300048925 | Bacteria | 19747 |
| 589 | Ga0496123_0001431 | 3300048926 | Bacteria | 33345 |
| 590 | Ga0496126_0001613 | 3300048929 | Bacteria | 34166 |
| 591 | Ga0495678_032607 | 3300049459 | Bacteria | 2157 |
| 592 | Ga0495682_0014033 | 3300049460 | Bacteria | 3041 |
| 593 | Ga0501034_0118824 | 3300049571 | Bacteria | 2630 |
| 594 | Ga0501043_0301095 | 3300049579 | Bacteria | 1225 |
| 595 | Ga0501047_0034081 | 3300049581 | Bacteria | 4916 |
| 596 | Ga0501070_0203032 | 3300049586 | Bacteria | 1627 |
| 597 | Ga0501075_0199288 | 3300049591 | Bacteria | 1527 |
| 598 | Ga0501080_0082130 | 3300049742 | Bacteria | 2994 |
| 599 | Ga0501035_0004649 | 3300049822 | Bacteria | 13027 |
| 600 | Ga0501044_0024057 | 3300049823 | Bacteria | 6471 |
| 601 | Ga0501044_0029787 | 3300049823 | Bacteria | 5755 |
| 602 | nmdc:mga03n38_22539_c1 | 3300050490 | Bacteria | 2551 |
| 603 | nmdc:mga0yw44_96930_c1 | 3300050492 | Bacteria | 1873 |
| 604 | nmdc:mga05p37_37242_c1 | 3300050507 | Bacteria | 5964 |
| 605 | nmdc:mga05p37_97872_c1 | 3300050507 | Bacteria | 3614 |
| 606 | nmdc:mga09592_37452_c1 | 3300050508 | Bacteria | 4069 |
| 607 | nmdc:mga09592_43549_c1 | 3300050508 | Bacteria | 3777 |
| 608 | nmdc:mga0qj67_21925_c1 | 3300050509 | Bacteria | 4902 |
| 609 | nmdc:mga06r32_140023_c1 | 3300050510 | Bacteria | 2395 |
| 610 | nmdc:mga06r32_151626_c1 | 3300050510 | Bacteria | 2297 |
| 611 | nmdc:mga08y16_128345_c1 | 3300050511 | Bacteria | 2637 |
| 612 | nmdc:mga08y16_136408_c1 | 3300050511 | Bacteria | 2550 |
| 613 | nmdc:mga0n895_112995_c1 | 3300050512 | Unclassified | 2733 |
| 614 | nmdc:mga0n895_113742_c1 | 3300050512 | Bacteria | 2724 |
| 615 | nmdc:mga0n895_14307_c1 | 3300050512 | Bacteria | 7201 |
| 616 | nmdc:mga0n895_42361_c1 | 3300050512 | Bacteria | 4429 |
| 617 | nmdc:mga08x19_16913_c1 | 3300050514 | Bacteria | 4456 |
| 618 | nmdc:mga08x19_7348_c1 | 3300050514 | Bacteria | 6546 |
| 619 | Ga0495601_0000014 | 3300053077 | Bacteria | 220318 |
| 620 | Ga0495601_0000579 | 3300053077 | Bacteria | 19447 |
| 621 | Ga0495601_0000751 | 3300053077 | Bacteria | 17458 |
| 622 | Ga0495601_0007390 | 3300053077 | Bacteria | 6439 |
| 623 | Ga0495601_0009463 | 3300053077 | Bacteria | 5765 |
| 624 | Ga0495601_0074811 | 3300053077 | Bacteria | 2167 |
| 625 | Ga0495612_0000014 | 3300053078 | Bacteria | 187444 |
| 626 | Ga0495612_0000428 | 3300053078 | Bacteria | 16790 |
| 627 | Ga0495612_0000961 | 3300053078 | Bacteria | 11838 |
| 628 | Ga0495595_0000038 | 3300053084 | Bacteria | 70955 |
| 629 | Ga0495595_0000614 | 3300053084 | Bacteria | 13575 |
| 630 | Ga0495595_0001366 | 3300053084 | Bacteria | 9465 |
| 631 | Ga0495619_0000006 | 3300053085 | Bacteria | 384835 |
| 632 | Ga0495619_0000706 | 3300053085 | Bacteria | 21775 |
| 633 | Ga0495619_0007500 | 3300053085 | Bacteria | 6908 |
| 634 | Ga0495619_0015998 | 3300053085 | Bacteria | 4747 |
| 635 | Ga0495619_0032522 | 3300053085 | Bacteria | 3385 |
| 636 | Ga0495619_0033808 | 3300053085 | Bacteria | 3321 |
| 637 | Ga0495619_0036007 | 3300053085 | Bacteria | 3221 |
| 638 | Ga0495619_0045438 | 3300053085 | Bacteria | 2886 |
| 639 | Ga0495619_0064626 | 3300053085 | Bacteria | 2440 |
| 640 | Ga0495619_0116689 | 3300053085 | Bacteria | 1827 |
| 641 | Ga0500593_000017 | 3300053117 | Bacteria | 56465 |
| 642 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 643 | Ga0500568_0045391 | 3300053139 | Bacteria | 1749 |
| 644 | 2511247512 | 2511231003 | Bacteria | 5606035 |
| 645 | 2563063718 | 2562617112 | Bacteria | 10918404 |
| 646 | 2713474604 | 2711768613 | Bacteria | 11048459 |
| 647 | 2792833410 | 2791355137 | Bacteria | 9654227 |
| 648 | 2842333171 | 2842324504 | Bacteria | 9364110 |
| 649 | 2855731098 | 2855730933 | Bacteria | 7047938 |
| 650 | 2855770301 | 2855767633 | Bacteria | 7049357 |
| 651 | 2881414522 | 2881412998 | Bacteria | 6492157 |
| 652 | 2884816980 | 2884811622 | Bacteria | 5552861 |
| 653 | 2884840915 | 2884836552 | Bacteria | 5219991 |
| 654 | 2884857489 | 2884852848 | Bacteria | 5221161 |
| 655 | 2885277139 | 2885270888 | Bacteria | 9831543 |
| 656 | 2896158429 | 2896154374 | Bacteria | 5221518 |
| 657 | 2904623224 | 2904615490 | Bacteria | 10047340 |
| 658 | 2921643541 | 2921643360 | Bacteria | 11448031 |
| 659 | Ga0495634_0007216 | |||
| 660 | JGI24750J21931_1001266 | |||
| 661 | JGI24742J22300_10000928 | |||
| 662 | JGI25151J46595_10003207 | |||
| 663 | rootH1_10097723 | |||
| 664 | Ga0065712_10010748 | |||
| 665 | Ga0065712_10105777 | |||
| 666 | Ga0070658_10014828 | |||
| 667 | Ga0070658_10032865 | |||
| 668 | Ga0070658_10063027 | |||
| 669 | Ga0070676_10027837 | |||
| 670 | Ga0070683_100001114 | |||
| 671 | Ga0070683_100001248 | |||
| 672 | Ga0070690_100024232 | |||
| 673 | Ga0070670_100001277 | |||
| 674 | Ga0070670_100002839 | |||
| 675 | Ga0070670_100003204 | |||
| 676 | Ga0070670_100061716 | |||
| 677 | Ga0070670_100077089 | |||
| 678 | Ga0070670_100095271 | |||
| 679 | Ga0070677_10003682 | |||
| 680 | Ga0070677_10023089 | |||
| 681 | Ga0070677_10056765 | |||
| 682 | Ga0070666_10057991 | |||
| 683 | Ga0070680_100017231 | |||
| 684 | Ga0068868_100000410 | |||
| 685 | Ga0068868_100001321 | |||
| 686 | Ga0068868_100063223 | |||
| 687 | Ga0070689_100055569 | |||
| 688 | Ga0070687_100005754 | |||
| 689 | Ga0070661_100000923 | |||
| 690 | Ga0070661_100003988 | |||
| 691 | Ga0070661_100061340 | |||
| 692 | Ga0070669_100171565 | |||
| 693 | Ga0070675_100000071 | |||
| 694 | Ga0070675_100000793 | |||
| 695 | Ga0070671_100001499 | |||
| 696 | Ga0070674_100063360 | |||
| 697 | Ga0070674_100103655 | |||
| 698 | Ga0070673_100000149 | |||
| 699 | Ga0070673_100065651 | |||
| 700 | Ga0070673_100149443 | |||
| 701 | Ga0070673_100179422 | |||
| 702 | Ga0070659_100016067 | |||
| 703 | Ga0070667_100051010 | |||
| 704 | Ga0070667_100075575 | |||
| 705 | Ga0070713_100000870 | |||
| 706 | Ga0070713_100006605 | |||
| 707 | Ga0070713_100136935 | |||
| 708 | Ga0070710_10016803 | |||
| 709 | Ga0070711_100015513 | |||
| 710 | Ga0070700_100010063 | |||
| 711 | Ga0070694_100073118 | |||
| 712 | Ga0070708_100242222 | |||
| 713 | Ga0070663_100014372 | |||
| 714 | Ga0070678_100000010 | |||
| 715 | Ga0070678_100000373 | |||
| 716 | Ga0070678_100052822 | |||
| 717 | Ga0070681_10009601 | |||
| 718 | Ga0070681_10054888 | |||
| 719 | Ga0068867_100018813 | |||
| 720 | Ga0068867_100037683 | |||
| 721 | Ga0070685_10009635 | |||
| 722 | Ga0070707_100040082 | |||
| 723 | Ga0070699_100038745 | |||
| 724 | Ga0070697_100042401 | |||
| 725 | Ga0070672_100000312 | |||
| 726 | Ga0070672_100000909 | |||
| 727 | Ga0070672_100106850 | |||
| 728 | Ga0070695_100019408 | |||
| 729 | Ga0070695_100066573 | |||
| 730 | Ga0070704_100190634 | |||
| 731 | Ga0068855_100029244 | |||
| 732 | Ga0068855_100029314 | |||
| 733 | Ga0068855_100199259 | |||
| 734 | Ga0068855_100216522 | |||
| 735 | Ga0070664_100000179 | |||
| 736 | Ga0070664_100002026 | |||
| 737 | Ga0068854_100040322 | |||
| 738 | Ga0068852_100000828 | |||
| 739 | Ga0068852_100002798 | |||
| 740 | Ga0068852_100014313 | |||
| 741 | Ga0068852_100036862 | |||
| 742 | Ga0068859_100177933 | |||
| 743 | Ga0068864_100001555 | |||
| 744 | Ga0068864_100026648 | |||
| 745 | Ga0068864_100105263 | |||
| 746 | Ga0068864_100123609 | |||
| 747 | Ga0068851_10000460 | |||
| 748 | Ga0068870_10003702 | |||
| 749 | Ga0068863_100008612 | |||
| 750 | Ga0068863_100028706 | |||
| 751 | Ga0068863_100113454 | |||
| 752 | Ga0068858_100076882 | |||
| 753 | Ga0068858_100109782 | |||
| 754 | Ga0068860_100195206 | |||
| 755 | Ga0068860_100209543 | |||
| 756 | Ga0081455_10006987 | |||
| 757 | Ga0081540_1000015 | |||
| 758 | Ga0070717_10025797 | |||
| 759 | Ga0075365_10000662 | |||
| 760 | Ga0075363_100004310 | |||
| 761 | Ga0097621_100000056 | |||
| 762 | Ga0097621_100000761 | |||
| 763 | Ga0097621_100059374 | |||
| 764 | Ga0075370_10026536 | |||
| 765 | Ga0075370_10041441 | |||
| 766 | Ga0068871_100000774 | |||
| 767 | Ga0068871_100030458 | |||
| 768 | Ga0068871_100140432 | |||
| 769 | Ga0075428_100002507 | |||
| 770 | Ga0075428_100148536 | |||
| 771 | Ga0075428_100152086 | |||
| 772 | Ga0075430_100000747 | |||
| 773 | Ga0075431_100037913 | |||
| 774 | Ga0075431_100093494 | |||
| 775 | Ga0075434_100076792 | |||
| 776 | Ga0075434_100201361 | |||
| 777 | Ga0075429_100044461 | |||
| 778 | Ga0075429_100046477 | |||
| 779 | Ga0075436_100004335 | |||
| 780 | Ga0075436_100011918 | |||
| 781 | Ga0097620_100177927 | |||
| 782 | Ga0075435_100078885 | |||
| 783 | Ga0075435_100145458 | |||
| 784 | Ga0099795_10000578 | |||
| 785 | Ga0105240_10024423 | |||
| 786 | Ga0111539_10068503 | |||
| 787 | Ga0111539_10112275 | |||
| 788 | Ga0111539_10171590 | |||
| 789 | Ga0114129_10029908 | |||
| 790 | Ga0114129_10073179 | |||
| 791 | Ga0114129_10088023 | |||
| 792 | Ga0114129_10293365 | |||
| 793 | Ga0105248_10023630 | |||
| 794 | Ga0105248_10030350 | |||
| 795 | Ga0105248_10181994 | |||
| 796 | Ga0105248_10325795 | |||
| 797 | Ga0099796_10020942 | |||
| 798 | Ga0157374_10000729 | |||
| 799 | Ga0157374_10001930 | |||
| 800 | Ga0157374_10070369 | |||
| 801 | Ga0157378_10003430 | |||
| 802 | Ga0157378_10007916 | |||
| 803 | Ga0157378_10164516 | |||
| 804 | Ga0163162_10001281 | |||
| 805 | Ga0163162_10007039 | |||
| 806 | Ga0163162_10026510 | |||
| 807 | Ga0157372_10175542 | |||
| 808 | Ga0157372_10194490 | |||
| 809 | Ga0157375_10002204 | |||
| 810 | Ga0157375_10003743 | |||
| 811 | Ga0157375_10030147 | |||
| 812 | Ga0157375_10110257 | |||
| 813 | Ga0163163_10014783 | |||
| 814 | Ga0163163_10150452 | |||
| 815 | Ga0157379_10026622 | |||
| 816 | Ga0157376_10010135 | |||
| 817 | Ga0157376_10019293 | |||
| 818 | Ga0157376_10050250 | |||
| 819 | Ga0157376_10069317 | |||
| 820 | Ga0213875_10004743 | |||
| 821 | Ga0209025_1000003 | |||
| 822 | Ga0207697_10005175 | |||
| 823 | Ga0207656_10000449 | |||
| 824 | Ga0207682_10004778 | |||
| 825 | Ga0207682_10005745 | |||
| 826 | Ga0207682_10006398 | |||
| 827 | Ga0207692_10032563 | |||
| 828 | Ga0207688_10005568 | |||
| 829 | Ga0207688_10031318 | |||
| 830 | Ga0207680_10031812 | |||
| 831 | Ga0207645_10026467 | |||
| 832 | Ga0207645_10027285 | |||
| 833 | Ga0207645_10040519 | |||
| 834 | Ga0207643_10002035 | |||
| 835 | Ga0207705_10011650 | |||
| 836 | Ga0207684_10087908 | |||
| 837 | Ga0207707_10097415 | |||
| 838 | Ga0207707_10103866 | |||
| 839 | Ga0207663_10129564 | |||
| 840 | Ga0207660_10035713 | |||
| 841 | Ga0207660_10180079 | |||
| 842 | Ga0207662_10005039 | |||
| 843 | Ga0207662_10014029 | |||
| 844 | Ga0207662_10055906 | |||
| 845 | Ga0207662_10057093 | |||
| 846 | Ga0207657_10049054 | |||
| 847 | Ga0207657_10059744 | |||
| 848 | Ga0207657_10113392 | |||
| 849 | Ga0207649_10004827 | |||
| 850 | Ga0207649_10071121 | |||
| 851 | Ga0207649_10144829 | |||
| 852 | Ga0207646_10054665 | |||
| 853 | Ga0207681_10073295 | |||
| 854 | Ga0207650_10001859 | |||
| 855 | Ga0207650_10002001 | |||
| 856 | Ga0207650_10003953 | |||
| 857 | Ga0207650_10004434 | |||
| 858 | Ga0207650_10115869 | |||
| 859 | Ga0207659_10000756 | |||
| 860 | Ga0207659_10047343 | |||
| 861 | Ga0207659_10064728 | |||
| 862 | Ga0207700_10107367 | |||
| 863 | Ga0207644_10000182 | |||
| 864 | Ga0207644_10001114 | |||
| 865 | Ga0207644_10064408 | |||
| 866 | Ga0207706_10012119 | |||
| 867 | Ga0207706_10061191 | |||
| 868 | Ga0207670_10064533 | |||
| 869 | Ga0207669_10077955 | |||
| 870 | Ga0207669_10097614 | |||
| 871 | Ga0207704_10076465 | |||
| 872 | Ga0207704_10087305 | |||
| 873 | Ga0207691_10000678 | |||
| 874 | Ga0207691_10001156 | |||
| 875 | Ga0207691_10064030 | |||
| 876 | Ga0207711_10012082 | |||
| 877 | Ga0207711_10025993 | |||
| 878 | Ga0207711_10051184 | |||
| 879 | Ga0207711_10098834 | |||
| 880 | Ga0207689_10038282 | |||
| 881 | Ga0207661_10001359 | |||
| 882 | Ga0207661_10094719 | |||
| 883 | Ga0207679_10023955 | |||
| 884 | Ga0207679_10134818 | |||
| 885 | Ga0207667_10071075 | |||
| 886 | Ga0207667_10167063 | |||
| 887 | Ga0207651_10021614 | |||
| 888 | Ga0207651_10069604 | |||
| 889 | Ga0207668_10162177 | |||
| 890 | Ga0207640_10039827 | |||
| 891 | Ga0207658_10017093 | |||
| 892 | Ga0207677_10002173 | |||
| 893 | Ga0207677_10150407 | |||
| 894 | Ga0207703_10031279 | |||
| 895 | Ga0207703_10087115 | |||
| 896 | Ga0207703_10140468 | |||
| 897 | Ga0207678_10009696 | |||
| 898 | Ga0207708_10001367 | |||
| 899 | Ga0207708_10006646 | |||
| 900 | Ga0207708_10015205 | |||
| 901 | Ga0207702_10114055 | |||
| 902 | Ga0207641_10030033 | |||
| 903 | Ga0207641_10034677 | |||
| 904 | Ga0207648_10013037 | |||
| 905 | Ga0207648_10019977 | |||
| 906 | Ga0207648_10028751 | |||
| 907 | Ga0207648_10034648 | |||
| 908 | Ga0207648_10053083 | |||
| 909 | Ga0207676_10003358 | |||
| 910 | Ga0207676_10008867 | |||
| 911 | Ga0207676_10009977 | |||
| 912 | Ga0207676_10017400 | |||
| 913 | Ga0207676_10070764 | |||
| 914 | Ga0207676_10073864 | |||
| 915 | Ga0207674_10161610 | |||
| 916 | Ga0207675_100011762 | |||
| 917 | Ga0207675_100012361 | |||
| 918 | Ga0207675_100016943 | |||
| 919 | Ga0207683_10000381 | |||
| 920 | Ga0207683_10000429 | |||
| 921 | Ga0207683_10131784 | |||
| 922 | Ga0207683_10245887 | |||
| 923 | Ga0207698_10000528 | |||
| 924 | Ga0207698_10008747 | |||
| 925 | Ga0207698_10023268 | |||
| 926 | Ga0209969_1000749 | |||
| 927 | Ga0210000_1000409 | |||
| 928 | Ga0209995_1002001 | |||
| 929 | Ga0209970_1004110 | |||
| 930 | Ga0209588_1014496 | |||
| 931 | Ga0209974_10001292 | |||
| 932 | Ga0268265_10061143 | |||
| 933 | Ga0268264_10048040 | |||
| 934 | Ga0265337_1005978 | |||
| 935 | Ga0265318_10000775 | |||
| 936 | Ga0265318_10012647 | |||
| 937 | Ga0265318_10038829 | |||
| 938 | Ga0265338_10000644 | |||
| 939 | Ga0265338_10006542 | |||
| 940 | Ga0265338_10089938 | |||
| 941 | Ga0265330_10016917 | |||
| 942 | Ga0265330_10034699 | |||
| 943 | Ga0265332_10002343 | |||
| 944 | Ga0265332_10002820 | |||
| 945 | Ga0265328_10007093 | |||
| 946 | Ga0265328_10017265 | |||
| 947 | Ga0265320_10016073 | |||
| 948 | Ga0265320_10020231 | |||
| 949 | Ga0265325_10008895 | |||
| 950 | Ga0265325_10010857 | |||
| 951 | Ga0265329_10003801 | |||
| 952 | Ga0265339_10000133 | |||
| 953 | Ga0265339_10041324 | |||
| 954 | Ga0265331_10005523 | |||
| 955 | Ga0265331_10006226 | |||
| 956 | Ga0265331_10048336 | |||
| 957 | Ga0265316_10003811 | |||
| 958 | Ga0265313_10000491 | |||
| 959 | Ga0265313_10017071 | |||
| 960 | Ga0265313_10023906 | |||
| 961 | Ga0265314_10001327 | |||
| 962 | Ga0265314_10004625 | |||
| 963 | Ga0265314_10009507 | |||
| 964 | Ga0265314_10021442 | |||
| 965 | Ga0265342_10003079 | |||
| 966 | Ga0265342_10009617 | |||
| 967 | Ga0307507_10041293 | |||
| 968 | Ga0373944_0014757 | |||
| 969 | Ga0373936_0000414 | |||
| 970 | Ga0373936_0037673 | |||
| 971 | Ga0373945_0025942 | |||
| 972 | Ga0373954_0003714 | |||
| 973 | Ga0373957_0028120 | |||
| 974 | Ga0373943_0000765 | |||
| 975 | Ga0373943_0002746 | |||
| 976 | Ga0373943_0003109 | |||
| 977 | Ga0373943_0015662 | |||
| 978 | Ga0373943_0051268 | |||
| 979 | Ga0373946_0003963 | |||
| 980 | Ga0373955_0000940 | |||
| 981 | Ga0373955_0015680 | |||
| 982 | Ga0373924_0039618 | |||
| 983 | Ga0373935_0000227 | |||
| 984 | Ga0373935_0007148 | |||
| 985 | Ga0373927_0003928 | |||
| 986 | Ga0373927_0010806 | |||
| 987 | Ga0373927_0029729 | |||
| 988 | Ga0373933_0008736 | |||
| 989 | Ga0373947_0000216 | |||
| 990 | Ga0373947_0006128 | |||
| 991 | Ga0373947_0006147 | |||
| 992 | Ga0373947_0013899 | |||
| 993 | Ga0373937_0000003 | |||
| 994 | Ga0373937_0018622 | |||
| 995 | Ga0373937_0045582 | |||
| 996 | Ga0373937_0189744 | |||
| 997 | Ga0373925_0000118 | |||
| 998 | Ga0373925_0003524 | |||
| 999 | Ga0373925_0011384 | |||
| 1000 | Ga0373925_0045742 | |||
| 1001 | Ga0373925_0082956 | |||
| 1002 | Ga0395898_0135325 | |||
| 1003 | Ga0395905_0000020 | |||
| 1004 | Ga0436364_0200832 | |||
| 1005 | Ga0436364_0935980 | |||
| 1006 | Ga0395901_0049764 | |||
| 1007 | Ga0395901_0107332 | |||
| 1008 | Ga0436361_0592523 | |||
| 1009 | Ga0436363_0974176 | |||
| 1010 | Ga0466963_0068868 | |||
| 1011 | Ga0466957_0050844 | |||
| 1012 | Ga0466957_0080168 | |||
| 1013 | Ga0466959_0122512 | |||
| 1014 | Ga0466967_0154899 | |||
| 1015 | Ga0495592_0000051 | |||
| 1016 | Ga0495592_0000925 | |||
| 1017 | Ga0495592_0002280 | |||
| 1018 | Ga0495592_0031734 | |||
| 1019 | Ga0495603_0002378 | |||
| 1020 | Ga0495603_0003805 | |||
| 1021 | Ga0495603_0024737 | |||
| 1022 | Ga0495590_0036028 | |||
| 1023 | Ga0495591_002794 | |||
| 1024 | Ga0495629_0000195 | |||
| 1025 | Ga0495629_0003133 | |||
| 1026 | Ga0495629_0004794 | |||
| 1027 | Ga0495629_0044241 | |||
| 1028 | Ga0495629_0066814 | |||
| 1029 | Ga0495638_0013805 | |||
| 1030 | Ga0495638_0071365 | |||
| 1031 | Ga0495641_0018341 | |||
| 1032 | Ga0495651_0000263 | |||
| 1033 | Ga0495651_0000583 | |||
| 1034 | Ga0495651_0006074 | |||
| 1035 | Ga0495651_0034505 | |||
| 1036 | Ga0495651_0107335 | |||
| 1037 | Ga0495653_0000039 | |||
| 1038 | Ga0495653_0001192 | |||
| 1039 | Ga0495653_0045250 | |||
| 1040 | Ga0495650_0001346 | |||
| 1041 | Ga0495650_0012070 | |||
| 1042 | Ga0495580_0002294 | |||
| 1043 | Ga0495580_0026059 | |||
| 1044 | Ga0495580_0027503 | |||
| 1045 | Ga0495580_0028422 | |||
| 1046 | Ga0495582_0023348 | |||
| 1047 | Ga0495605_0003236 | |||
| 1048 | Ga0495605_0023395 | |||
| 1049 | Ga0495605_0030980 | |||
| 1050 | Ga0495605_0053296 | |||
| 1051 | Ga0495639_0003849 | |||
| 1052 | Ga0495662_0013418 | |||
| 1053 | Ga0495662_0013611 | |||
| 1054 | Ga0495664_0000015 | |||
| 1055 | Ga0495664_0000375 | |||
| 1056 | Ga0495584_0084441 | |||
| 1057 | Ga0495585_0044477 | |||
| 1058 | Ga0495594_0005399 | |||
| 1059 | Ga0495594_0044952 | |||
| 1060 | Ga0495596_0005855 | |||
| 1061 | Ga0495596_0013347 | |||
| 1062 | Ga0495607_0086954 | |||
| 1063 | Ga0495583_0004968 | |||
| 1064 | Ga0495608_0000025 | |||
| 1065 | Ga0495608_0017317 | |||
| 1066 | Ga0495608_0144348 | |||
| 1067 | Ga0495616_0010848 | |||
| 1068 | Ga0495618_0000040 | |||
| 1069 | Ga0495618_0043585 | |||
| 1070 | Ga0495628_0000011 | |||
| 1071 | Ga0495630_0004426 | |||
| 1072 | Ga0495630_0012700 | |||
| 1073 | Ga0495630_0037737 | |||
| 1074 | Ga0495630_0072188 | |||
| 1075 | Ga0495648_0001911 | |||
| 1076 | Ga0495666_0012877 | |||
| 1077 | Ga0495666_0023499 | |||
| 1078 | Ga0495666_0042284 | |||
| 1079 | Ga0495642_0014346 | |||
| 1080 | Ga0495652_0000014 | |||
| 1081 | Ga0495652_0027911 | |||
| 1082 | Ga0495652_0040159 | |||
| 1083 | Ga0495652_0089875 | |||
| 1084 | Ga0495652_0111629 | |||
| 1085 | Ga0495665_0004423 | |||
| 1086 | Ga0495665_0010279 | |||
| 1087 | Ga0495665_0016341 | |||
| 1088 | Ga0495665_0032509 | |||
| 1089 | Ga0495640_0000008 | |||
| 1090 | Ga0495640_0002950 | |||
| 1091 | Ga0495640_0009570 | |||
| 1092 | Ga0495640_0010709 | |||
| 1093 | Ga0495640_0057608 | |||
| 1094 | Ga0495640_0068791 | |||
| 1095 | Ga0495586_0069190 | |||
| 1096 | Ga0495586_0070611 | |||
| 1097 | Ga0495587_0000015 | |||
| 1098 | Ga0495587_0011567 | |||
| 1099 | Ga0495621_0015396 | |||
| 1100 | Ga0495645_0000020 | |||
| 1101 | Ga0495645_0005566 | |||
| 1102 | Ga0495645_0030525 | |||
| 1103 | Ga0495645_0037034 | |||
| 1104 | Ga0495622_0000020 | |||
| 1105 | Ga0495622_0000147 | |||
| 1106 | Ga0495667_0000013 | |||
| 1107 | Ga0495667_0006693 | |||
| 1108 | Ga0495667_0095585 | |||
| 1109 | Ga0495634_0000415 | |||
| 1110 | Ga0495634_0001639 | |||
| 1111 | Ga0495634_0009154 | |||
| 1112 | Ga0495634_0047841 | |||
| 1113 | Ga0495634_0048393 | |||
| 1114 | Ga0495611_0008932 | |||
| 1115 | Ga0495635_0000012 | |||
| 1116 | Ga0495635_0001827 | |||
| 1117 | Ga0495635_0021654 | |||
| 1118 | Ga0495635_0107091 | |||
| 1119 | Ga0495661_0005088 | |||
| 1120 | Ga0495661_0030740 | |||
| 1121 | Ga0495588_0079603 | |||
| 1122 | Ga0495657_0000815 | |||
| 1123 | Ga0495657_0008582 | |||
| 1124 | Ga0495599_0000008 | |||
| 1125 | Ga0495599_0126763 | |||
| 1126 | Ga0495623_0000002 | |||
| 1127 | Ga0495623_0026799 | |||
| 1128 | Ga0495623_0062267 | |||
| 1129 | Ga0495646_0000004 | |||
| 1130 | Ga0495646_0001238 | |||
| 1131 | Ga0495646_0007246 | |||
| 1132 | Ga0495647_0002749 | |||
| 1133 | Ga0495658_0009054 | |||
| 1134 | Ga0495658_0012691 | |||
| 1135 | Ga0495658_0043870 | |||
| 1136 | Ga0495669_0020421 | |||
| 1137 | Ga0495669_0045753 | |||
| 1138 | Ga0495613_0010776 | |||
| 1139 | Ga0495613_0014563 | |||
| 1140 | Ga0495613_0159436 | |||
| 1141 | Ga0495624_0003694 | |||
| 1142 | Ga0495624_0011365 | |||
| 1143 | Ga0495624_0039101 | |||
| 1144 | Ga0495624_0040600 | |||
| 1145 | Ga0495670_0034671 | |||
| 1146 | Ga0495670_0056462 | |||
| 1147 | Ga0495671_0030914 | |||
| 1148 | Ga0495649_0031537 | |||
| 1149 | Ga0495649_0060383 | |||
| 1150 | Ga0495589_0000876 | |||
| 1151 | Ga0495589_0002891 | |||
| 1152 | Ga0495600_0000024 | |||
| 1153 | Ga0495600_0016171 | |||
| 1154 | Ga0495581_0015723 | |||
| 1155 | Ga0495581_0036668 | |||
| 1156 | Ga0495581_0043406 | |||
| 1157 | Ga0495604_0000001 | |||
| 1158 | Ga0495604_0007948 | |||
| 1159 | Ga0495604_0015166 | |||
| 1160 | Ga0495674_0000023 | |||
| 1161 | Ga0495674_0001761 | |||
| 1162 | Ga0495674_0007612 | |||
| 1163 | Ga0495674_0026948 | |||
| 1164 | Ga0495674_0029316 | |||
| 1165 | Ga0495674_0219483 | |||
| 1166 | Ga0495676_0010728 | |||
| 1167 | Ga0495676_0127482 | |||
| 1168 | Ga0495680_0001451 | |||
| 1169 | Ga0495680_0003698 | |||
| 1170 | Ga0495680_0061555 | |||
| 1171 | Ga0495680_0102512 | |||
| 1172 | Ga0495683_0007144 | |||
| 1173 | Ga0495687_028804 | |||
| 1174 | Ga0495675_0000392 | |||
| 1175 | Ga0495675_0004093 | |||
| 1176 | Ga0495675_0042674 | |||
| 1177 | Ga0495679_000036 | |||
| 1178 | Ga0495679_001250 | |||
| 1179 | Ga0495673_0017287 | |||
| 1180 | Ga0495673_0024931 | |||
| 1181 | Ga0495684_0000007 | |||
| 1182 | Ga0495684_0006845 | |||
| 1183 | Ga0495684_0017916 | |||
| 1184 | Ga0495684_0062050 | |||
| 1185 | Ga0495686_0124273 | |||
| 1186 | Ga0495593_0000886 | |||
| 1187 | Ga0495593_0001189 | |||
| 1188 | Ga0495593_0028383 | |||
| 1189 | Ga0495602_0000045 | |||
| 1190 | Ga0495602_0021399 | |||
| 1191 | Ga0495602_0036711 | |||
| 1192 | Ga0495614_0003498 | |||
| 1193 | Ga0495626_0025537 | |||
| 1194 | Ga0496101_0023051 | |||
| 1195 | Ga0496101_0026610 | |||
| 1196 | Ga0496101_0040043 | |||
| 1197 | Ga0496101_0075791 | |||
| 1198 | Ga0496102_0012310 | |||
| 1199 | Ga0496102_0187647 | |||
| 1200 | Ga0496102_0238118 | |||
| 1201 | Ga0496104_0036562 | |||
| 1202 | Ga0496104_0074929 | |||
| 1203 | Ga0496104_0080014 | |||
| 1204 | Ga0496104_0085980 | |||
| 1205 | Ga0496104_0086681 | |||
| 1206 | Ga0496104_0309842 | |||
| 1207 | Ga0496105_0044324 | |||
| 1208 | Ga0496105_0094136 | |||
| 1209 | Ga0496105_0109115 | |||
| 1210 | Ga0496105_0186454 | |||
| 1211 | Ga0496106_0026019 | |||
| 1212 | Ga0496106_0117793 | |||
| 1213 | Ga0496106_0160363 | |||
| 1214 | Ga0496107_0020118 | |||
| 1215 | Ga0496107_0045573 | |||
| 1216 | Ga0496107_0058658 | |||
| 1217 | Ga0496108_0000249 | |||
| 1218 | Ga0496108_0002673 | |||
| 1219 | Ga0496108_0047436 | |||
| 1220 | Ga0496108_0073425 | |||
| 1221 | Ga0496109_0000754 | |||
| 1222 | Ga0496109_0001468 | |||
| 1223 | Ga0496110_0000037 | |||
| 1224 | Ga0496110_0003356 | |||
| 1225 | Ga0496110_0162983 | |||
| 1226 | Ga0496110_0178520 | |||
| 1227 | Ga0496111_0002935 | |||
| 1228 | Ga0496111_0151488 | |||
| 1229 | Ga0496112_0007789 | |||
| 1230 | Ga0496112_0015644 | |||
| 1231 | Ga0496113_0000455 | |||
| 1232 | Ga0496113_0000937 | |||
| 1233 | Ga0496113_0066187 | |||
| 1234 | Ga0496114_0013377 | |||
| 1235 | Ga0496114_0084644 | |||
| 1236 | Ga0496114_0300737 | |||
| 1237 | Ga0496115_0079809 | |||
| 1238 | Ga0496115_0163201 | |||
| 1239 | Ga0496116_0022456 | |||
| 1240 | Ga0496116_0094798 | |||
| 1241 | Ga0496117_0031450 | |||
| 1242 | Ga0496118_0021608 | |||
| 1243 | Ga0496118_0025416 | |||
| 1244 | Ga0496121_0000186 | |||
| 1245 | Ga0496121_0002020 | |||
| 1246 | Ga0496122_0003710 | |||
| 1247 | Ga0496123_0001431 | |||
| 1248 | Ga0496126_0001613 | |||
| 1249 | Ga0495678_032607 | |||
| 1250 | Ga0495682_0014033 | |||
| 1251 | Ga0501034_0118824 | |||
| 1252 | Ga0501043_0301095 | |||
| 1253 | Ga0501047_0034081 | |||
| 1254 | Ga0501070_0203032 | |||
| 1255 | Ga0501075_0199288 | |||
| 1256 | Ga0501080_0082130 | |||
| 1257 | Ga0501035_0004649 | |||
| 1258 | Ga0501044_0024057 | |||
| 1259 | Ga0501044_0029787 | |||
| 1260 | nmdc:mga03n38_22539_c1 | |||
| 1261 | nmdc:mga0yw44_96930_c1 | |||
| 1262 | nmdc:mga05p37_37242_c1 | |||
| 1263 | nmdc:mga05p37_97872_c1 | |||
| 1264 | nmdc:mga09592_37452_c1 | |||
| 1265 | nmdc:mga09592_43549_c1 | |||
| 1266 | nmdc:mga0qj67_21925_c1 | |||
| 1267 | nmdc:mga06r32_140023_c1 | |||
| 1268 | nmdc:mga06r32_151626_c1 | |||
| 1269 | nmdc:mga08y16_128345_c1 | |||
| 1270 | nmdc:mga08y16_136408_c1 | |||
| 1271 | nmdc:mga0n895_112995_c1 | |||
| 1272 | nmdc:mga0n895_113742_c1 | |||
| 1273 | nmdc:mga0n895_14307_c1 | |||
| 1274 | nmdc:mga0n895_42361_c1 | |||
| 1275 | nmdc:mga08x19_16913_c1 | |||
| 1276 | nmdc:mga08x19_7348_c1 | |||
| 1277 | Ga0495601_0000014 | |||
| 1278 | Ga0495601_0000579 | |||
| 1279 | Ga0495601_0000751 | |||
| 1280 | Ga0495601_0007390 | |||
| 1281 | Ga0495601_0009463 | |||
| 1282 | Ga0495601_0074811 | |||
| 1283 | Ga0495612_0000014 | |||
| 1284 | Ga0495612_0000428 | |||
| 1285 | Ga0495612_0000961 | |||
| 1286 | Ga0495595_0000038 | |||
| 1287 | Ga0495595_0000614 | |||
| 1288 | Ga0495595_0001366 | |||
| 1289 | Ga0495619_0000006 | |||
| 1290 | Ga0495619_0000706 | |||
| 1291 | Ga0495619_0007500 | |||
| 1292 | Ga0495619_0015998 | |||
| 1293 | Ga0495619_0032522 | |||
| 1294 | Ga0495619_0033808 | |||
| 1295 | Ga0495619_0036007 | |||
| 1296 | Ga0495619_0045438 | |||
| 1297 | Ga0495619_0064626 | |||
| 1298 | Ga0495619_0116689 | |||
| 1299 | Ga0500593_000017 | |||
| 1300 | Ga0500568_0000002 | |||
| 1301 | Ga0500568_0045391 | |||
| 1302 | 2511247512 | |||
| 1303 | 2563063718 | |||
| 1304 | 2713474604 | |||
| 1305 | 2792833410 | |||
| 1306 | 2842333171 | |||
| 1307 | 2855731098 | |||
| 1308 | 2855770301 | |||
| 1309 | 2881414522 | |||
| 1310 | 2884816980 | |||
| 1311 | 2884840915 | |||
| 1312 | 2884857489 | |||
| 1313 | 2885277139 | |||
| 1314 | 2896158429 | |||
| 1315 | 2904623224 | |||
| 1316 | 2921643541 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7e9d-assembly1.cif.gz_B | h102a mutant of irg1 from bacillus | 0.8715 | 12 | 463 |
| 7e9d-assembly1.cif.gz_B | h102a mutant of irg1 from bacillus | 0.8605 | 12 | 463 |
| 2hp0-assembly1.cif.gz_A | crystal structure of iminodisuccinate epimerase | 0.8548 | 12 | 460 |
| 7bra-assembly1.cif.gz_B | bacillus subtilis irg1 | 0.8545 | 12 | 463 |
| 2hp0-assembly1.cif.gz_A | crystal structure of iminodisuccinate epimerase | 0.8459 | 12 | 460 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hp3B01 | Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD | 0.8488 | 12 | 277 | 1.10.4100.10 |
| 1szqB02 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD | 0.8427 | 276 | 410 | 3.30.1330.120 |
| 3w5mA02 | Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like | 0.8314 | 390 | 406 | 2.60.120.260 |
| 2chsI00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.8269 | 284 | 315 | 3.30.1330.40 |
| 1szqB02 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD | 0.8153 | 276 | 410 | 3.30.1330.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537B7X7-F1-model_v4 | MmgE/PrpD family protein | 0.978 | 268 | 463 |
GO:0016829
|
| AF-A0A536WTG6-F1-model_v4 | MmgE/PrpD family protein | 0.9688 | 11 | 466 |
GO:0016829
|
| AF-A0A2N1QLR3-F1-model_v4 | MmgE/PrpD family protein | 0.9661 | 12 | 196 |
GO:0016829
|
| AF-A0A537FLW6-F1-model_v4 | MmgE/PrpD family protein | 0.956 | 11 | 466 |
GO:0016829
|
| AF-A0A1V5E911-F1-model_v4 | 2-methylcitrate dehydratase | 0.955 | 256 | 463 |
GO:0016829
|