F473203

General Info

Members Datasets Scaffolds Average Seq Length
658 316 1316 465

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0007216|Ga0495634_0007216_29_1609
Length 517
Sequence MIKSEQHSVDRRNFLKITAGTAAALVASAPRAGGQENSDRPSNKQTSGERKTKVDAPAGERTAERSANNPYTQGMAAFISGLRYEQIPAEVIDRIKLLMLDSLGCAIYGVDLEWSRILMRTLKELDSSNSCGVWGTSLRLSAPHAALVNGTLVHGFELDDIHRLGVMHVGAVTLPSLLAVTEIKPGISGRDFLTAAVAGYEIGPRVGRCMGEEHIGQGWHSAATVGVFSRLSREQTVHALGIAGTQSAGLMAAEYGSMVLRMHTGRSAQSGLYGGLLAAKGFTGIVNVFESTYGGFCTTFSRSQDRFDLAELTSGLGTRFETMQVSLKFYSCVSSNHTTLDAIRAIRARRSFSVGEVDHIIVHGSQVTVDHVGWKYRPDGISAAQLNLPFCVATLLLDGDVFVDQFTALKIVDPVRIALADKVEVVADPEIVARGSEFRQMVRAEIFLKDGTVLTETIETPRGSERNFASKSDVVGKFENLAGHAIPRARAAAIQEAVLNLETLPDSSRLANLLTKR

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
292 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
293 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
294 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
303 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
304 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
305 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
306 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
307 2855730933 Achromobacter sp. HZ28 Isolate Nodule
308 2855767633 Achromobacter sp. HZ34 Isolate Nodule
309 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
310 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
311 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
312 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
313 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
314 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
315 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
316 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0.76
Rhizoplane 6.84
Rhizosphere 87.23
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0007216 3300046642 Bacteria 8378
2 JGI24750J21931_1001266 3300002070 Bacteria 3194
3 JGI24742J22300_10000928 3300002244 Bacteria 4472
4 JGI25151J46595_10003207 3300003187 Bacteria 9164
5 rootH1_10097723 3300003323 Bacteria 3805
6 Ga0065712_10010748 3300005290 Bacteria 2155
7 Ga0065712_10105777 3300005290 Bacteria 1920
8 Ga0070658_10014828 3300005327 Bacteria 6245
9 Ga0070658_10032865 3300005327 Bacteria 4172
10 Ga0070658_10063027 3300005327 Bacteria 3022
11 Ga0070676_10027837 3300005328 Bacteria 3208
12 Ga0070683_100001114 3300005329 Bacteria 20301
13 Ga0070683_100001248 3300005329 Bacteria 19351
14 Ga0070690_100024232 3300005330 Bacteria 3730
15 Ga0070670_100001277 3300005331 Bacteria 20065
16 Ga0070670_100002839 3300005331 Bacteria 14325
17 Ga0070670_100003204 3300005331 Bacteria 13509
18 Ga0070670_100061716 3300005331 Bacteria 3217
19 Ga0070670_100077089 3300005331 Bacteria 2864
20 Ga0070670_100095271 3300005331 Bacteria 2560
21 Ga0070677_10003682 3300005333 Bacteria 4953
22 Ga0070677_10023089 3300005333 Bacteria 2299
23 Ga0070677_10056765 3300005333 Bacteria 1602
24 Ga0070666_10057991 3300005335 Bacteria 2617
25 Ga0070680_100017231 3300005336 Bacteria 5693
26 Ga0068868_100000410 3300005338 Bacteria 28968
27 Ga0068868_100001321 3300005338 Bacteria 17082
28 Ga0068868_100063223 3300005338 Bacteria 2936
29 Ga0070689_100055569 3300005340 Bacteria 3068
30 Ga0070687_100005754 3300005343 Bacteria 5032
31 Ga0070661_100000923 3300005344 Bacteria 21058
32 Ga0070661_100003988 3300005344 Bacteria 10154
33 Ga0070661_100061340 3300005344 Bacteria 2760
34 Ga0070669_100171565 3300005353 Bacteria 1691
35 Ga0070675_100000071 3300005354 Bacteria 59417
36 Ga0070675_100000793 3300005354 Bacteria 22161
37 Ga0070671_100001499 3300005355 Bacteria 17468
38 Ga0070674_100063360 3300005356 Bacteria 2587
39 Ga0070674_100103655 3300005356 Bacteria 2077
40 Ga0070673_100000149 3300005364 Bacteria 33510
41 Ga0070673_100065651 3300005364 Bacteria 2896
42 Ga0070673_100149443 3300005364 Bacteria 1977
43 Ga0070673_100179422 3300005364 Bacteria 1812
44 Ga0070659_100016067 3300005366 Bacteria 5616
45 Ga0070667_100051010 3300005367 Bacteria 3487
46 Ga0070667_100075575 3300005367 Bacteria 2876
47 Ga0070713_100000870 3300005436 Bacteria 19329
48 Ga0070713_100006605 3300005436 Bacteria 8061
49 Ga0070713_100136935 3300005436 Bacteria 2165
50 Ga0070710_10016803 3300005437 Bacteria 3731
51 Ga0070711_100015513 3300005439 Bacteria 4825
52 Ga0070700_100010063 3300005441 Bacteria 5206
53 Ga0070694_100073118 3300005444 Bacteria 2367
54 Ga0070708_100242222 3300005445 Unclassified 1693
55 Ga0070663_100014372 3300005455 Bacteria 5081
56 Ga0070678_100000010 3300005456 Bacteria 58577
57 Ga0070678_100000373 3300005456 Bacteria 20912
58 Ga0070678_100052822 3300005456 Bacteria 2952
59 Ga0070681_10009601 3300005458 Bacteria 9513
60 Ga0070681_10054888 3300005458 Bacteria 3969
61 Ga0068867_100018813 3300005459 Bacteria 4914
62 Ga0068867_100037683 3300005459 Bacteria 3515
63 Ga0070685_10009635 3300005466 Bacteria 4999
64 Ga0070707_100040082 3300005468 Bacteria 4479
65 Ga0070699_100038745 3300005518 Bacteria 4127
66 Ga0070697_100042401 3300005536 Bacteria 3683
67 Ga0070672_100000312 3300005543 Bacteria 27513
68 Ga0070672_100000909 3300005543 Bacteria 17718
69 Ga0070672_100106850 3300005543 Bacteria 2277
70 Ga0070695_100019408 3300005545 Bacteria 4140
71 Ga0070695_100066573 3300005545 Unclassified 2348
72 Ga0070704_100190634 3300005549 Bacteria 1648
73 Ga0068855_100029244 3300005563 Bacteria 6590
74 Ga0068855_100029314 3300005563 Bacteria 6580
75 Ga0068855_100199259 3300005563 Bacteria 2255
76 Ga0068855_100216522 3300005563 Bacteria 2150
77 Ga0070664_100000179 3300005564 Bacteria 44681
78 Ga0070664_100002026 3300005564 Bacteria 16244
79 Ga0068854_100040322 3300005578 Bacteria 3295
80 Ga0068852_100000828 3300005616 Bacteria 20438
81 Ga0068852_100002798 3300005616 Bacteria 12085
82 Ga0068852_100014313 3300005616 Bacteria 6101
83 Ga0068852_100036862 3300005616 Bacteria 4096
84 Ga0068859_100177933 3300005617 Bacteria 2209
85 Ga0068864_100001555 3300005618 Bacteria 18895
86 Ga0068864_100026648 3300005618 Bacteria 4874
87 Ga0068864_100105263 3300005618 Bacteria 2507
88 Ga0068864_100123609 3300005618 Bacteria 2316
89 Ga0068851_10000460 3300005834 Bacteria 17963
90 Ga0068870_10003702 3300005840 Bacteria 6496
91 Ga0068863_100008612 3300005841 Bacteria 9970
92 Ga0068863_100028706 3300005841 Bacteria 5312
93 Ga0068863_100113454 3300005841 Bacteria 2581
94 Ga0068858_100076882 3300005842 Bacteria 3100
95 Ga0068858_100109782 3300005842 Bacteria 2575
96 Ga0068860_100195206 3300005843 Bacteria 1960
97 Ga0068860_100209543 3300005843 Bacteria 1890
98 Ga0081455_10006987 3300005937 Bacteria 11993
99 Ga0081540_1000015 3300005983 Bacteria 178704
100 Ga0070717_10025797 3300006028 Bacteria 4681
101 Ga0075365_10000662 3300006038 Bacteria 13766
102 Ga0075363_100004310 3300006048 Bacteria 6194
103 Ga0097621_100000056 3300006237 Bacteria 59138
104 Ga0097621_100000761 3300006237 Bacteria 22608
105 Ga0097621_100059374 3300006237 Bacteria 3131
106 Ga0075370_10026536 3300006353 Bacteria 3209
107 Ga0075370_10041441 3300006353 Bacteria 2599
108 Ga0068871_100000774 3300006358 Bacteria 21535
109 Ga0068871_100030458 3300006358 Bacteria 4249
110 Ga0068871_100140432 3300006358 Bacteria 2054
111 Ga0075428_100002507 3300006844 Bacteria 19942
112 Ga0075428_100148536 3300006844 Bacteria 2547
113 Ga0075428_100152086 3300006844 Bacteria 2514
114 Ga0075430_100000747 3300006846 Bacteria 25006
115 Ga0075431_100037913 3300006847 Bacteria 4963
116 Ga0075431_100093494 3300006847 Bacteria 3103
117 Ga0075434_100076792 3300006871 Bacteria 3335
118 Ga0075434_100201361 3300006871 Bacteria 2011
119 Ga0075429_100044461 3300006880 Bacteria 3863
120 Ga0075429_100046477 3300006880 Bacteria 3777
121 Ga0075436_100004335 3300006914 Bacteria 9736
122 Ga0075436_100011918 3300006914 Bacteria 5964
123 Ga0097620_100177927 3300006931 Bacteria 2209
124 Ga0075435_100078885 3300007076 Bacteria 2701
125 Ga0075435_100145458 3300007076 Bacteria 1991
126 Ga0099795_10000578 3300007788 Bacteria 6961
127 Ga0105240_10024423 3300009093 Bacteria 7965
128 Ga0111539_10068503 3300009094 Bacteria 4189
129 Ga0111539_10112275 3300009094 Bacteria 3197
130 Ga0111539_10171590 3300009094 Bacteria 2534
131 Ga0114129_10029908 3300009147 Bacteria 7713
132 Ga0114129_10073179 3300009147 Bacteria 4775
133 Ga0114129_10088023 3300009147 Bacteria 4306
134 Ga0114129_10293365 3300009147 Bacteria 2169
135 Ga0105248_10023630 3300009177 Bacteria 6829
136 Ga0105248_10030350 3300009177 Bacteria 6035
137 Ga0105248_10181994 3300009177 Bacteria 2368
138 Ga0105248_10325795 3300009177 Bacteria 1730
139 Ga0099796_10020942 3300010159 Bacteria 2006
140 Ga0157374_10000729 3300013296 Bacteria 28724
141 Ga0157374_10001930 3300013296 Bacteria 17393
142 Ga0157374_10070369 3300013296 Bacteria 3297
143 Ga0157378_10003430 3300013297 Bacteria 14070
144 Ga0157378_10007916 3300013297 Bacteria 9272
145 Ga0157378_10164516 3300013297 Bacteria 2077
146 Ga0163162_10001281 3300013306 Bacteria 23539
147 Ga0163162_10007039 3300013306 Bacteria 10904
148 Ga0163162_10026510 3300013306 Bacteria 5727
149 Ga0157372_10175542 3300013307 Bacteria 2480
150 Ga0157372_10194490 3300013307 Bacteria 2349
151 Ga0157375_10002204 3300013308 Bacteria 16840
152 Ga0157375_10003743 3300013308 Bacteria 13196
153 Ga0157375_10030147 3300013308 Bacteria 5111
154 Ga0157375_10110257 3300013308 Bacteria 2849
155 Ga0163163_10014783 3300014325 Bacteria 7184
156 Ga0163163_10150452 3300014325 Bacteria 2372
157 Ga0157379_10026622 3300014968 Bacteria 5148
158 Ga0157376_10010135 3300014969 Bacteria 6882
159 Ga0157376_10019293 3300014969 Bacteria 5251
160 Ga0157376_10050250 3300014969 Bacteria 3459
161 Ga0157376_10069317 3300014969 Bacteria 2989
162 Ga0213875_10004743 3300021388 Bacteria 7395
163 Ga0209025_1000003 3300025294 Bacteria 1366495
164 Ga0207697_10005175 3300025315 Bacteria 6088
165 Ga0207656_10000449 3300025321 Bacteria 13758
166 Ga0207682_10004778 3300025893 Bacteria 5613
167 Ga0207682_10005745 3300025893 Bacteria 5031
168 Ga0207682_10006398 3300025893 Bacteria 4746
169 Ga0207692_10032563 3300025898 Bacteria 2506
170 Ga0207688_10005568 3300025901 Bacteria 6849
171 Ga0207688_10031318 3300025901 Bacteria 2936
172 Ga0207680_10031812 3300025903 Bacteria 2993
173 Ga0207645_10026467 3300025907 Bacteria 3748
174 Ga0207645_10027285 3300025907 Bacteria 3689
175 Ga0207645_10040519 3300025907 Bacteria 2982
176 Ga0207643_10002035 3300025908 Bacteria 11158
177 Ga0207705_10011650 3300025909 Bacteria 6352
178 Ga0207684_10087908 3300025910 Bacteria 2648
179 Ga0207707_10097415 3300025912 Bacteria 2570
180 Ga0207707_10103866 3300025912 Bacteria 2483
181 Ga0207663_10129564 3300025916 Unclassified 1741
182 Ga0207660_10035713 3300025917 Bacteria 3452
183 Ga0207660_10180079 3300025917 Bacteria 1641
184 Ga0207662_10005039 3300025918 Bacteria 6996
185 Ga0207662_10014029 3300025918 Bacteria 4488
186 Ga0207662_10055906 3300025918 Bacteria 2356
187 Ga0207662_10057093 3300025918 Bacteria 2332
188 Ga0207657_10049054 3300025919 Bacteria 3682
189 Ga0207657_10059744 3300025919 Bacteria 3274
190 Ga0207657_10113392 3300025919 Bacteria 2236
191 Ga0207649_10004827 3300025920 Bacteria 7292
192 Ga0207649_10071121 3300025920 Bacteria 2221
193 Ga0207649_10144829 3300025920 Bacteria 1630
194 Ga0207646_10054665 3300025922 Bacteria 3571
195 Ga0207681_10073295 3300025923 Bacteria 2394
196 Ga0207650_10001859 3300025925 Bacteria 14883
197 Ga0207650_10002001 3300025925 Bacteria 14277
198 Ga0207650_10003953 3300025925 Bacteria 10141
199 Ga0207650_10004434 3300025925 Bacteria 9589
200 Ga0207650_10115869 3300025925 Bacteria 2080
201 Ga0207659_10000756 3300025926 Bacteria 19182
202 Ga0207659_10047343 3300025926 Bacteria 3041
203 Ga0207659_10064728 3300025926 Bacteria 2647
204 Ga0207700_10107367 3300025928 Bacteria 2240
205 Ga0207644_10000182 3300025931 Bacteria 44971
206 Ga0207644_10001114 3300025931 Bacteria 17235
207 Ga0207644_10064408 3300025931 Bacteria 2663
208 Ga0207706_10012119 3300025933 Bacteria 7853
209 Ga0207706_10061191 3300025933 Bacteria 3315
210 Ga0207670_10064533 3300025936 Bacteria 2510
211 Ga0207669_10077955 3300025937 Bacteria 2109
212 Ga0207669_10097614 3300025937 Bacteria 1932
213 Ga0207704_10076465 3300025938 Bacteria 2145
214 Ga0207704_10087305 3300025938 Bacteria 2037
215 Ga0207691_10000678 3300025940 Bacteria 33621
216 Ga0207691_10001156 3300025940 Bacteria 26211
217 Ga0207691_10064030 3300025940 Bacteria 3333
218 Ga0207711_10012082 3300025941 Bacteria 7177
219 Ga0207711_10025993 3300025941 Bacteria 4911
220 Ga0207711_10051184 3300025941 Bacteria 3537
221 Ga0207711_10098834 3300025941 Bacteria 2579
222 Ga0207689_10038282 3300025942 Bacteria 3973
223 Ga0207661_10001359 3300025944 Bacteria 16398
224 Ga0207661_10094719 3300025944 Bacteria 2495
225 Ga0207679_10023955 3300025945 Bacteria 4181
226 Ga0207679_10134818 3300025945 Bacteria 1987
227 Ga0207667_10071075 3300025949 Bacteria 3620
228 Ga0207667_10167063 3300025949 Bacteria 2262
229 Ga0207651_10021614 3300025960 Bacteria 3914
230 Ga0207651_10069604 3300025960 Bacteria 2485
231 Ga0207668_10162177 3300025972 Bacteria 1743
232 Ga0207640_10039827 3300025981 Bacteria 2977
233 Ga0207658_10017093 3300025986 Bacteria 4996
234 Ga0207677_10002173 3300026023 Bacteria 10305
235 Ga0207677_10150407 3300026023 Unclassified 1795
236 Ga0207703_10031279 3300026035 Bacteria 4207
237 Ga0207703_10087115 3300026035 Bacteria 2617
238 Ga0207703_10140468 3300026035 Bacteria 2095
239 Ga0207678_10009696 3300026067 Bacteria 8469
240 Ga0207708_10001367 3300026075 Bacteria 18341
241 Ga0207708_10006646 3300026075 Bacteria 8555
242 Ga0207708_10015205 3300026075 Bacteria 5770
243 Ga0207702_10114055 3300026078 Bacteria 2408
244 Ga0207641_10030033 3300026088 Bacteria 4499
245 Ga0207641_10034677 3300026088 Bacteria 4200
246 Ga0207648_10013037 3300026089 Bacteria 7752
247 Ga0207648_10019977 3300026089 Bacteria 6044
248 Ga0207648_10028751 3300026089 Bacteria 4928
249 Ga0207648_10034648 3300026089 Bacteria 4450
250 Ga0207648_10053083 3300026089 Bacteria 3544
251 Ga0207676_10003358 3300026095 Bacteria 11343
252 Ga0207676_10008867 3300026095 Bacteria 7155
253 Ga0207676_10009977 3300026095 Bacteria 6756
254 Ga0207676_10017400 3300026095 Bacteria 5208
255 Ga0207676_10070764 3300026095 Bacteria 2798
256 Ga0207676_10073864 3300026095 Bacteria 2745
257 Ga0207674_10161610 3300026116 Bacteria 2194
258 Ga0207675_100011762 3300026118 Bacteria 8180
259 Ga0207675_100012361 3300026118 Bacteria 7974
260 Ga0207675_100016943 3300026118 Bacteria 6809
261 Ga0207683_10000381 3300026121 Bacteria 40910
262 Ga0207683_10000429 3300026121 Bacteria 38858
263 Ga0207683_10131784 3300026121 Bacteria 2249
264 Ga0207683_10245887 3300026121 Bacteria 1632
265 Ga0207698_10000528 3300026142 Bacteria 22203
266 Ga0207698_10008747 3300026142 Bacteria 6421
267 Ga0207698_10023268 3300026142 Bacteria 4325
268 Ga0209969_1000749 3300027360 Bacteria 4355
269 Ga0210000_1000409 3300027462 Bacteria 5959
270 Ga0209995_1002001 3300027471 Bacteria 3194
271 Ga0209970_1004110 3300027614 Bacteria 2425
272 Ga0209588_1014496 3300027671 Bacteria 2414
273 Ga0209974_10001292 3300027876 Bacteria 9011
274 Ga0268265_10061143 3300028380 Bacteria 2890
275 Ga0268264_10048040 3300028381 Bacteria 3549
276 Ga0265337_1005978 3300028556 Bacteria 4751
277 Ga0265318_10000775 3300028577 Bacteria 21191
278 Ga0265318_10012647 3300028577 Bacteria 3584
279 Ga0265318_10038829 3300028577 Bacteria 1818
280 Ga0265338_10000644 3300028800 Bacteria 60398
281 Ga0265338_10006542 3300028800 Bacteria 14807
282 Ga0265338_10089938 3300028800 Bacteria 2542
283 Ga0265330_10016917 3300031235 Bacteria 3362
284 Ga0265330_10034699 3300031235 Bacteria 2252
285 Ga0265332_10002343 3300031238 Bacteria 9666
286 Ga0265332_10002820 3300031238 Bacteria 8626
287 Ga0265328_10007093 3300031239 Bacteria 4695
288 Ga0265328_10017265 3300031239 Bacteria 2795
289 Ga0265320_10016073 3300031240 Bacteria 4205
290 Ga0265320_10020231 3300031240 Bacteria 3614
291 Ga0265325_10008895 3300031241 Bacteria 5900
292 Ga0265325_10010857 3300031241 Bacteria 5250
293 Ga0265329_10003801 3300031242 Bacteria 6485
294 Ga0265339_10000133 3300031249 Bacteria 60726
295 Ga0265339_10041324 3300031249 Bacteria 2561
296 Ga0265331_10005523 3300031250 Bacteria 7622
297 Ga0265331_10006226 3300031250 Bacteria 7078
298 Ga0265331_10048336 3300031250 Bacteria 2045
299 Ga0265316_10003811 3300031344 Bacteria 15143
300 Ga0265313_10000491 3300031595 Bacteria 41687
301 Ga0265313_10017071 3300031595 Bacteria 4143
302 Ga0265313_10023906 3300031595 Bacteria 3280
303 Ga0265314_10001327 3300031711 Bacteria 28028
304 Ga0265314_10004625 3300031711 Bacteria 12676
305 Ga0265314_10009507 3300031711 Bacteria 8196
306 Ga0265314_10021442 3300031711 Bacteria 4966
307 Ga0265342_10003079 3300031712 Bacteria 13936
308 Ga0265342_10009617 3300031712 Bacteria 6788
309 Ga0307507_10041293 3300033179 Bacteria 4619
310 Ga0373944_0014757 3300035089 Bacteria 2184
311 Ga0373936_0000414 3300035113 Bacteria 14400
312 Ga0373936_0037673 3300035113 Bacteria 1932
313 Ga0373945_0025942 3300035116 Bacteria 2039
314 Ga0373954_0003714 3300035118 Bacteria 6502
315 Ga0373957_0028120 3300035120 Bacteria 2047
316 Ga0373943_0000765 3300035170 Bacteria 14011
317 Ga0373943_0002746 3300035170 Bacteria 8010
318 Ga0373943_0003109 3300035170 Bacteria 7539
319 Ga0373943_0015662 3300035170 Bacteria 3449
320 Ga0373943_0051268 3300035170 Bacteria 2031
321 Ga0373946_0003963 3300035171 Bacteria 5267
322 Ga0373955_0000940 3300035172 Bacteria 12458
323 Ga0373955_0015680 3300035172 Bacteria 3716
324 Ga0373924_0039618 3300035410 Bacteria 1925
325 Ga0373935_0000227 3300035692 Bacteria 27455
326 Ga0373935_0007148 3300035692 Bacteria 6664
327 Ga0373927_0003928 3300035695 Bacteria 10541
328 Ga0373927_0010806 3300035695 Bacteria 6083
329 Ga0373927_0029729 3300035695 Bacteria 3563
330 Ga0373933_0008736 3300035724 Bacteria 5524
331 Ga0373947_0000216 3300035725 Bacteria 32290
332 Ga0373947_0006128 3300035725 Bacteria 6996
333 Ga0373947_0006147 3300035725 Bacteria 6985
334 Ga0373947_0013899 3300035725 Bacteria 4615
335 Ga0373937_0000003 3300036401 Bacteria 235408
336 Ga0373937_0018622 3300036401 Bacteria 6203
337 Ga0373937_0045582 3300036401 Bacteria 4007
338 Ga0373937_0189744 3300036401 Bacteria 1931
339 Ga0373925_0000118 3300037068 Bacteria 85072
340 Ga0373925_0003524 3300037068 Bacteria 12079
341 Ga0373925_0011384 3300037068 Bacteria 6450
342 Ga0373925_0045742 3300037068 Bacteria 3252
343 Ga0373925_0082956 3300037068 Bacteria 2440
344 Ga0395898_0135325 3300037466 Bacteria 2359
345 Ga0395905_0000020 3300037471 Bacteria 337672
346 Ga0436364_0200832 3300037853 Bacteria 50854
347 Ga0436364_0935980 3300037853 Bacteria 9417
348 Ga0395901_0049764 3300038443 Bacteria 4354
349 Ga0395901_0107332 3300038443 Bacteria 2931
350 Ga0436361_0592523 3300039447 Bacteria 2022
351 Ga0436363_0974176 3300039450 Bacteria 4856
352 Ga0466963_0068868 3300044694 Bacteria 2377
353 Ga0466957_0050844 3300044842 Bacteria 2522
354 Ga0466957_0080168 3300044842 Bacteria 2032
355 Ga0466959_0122512 3300045049 Bacteria 1847
356 Ga0466967_0154899 3300045976 Bacteria 2145
357 Ga0495592_0000051 3300046454 Bacteria 111216
358 Ga0495592_0000925 3300046454 Bacteria 20366
359 Ga0495592_0002280 3300046454 Bacteria 13533
360 Ga0495592_0031734 3300046454 Bacteria 3991
361 Ga0495603_0002378 3300046455 Bacteria 11057
362 Ga0495603_0003805 3300046455 Bacteria 8985
363 Ga0495603_0024737 3300046455 Bacteria 3632
364 Ga0495590_0036028 3300046457 Bacteria 1726
365 Ga0495591_002794 3300046458 Bacteria 9400
366 Ga0495629_0000195 3300046459 Bacteria 54287
367 Ga0495629_0003133 3300046459 Bacteria 12533
368 Ga0495629_0004794 3300046459 Bacteria 10144
369 Ga0495629_0044241 3300046459 Bacteria 3125
370 Ga0495629_0066814 3300046459 Bacteria 2510
371 Ga0495638_0013805 3300046460 Bacteria 5484
372 Ga0495638_0071365 3300046460 Bacteria 2124
373 Ga0495641_0018341 3300046461 Bacteria 3614
374 Ga0495651_0000263 3300046462 Bacteria 40725
375 Ga0495651_0000583 3300046462 Bacteria 28302
376 Ga0495651_0006074 3300046462 Bacteria 9224
377 Ga0495651_0034505 3300046462 Bacteria 3943
378 Ga0495651_0107335 3300046462 Bacteria 2069
379 Ga0495653_0000039 3300046463 Bacteria 119840
380 Ga0495653_0001192 3300046463 Bacteria 20136
381 Ga0495653_0045250 3300046463 Bacteria 3413
382 Ga0495650_0001346 3300046471 Bacteria 24430
383 Ga0495650_0012070 3300046471 Bacteria 4673
384 Ga0495580_0002294 3300046472 Bacteria 16699
385 Ga0495580_0026059 3300046472 Bacteria 4266
386 Ga0495580_0027503 3300046472 Bacteria 4138
387 Ga0495580_0028422 3300046472 Bacteria 4063
388 Ga0495582_0023348 3300046473 Bacteria 3384
389 Ga0495605_0003236 3300046474 Bacteria 9777
390 Ga0495605_0023395 3300046474 Bacteria 3250
391 Ga0495605_0030980 3300046474 Bacteria 2736
392 Ga0495605_0053296 3300046474 Bacteria 1963
393 Ga0495639_0003849 3300046475 Bacteria 6447
394 Ga0495662_0013418 3300046476 Bacteria 3987
395 Ga0495662_0013611 3300046476 Bacteria 3960
396 Ga0495664_0000015 3300046477 Bacteria 192569
397 Ga0495664_0000375 3300046477 Bacteria 21707
398 Ga0495584_0084441 3300046491 Bacteria 1599
399 Ga0495585_0044477 3300046492 Bacteria 2481
400 Ga0495594_0005399 3300046499 Bacteria 6566
401 Ga0495594_0044952 3300046499 Bacteria 2423
402 Ga0495596_0005855 3300046500 Bacteria 5748
403 Ga0495596_0013347 3300046500 Bacteria 3487
404 Ga0495607_0086954 3300046501 Bacteria 1703
405 Ga0495583_0004968 3300046506 Bacteria 9230
406 Ga0495608_0000025 3300046511 Bacteria 158132
407 Ga0495608_0017317 3300046511 Bacteria 4985
408 Ga0495608_0144348 3300046511 Bacteria 1518
409 Ga0495616_0010848 3300046513 Bacteria 5250
410 Ga0495618_0000040 3300046514 Bacteria 98012
411 Ga0495618_0043585 3300046514 Bacteria 2830
412 Ga0495628_0000011 3300046516 Bacteria 225267
413 Ga0495630_0004426 3300046517 Bacteria 9858
414 Ga0495630_0012700 3300046517 Bacteria 6119
415 Ga0495630_0037737 3300046517 Bacteria 3613
416 Ga0495630_0072188 3300046517 Unclassified 2598
417 Ga0495648_0001911 3300046524 Bacteria 19892
418 Ga0495666_0012877 3300046526 Bacteria 4169
419 Ga0495666_0023499 3300046526 Bacteria 3048
420 Ga0495666_0042284 3300046526 Bacteria 2204
421 Ga0495642_0014346 3300046528 Bacteria 3069
422 Ga0495652_0000014 3300046529 Bacteria 225484
423 Ga0495652_0027911 3300046529 Bacteria 4972
424 Ga0495652_0040159 3300046529 Bacteria 4044
425 Ga0495652_0089875 3300046529 Bacteria 2514
426 Ga0495652_0111629 3300046529 Bacteria 2198
427 Ga0495665_0004423 3300046531 Bacteria 7589
428 Ga0495665_0010279 3300046531 Bacteria 5065
429 Ga0495665_0016341 3300046531 Bacteria 3999
430 Ga0495665_0032509 3300046531 Bacteria 2791
431 Ga0495640_0000008 3300046533 Bacteria 220320
432 Ga0495640_0002950 3300046533 Bacteria 13700
433 Ga0495640_0009570 3300046533 Bacteria 7538
434 Ga0495640_0010709 3300046533 Bacteria 7074
435 Ga0495640_0057608 3300046533 Bacteria 2651
436 Ga0495640_0068791 3300046533 Bacteria 2382
437 Ga0495586_0069190 3300046535 Bacteria 1926
438 Ga0495586_0070611 3300046535 Bacteria 1907
439 Ga0495587_0000015 3300046536 Bacteria 187415
440 Ga0495587_0011567 3300046536 Bacteria 5587
441 Ga0495621_0015396 3300046539 Bacteria 2439
442 Ga0495645_0000020 3300046543 Bacteria 143867
443 Ga0495645_0005566 3300046543 Bacteria 8663
444 Ga0495645_0030525 3300046543 Bacteria 3925
445 Ga0495645_0037034 3300046543 Bacteria 3556
446 Ga0495622_0000020 3300046557 Bacteria 166839
447 Ga0495622_0000147 3300046557 Bacteria 60460
448 Ga0495667_0000013 3300046559 Bacteria 220294
449 Ga0495667_0006693 3300046559 Bacteria 7819
450 Ga0495667_0095585 3300046559 Bacteria 1924
451 Ga0495634_0000415 3300046642 Bacteria 42260
452 Ga0495634_0001639 3300046642 Bacteria 19477
453 Ga0495634_0009154 3300046642 Bacteria 7313
454 Ga0495634_0047841 3300046642 Bacteria 2881
455 Ga0495634_0048393 3300046642 Bacteria 2862
456 Ga0495611_0008932 3300046648 Bacteria 4239
457 Ga0495635_0000012 3300046663 Bacteria 225271
458 Ga0495635_0001827 3300046663 Bacteria 14391
459 Ga0495635_0021654 3300046663 Bacteria 4481
460 Ga0495635_0107091 3300046663 Bacteria 1909
461 Ga0495661_0005088 3300046665 Bacteria 9379
462 Ga0495661_0030740 3300046665 Bacteria 3417
463 Ga0495588_0079603 3300046674 Bacteria 1710
464 Ga0495657_0000815 3300046675 Bacteria 27667
465 Ga0495657_0008582 3300046675 Bacteria 7802
466 Ga0495599_0000008 3300046678 Bacteria 225534
467 Ga0495599_0126763 3300046678 Bacteria 1586
468 Ga0495623_0000002 3300046679 Bacteria 166669
469 Ga0495623_0026799 3300046679 Bacteria 3709
470 Ga0495623_0062267 3300046679 Bacteria 2339
471 Ga0495646_0000004 3300046680 Bacteria 268993
472 Ga0495646_0001238 3300046680 Bacteria 14975
473 Ga0495646_0007246 3300046680 Bacteria 7047
474 Ga0495647_0002749 3300046681 Bacteria 5580
475 Ga0495658_0009054 3300046683 Bacteria 4950
476 Ga0495658_0012691 3300046683 Bacteria 4274
477 Ga0495658_0043870 3300046683 Bacteria 2503
478 Ga0495669_0020421 3300046684 Bacteria 2867
479 Ga0495669_0045753 3300046684 Bacteria 1952
480 Ga0495613_0010776 3300046689 Bacteria 6783
481 Ga0495613_0014563 3300046689 Bacteria 5833
482 Ga0495613_0159436 3300046689 Bacteria 1606
483 Ga0495624_0003694 3300046690 Bacteria 11307
484 Ga0495624_0011365 3300046690 Bacteria 6119
485 Ga0495624_0039101 3300046690 Bacteria 3043
486 Ga0495624_0040600 3300046690 Bacteria 2979
487 Ga0495670_0034671 3300046691 Bacteria 2515
488 Ga0495670_0056462 3300046691 Bacteria 1970
489 Ga0495671_0030914 3300046692 Bacteria 2740
490 Ga0495649_0031537 3300046694 Bacteria 2922
491 Ga0495649_0060383 3300046694 Bacteria 2039
492 Ga0495589_0000876 3300046794 Bacteria 18703
493 Ga0495589_0002891 3300046794 Bacteria 9502
494 Ga0495600_0000024 3300046809 Bacteria 92414
495 Ga0495600_0016171 3300046809 Bacteria 4731
496 Ga0495581_0015723 3300047315 Bacteria 4393
497 Ga0495581_0036668 3300047315 Bacteria 2837
498 Ga0495581_0043406 3300047315 Bacteria 2601
499 Ga0495604_0000001 3300047317 Bacteria 708627
500 Ga0495604_0007948 3300047317 Bacteria 8403
501 Ga0495604_0015166 3300047317 Bacteria 6151
502 Ga0495674_0000023 3300047319 Bacteria 157443
503 Ga0495674_0001761 3300047319 Bacteria 21319
504 Ga0495674_0007612 3300047319 Bacteria 10349
505 Ga0495674_0026948 3300047319 Bacteria 5256
506 Ga0495674_0029316 3300047319 Bacteria 5013
507 Ga0495674_0219483 3300047319 Bacteria 1572
508 Ga0495676_0010728 3300047321 Bacteria 8293
509 Ga0495676_0127482 3300047321 Bacteria 1842
510 Ga0495680_0001451 3300047322 Bacteria 25557
511 Ga0495680_0003698 3300047322 Bacteria 14944
512 Ga0495680_0061555 3300047322 Bacteria 2887
513 Ga0495680_0102512 3300047322 Bacteria 2130
514 Ga0495683_0007144 3300047323 Bacteria 6058
515 Ga0495687_028804 3300047443 Bacteria 2578
516 Ga0495675_0000392 3300047444 Bacteria 30250
517 Ga0495675_0004093 3300047444 Bacteria 8835
518 Ga0495675_0042674 3300047444 Unclassified 2889
519 Ga0495679_000036 3300047446 Bacteria 161473
520 Ga0495679_001250 3300047446 Bacteria 15047
521 Ga0495673_0017287 3300047469 Bacteria 3668
522 Ga0495673_0024931 3300047469 Bacteria 2879
523 Ga0495684_0000007 3300047471 Bacteria 225614
524 Ga0495684_0006845 3300047471 Bacteria 8860
525 Ga0495684_0017916 3300047471 Bacteria 5456
526 Ga0495684_0062050 3300047471 Bacteria 2843
527 Ga0495686_0124273 3300047472 Bacteria 1535
528 Ga0495593_0000886 3300047673 Bacteria 17382
529 Ga0495593_0001189 3300047673 Bacteria 15218
530 Ga0495593_0028383 3300047673 Bacteria 3073
531 Ga0495602_0000045 3300048088 Bacteria 118132
532 Ga0495602_0021399 3300048088 Bacteria 6367
533 Ga0495602_0036711 3300048088 Bacteria 4556
534 Ga0495614_0003498 3300048089 Bacteria 7031
535 Ga0495626_0025537 3300048091 Bacteria 2888
536 Ga0496101_0023051 3300048904 Bacteria 4295
537 Ga0496101_0026610 3300048904 Bacteria 4022
538 Ga0496101_0040043 3300048904 Bacteria 3337
539 Ga0496101_0075791 3300048904 Bacteria 2476
540 Ga0496102_0012310 3300048905 Bacteria 7399
541 Ga0496102_0187647 3300048905 Bacteria 1948
542 Ga0496102_0238118 3300048905 Bacteria 1716
543 Ga0496104_0036562 3300048907 Bacteria 4591
544 Ga0496104_0074929 3300048907 Bacteria 3222
545 Ga0496104_0080014 3300048907 Bacteria 3115
546 Ga0496104_0085980 3300048907 Bacteria 3002
547 Ga0496104_0086681 3300048907 Bacteria 2989
548 Ga0496104_0309842 3300048907 Bacteria 1491
549 Ga0496105_0044324 3300048908 Bacteria 3668
550 Ga0496105_0094136 3300048908 Bacteria 2474
551 Ga0496105_0109115 3300048908 Bacteria 2285
552 Ga0496105_0186454 3300048908 Bacteria 1697
553 Ga0496106_0026019 3300048909 Bacteria 4354
554 Ga0496106_0117793 3300048909 Bacteria 2073
555 Ga0496106_0160363 3300048909 Bacteria 1778
556 Ga0496107_0020118 3300048910 Bacteria 4713
557 Ga0496107_0045573 3300048910 Bacteria 3155
558 Ga0496107_0058658 3300048910 Bacteria 2783
559 Ga0496108_0000249 3300048911 Bacteria 47869
560 Ga0496108_0002673 3300048911 Bacteria 14277
561 Ga0496108_0047436 3300048911 Bacteria 3590
562 Ga0496108_0073425 3300048911 Bacteria 2888
563 Ga0496109_0000754 3300048912 Bacteria 26955
564 Ga0496109_0001468 3300048912 Bacteria 19562
565 Ga0496110_0000037 3300048913 Bacteria 64495
566 Ga0496110_0003356 3300048913 Bacteria 12224
567 Ga0496110_0162983 3300048913 Bacteria 2021
568 Ga0496110_0178520 3300048913 Bacteria 1928
569 Ga0496111_0002935 3300048914 Bacteria 10427
570 Ga0496111_0151488 3300048914 Bacteria 1720
571 Ga0496112_0007789 3300048915 Bacteria 9535
572 Ga0496112_0015644 3300048915 Bacteria 7086
573 Ga0496113_0000455 3300048916 Bacteria 19907
574 Ga0496113_0000937 3300048916 Bacteria 15487
575 Ga0496113_0066187 3300048916 Bacteria 2736
576 Ga0496114_0013377 3300048917 Bacteria 6579
577 Ga0496114_0084644 3300048917 Bacteria 2685
578 Ga0496114_0300737 3300048917 Bacteria 1416
579 Ga0496115_0079809 3300048918 Bacteria 2663
580 Ga0496115_0163201 3300048918 Unclassified 1842
581 Ga0496116_0022456 3300048919 Bacteria 4728
582 Ga0496116_0094798 3300048919 Bacteria 1803
583 Ga0496117_0031450 3300048920 Bacteria 4050
584 Ga0496118_0021608 3300048921 Bacteria 5657
585 Ga0496118_0025416 3300048921 Bacteria 5079
586 Ga0496121_0000186 3300048924 Bacteria 138418
587 Ga0496121_0002020 3300048924 Bacteria 32184
588 Ga0496122_0003710 3300048925 Bacteria 19747
589 Ga0496123_0001431 3300048926 Bacteria 33345
590 Ga0496126_0001613 3300048929 Bacteria 34166
591 Ga0495678_032607 3300049459 Bacteria 2157
592 Ga0495682_0014033 3300049460 Bacteria 3041
593 Ga0501034_0118824 3300049571 Bacteria 2630
594 Ga0501043_0301095 3300049579 Bacteria 1225
595 Ga0501047_0034081 3300049581 Bacteria 4916
596 Ga0501070_0203032 3300049586 Bacteria 1627
597 Ga0501075_0199288 3300049591 Bacteria 1527
598 Ga0501080_0082130 3300049742 Bacteria 2994
599 Ga0501035_0004649 3300049822 Bacteria 13027
600 Ga0501044_0024057 3300049823 Bacteria 6471
601 Ga0501044_0029787 3300049823 Bacteria 5755
602 nmdc:mga03n38_22539_c1 3300050490 Bacteria 2551
603 nmdc:mga0yw44_96930_c1 3300050492 Bacteria 1873
604 nmdc:mga05p37_37242_c1 3300050507 Bacteria 5964
605 nmdc:mga05p37_97872_c1 3300050507 Bacteria 3614
606 nmdc:mga09592_37452_c1 3300050508 Bacteria 4069
607 nmdc:mga09592_43549_c1 3300050508 Bacteria 3777
608 nmdc:mga0qj67_21925_c1 3300050509 Bacteria 4902
609 nmdc:mga06r32_140023_c1 3300050510 Bacteria 2395
610 nmdc:mga06r32_151626_c1 3300050510 Bacteria 2297
611 nmdc:mga08y16_128345_c1 3300050511 Bacteria 2637
612 nmdc:mga08y16_136408_c1 3300050511 Bacteria 2550
613 nmdc:mga0n895_112995_c1 3300050512 Unclassified 2733
614 nmdc:mga0n895_113742_c1 3300050512 Bacteria 2724
615 nmdc:mga0n895_14307_c1 3300050512 Bacteria 7201
616 nmdc:mga0n895_42361_c1 3300050512 Bacteria 4429
617 nmdc:mga08x19_16913_c1 3300050514 Bacteria 4456
618 nmdc:mga08x19_7348_c1 3300050514 Bacteria 6546
619 Ga0495601_0000014 3300053077 Bacteria 220318
620 Ga0495601_0000579 3300053077 Bacteria 19447
621 Ga0495601_0000751 3300053077 Bacteria 17458
622 Ga0495601_0007390 3300053077 Bacteria 6439
623 Ga0495601_0009463 3300053077 Bacteria 5765
624 Ga0495601_0074811 3300053077 Bacteria 2167
625 Ga0495612_0000014 3300053078 Bacteria 187444
626 Ga0495612_0000428 3300053078 Bacteria 16790
627 Ga0495612_0000961 3300053078 Bacteria 11838
628 Ga0495595_0000038 3300053084 Bacteria 70955
629 Ga0495595_0000614 3300053084 Bacteria 13575
630 Ga0495595_0001366 3300053084 Bacteria 9465
631 Ga0495619_0000006 3300053085 Bacteria 384835
632 Ga0495619_0000706 3300053085 Bacteria 21775
633 Ga0495619_0007500 3300053085 Bacteria 6908
634 Ga0495619_0015998 3300053085 Bacteria 4747
635 Ga0495619_0032522 3300053085 Bacteria 3385
636 Ga0495619_0033808 3300053085 Bacteria 3321
637 Ga0495619_0036007 3300053085 Bacteria 3221
638 Ga0495619_0045438 3300053085 Bacteria 2886
639 Ga0495619_0064626 3300053085 Bacteria 2440
640 Ga0495619_0116689 3300053085 Bacteria 1827
641 Ga0500593_000017 3300053117 Bacteria 56465
642 Ga0500568_0000002 3300053139 Bacteria 880601
643 Ga0500568_0045391 3300053139 Bacteria 1749
644 2511247512 2511231003 Bacteria 5606035
645 2563063718 2562617112 Bacteria 10918404
646 2713474604 2711768613 Bacteria 11048459
647 2792833410 2791355137 Bacteria 9654227
648 2842333171 2842324504 Bacteria 9364110
649 2855731098 2855730933 Bacteria 7047938
650 2855770301 2855767633 Bacteria 7049357
651 2881414522 2881412998 Bacteria 6492157
652 2884816980 2884811622 Bacteria 5552861
653 2884840915 2884836552 Bacteria 5219991
654 2884857489 2884852848 Bacteria 5221161
655 2885277139 2885270888 Bacteria 9831543
656 2896158429 2896154374 Bacteria 5221518
657 2904623224 2904615490 Bacteria 10047340
658 2921643541 2921643360 Bacteria 11448031
659 Ga0495634_0007216
660 JGI24750J21931_1001266
661 JGI24742J22300_10000928
662 JGI25151J46595_10003207
663 rootH1_10097723
664 Ga0065712_10010748
665 Ga0065712_10105777
666 Ga0070658_10014828
667 Ga0070658_10032865
668 Ga0070658_10063027
669 Ga0070676_10027837
670 Ga0070683_100001114
671 Ga0070683_100001248
672 Ga0070690_100024232
673 Ga0070670_100001277
674 Ga0070670_100002839
675 Ga0070670_100003204
676 Ga0070670_100061716
677 Ga0070670_100077089
678 Ga0070670_100095271
679 Ga0070677_10003682
680 Ga0070677_10023089
681 Ga0070677_10056765
682 Ga0070666_10057991
683 Ga0070680_100017231
684 Ga0068868_100000410
685 Ga0068868_100001321
686 Ga0068868_100063223
687 Ga0070689_100055569
688 Ga0070687_100005754
689 Ga0070661_100000923
690 Ga0070661_100003988
691 Ga0070661_100061340
692 Ga0070669_100171565
693 Ga0070675_100000071
694 Ga0070675_100000793
695 Ga0070671_100001499
696 Ga0070674_100063360
697 Ga0070674_100103655
698 Ga0070673_100000149
699 Ga0070673_100065651
700 Ga0070673_100149443
701 Ga0070673_100179422
702 Ga0070659_100016067
703 Ga0070667_100051010
704 Ga0070667_100075575
705 Ga0070713_100000870
706 Ga0070713_100006605
707 Ga0070713_100136935
708 Ga0070710_10016803
709 Ga0070711_100015513
710 Ga0070700_100010063
711 Ga0070694_100073118
712 Ga0070708_100242222
713 Ga0070663_100014372
714 Ga0070678_100000010
715 Ga0070678_100000373
716 Ga0070678_100052822
717 Ga0070681_10009601
718 Ga0070681_10054888
719 Ga0068867_100018813
720 Ga0068867_100037683
721 Ga0070685_10009635
722 Ga0070707_100040082
723 Ga0070699_100038745
724 Ga0070697_100042401
725 Ga0070672_100000312
726 Ga0070672_100000909
727 Ga0070672_100106850
728 Ga0070695_100019408
729 Ga0070695_100066573
730 Ga0070704_100190634
731 Ga0068855_100029244
732 Ga0068855_100029314
733 Ga0068855_100199259
734 Ga0068855_100216522
735 Ga0070664_100000179
736 Ga0070664_100002026
737 Ga0068854_100040322
738 Ga0068852_100000828
739 Ga0068852_100002798
740 Ga0068852_100014313
741 Ga0068852_100036862
742 Ga0068859_100177933
743 Ga0068864_100001555
744 Ga0068864_100026648
745 Ga0068864_100105263
746 Ga0068864_100123609
747 Ga0068851_10000460
748 Ga0068870_10003702
749 Ga0068863_100008612
750 Ga0068863_100028706
751 Ga0068863_100113454
752 Ga0068858_100076882
753 Ga0068858_100109782
754 Ga0068860_100195206
755 Ga0068860_100209543
756 Ga0081455_10006987
757 Ga0081540_1000015
758 Ga0070717_10025797
759 Ga0075365_10000662
760 Ga0075363_100004310
761 Ga0097621_100000056
762 Ga0097621_100000761
763 Ga0097621_100059374
764 Ga0075370_10026536
765 Ga0075370_10041441
766 Ga0068871_100000774
767 Ga0068871_100030458
768 Ga0068871_100140432
769 Ga0075428_100002507
770 Ga0075428_100148536
771 Ga0075428_100152086
772 Ga0075430_100000747
773 Ga0075431_100037913
774 Ga0075431_100093494
775 Ga0075434_100076792
776 Ga0075434_100201361
777 Ga0075429_100044461
778 Ga0075429_100046477
779 Ga0075436_100004335
780 Ga0075436_100011918
781 Ga0097620_100177927
782 Ga0075435_100078885
783 Ga0075435_100145458
784 Ga0099795_10000578
785 Ga0105240_10024423
786 Ga0111539_10068503
787 Ga0111539_10112275
788 Ga0111539_10171590
789 Ga0114129_10029908
790 Ga0114129_10073179
791 Ga0114129_10088023
792 Ga0114129_10293365
793 Ga0105248_10023630
794 Ga0105248_10030350
795 Ga0105248_10181994
796 Ga0105248_10325795
797 Ga0099796_10020942
798 Ga0157374_10000729
799 Ga0157374_10001930
800 Ga0157374_10070369
801 Ga0157378_10003430
802 Ga0157378_10007916
803 Ga0157378_10164516
804 Ga0163162_10001281
805 Ga0163162_10007039
806 Ga0163162_10026510
807 Ga0157372_10175542
808 Ga0157372_10194490
809 Ga0157375_10002204
810 Ga0157375_10003743
811 Ga0157375_10030147
812 Ga0157375_10110257
813 Ga0163163_10014783
814 Ga0163163_10150452
815 Ga0157379_10026622
816 Ga0157376_10010135
817 Ga0157376_10019293
818 Ga0157376_10050250
819 Ga0157376_10069317
820 Ga0213875_10004743
821 Ga0209025_1000003
822 Ga0207697_10005175
823 Ga0207656_10000449
824 Ga0207682_10004778
825 Ga0207682_10005745
826 Ga0207682_10006398
827 Ga0207692_10032563
828 Ga0207688_10005568
829 Ga0207688_10031318
830 Ga0207680_10031812
831 Ga0207645_10026467
832 Ga0207645_10027285
833 Ga0207645_10040519
834 Ga0207643_10002035
835 Ga0207705_10011650
836 Ga0207684_10087908
837 Ga0207707_10097415
838 Ga0207707_10103866
839 Ga0207663_10129564
840 Ga0207660_10035713
841 Ga0207660_10180079
842 Ga0207662_10005039
843 Ga0207662_10014029
844 Ga0207662_10055906
845 Ga0207662_10057093
846 Ga0207657_10049054
847 Ga0207657_10059744
848 Ga0207657_10113392
849 Ga0207649_10004827
850 Ga0207649_10071121
851 Ga0207649_10144829
852 Ga0207646_10054665
853 Ga0207681_10073295
854 Ga0207650_10001859
855 Ga0207650_10002001
856 Ga0207650_10003953
857 Ga0207650_10004434
858 Ga0207650_10115869
859 Ga0207659_10000756
860 Ga0207659_10047343
861 Ga0207659_10064728
862 Ga0207700_10107367
863 Ga0207644_10000182
864 Ga0207644_10001114
865 Ga0207644_10064408
866 Ga0207706_10012119
867 Ga0207706_10061191
868 Ga0207670_10064533
869 Ga0207669_10077955
870 Ga0207669_10097614
871 Ga0207704_10076465
872 Ga0207704_10087305
873 Ga0207691_10000678
874 Ga0207691_10001156
875 Ga0207691_10064030
876 Ga0207711_10012082
877 Ga0207711_10025993
878 Ga0207711_10051184
879 Ga0207711_10098834
880 Ga0207689_10038282
881 Ga0207661_10001359
882 Ga0207661_10094719
883 Ga0207679_10023955
884 Ga0207679_10134818
885 Ga0207667_10071075
886 Ga0207667_10167063
887 Ga0207651_10021614
888 Ga0207651_10069604
889 Ga0207668_10162177
890 Ga0207640_10039827
891 Ga0207658_10017093
892 Ga0207677_10002173
893 Ga0207677_10150407
894 Ga0207703_10031279
895 Ga0207703_10087115
896 Ga0207703_10140468
897 Ga0207678_10009696
898 Ga0207708_10001367
899 Ga0207708_10006646
900 Ga0207708_10015205
901 Ga0207702_10114055
902 Ga0207641_10030033
903 Ga0207641_10034677
904 Ga0207648_10013037
905 Ga0207648_10019977
906 Ga0207648_10028751
907 Ga0207648_10034648
908 Ga0207648_10053083
909 Ga0207676_10003358
910 Ga0207676_10008867
911 Ga0207676_10009977
912 Ga0207676_10017400
913 Ga0207676_10070764
914 Ga0207676_10073864
915 Ga0207674_10161610
916 Ga0207675_100011762
917 Ga0207675_100012361
918 Ga0207675_100016943
919 Ga0207683_10000381
920 Ga0207683_10000429
921 Ga0207683_10131784
922 Ga0207683_10245887
923 Ga0207698_10000528
924 Ga0207698_10008747
925 Ga0207698_10023268
926 Ga0209969_1000749
927 Ga0210000_1000409
928 Ga0209995_1002001
929 Ga0209970_1004110
930 Ga0209588_1014496
931 Ga0209974_10001292
932 Ga0268265_10061143
933 Ga0268264_10048040
934 Ga0265337_1005978
935 Ga0265318_10000775
936 Ga0265318_10012647
937 Ga0265318_10038829
938 Ga0265338_10000644
939 Ga0265338_10006542
940 Ga0265338_10089938
941 Ga0265330_10016917
942 Ga0265330_10034699
943 Ga0265332_10002343
944 Ga0265332_10002820
945 Ga0265328_10007093
946 Ga0265328_10017265
947 Ga0265320_10016073
948 Ga0265320_10020231
949 Ga0265325_10008895
950 Ga0265325_10010857
951 Ga0265329_10003801
952 Ga0265339_10000133
953 Ga0265339_10041324
954 Ga0265331_10005523
955 Ga0265331_10006226
956 Ga0265331_10048336
957 Ga0265316_10003811
958 Ga0265313_10000491
959 Ga0265313_10017071
960 Ga0265313_10023906
961 Ga0265314_10001327
962 Ga0265314_10004625
963 Ga0265314_10009507
964 Ga0265314_10021442
965 Ga0265342_10003079
966 Ga0265342_10009617
967 Ga0307507_10041293
968 Ga0373944_0014757
969 Ga0373936_0000414
970 Ga0373936_0037673
971 Ga0373945_0025942
972 Ga0373954_0003714
973 Ga0373957_0028120
974 Ga0373943_0000765
975 Ga0373943_0002746
976 Ga0373943_0003109
977 Ga0373943_0015662
978 Ga0373943_0051268
979 Ga0373946_0003963
980 Ga0373955_0000940
981 Ga0373955_0015680
982 Ga0373924_0039618
983 Ga0373935_0000227
984 Ga0373935_0007148
985 Ga0373927_0003928
986 Ga0373927_0010806
987 Ga0373927_0029729
988 Ga0373933_0008736
989 Ga0373947_0000216
990 Ga0373947_0006128
991 Ga0373947_0006147
992 Ga0373947_0013899
993 Ga0373937_0000003
994 Ga0373937_0018622
995 Ga0373937_0045582
996 Ga0373937_0189744
997 Ga0373925_0000118
998 Ga0373925_0003524
999 Ga0373925_0011384
1000 Ga0373925_0045742
1001 Ga0373925_0082956
1002 Ga0395898_0135325
1003 Ga0395905_0000020
1004 Ga0436364_0200832
1005 Ga0436364_0935980
1006 Ga0395901_0049764
1007 Ga0395901_0107332
1008 Ga0436361_0592523
1009 Ga0436363_0974176
1010 Ga0466963_0068868
1011 Ga0466957_0050844
1012 Ga0466957_0080168
1013 Ga0466959_0122512
1014 Ga0466967_0154899
1015 Ga0495592_0000051
1016 Ga0495592_0000925
1017 Ga0495592_0002280
1018 Ga0495592_0031734
1019 Ga0495603_0002378
1020 Ga0495603_0003805
1021 Ga0495603_0024737
1022 Ga0495590_0036028
1023 Ga0495591_002794
1024 Ga0495629_0000195
1025 Ga0495629_0003133
1026 Ga0495629_0004794
1027 Ga0495629_0044241
1028 Ga0495629_0066814
1029 Ga0495638_0013805
1030 Ga0495638_0071365
1031 Ga0495641_0018341
1032 Ga0495651_0000263
1033 Ga0495651_0000583
1034 Ga0495651_0006074
1035 Ga0495651_0034505
1036 Ga0495651_0107335
1037 Ga0495653_0000039
1038 Ga0495653_0001192
1039 Ga0495653_0045250
1040 Ga0495650_0001346
1041 Ga0495650_0012070
1042 Ga0495580_0002294
1043 Ga0495580_0026059
1044 Ga0495580_0027503
1045 Ga0495580_0028422
1046 Ga0495582_0023348
1047 Ga0495605_0003236
1048 Ga0495605_0023395
1049 Ga0495605_0030980
1050 Ga0495605_0053296
1051 Ga0495639_0003849
1052 Ga0495662_0013418
1053 Ga0495662_0013611
1054 Ga0495664_0000015
1055 Ga0495664_0000375
1056 Ga0495584_0084441
1057 Ga0495585_0044477
1058 Ga0495594_0005399
1059 Ga0495594_0044952
1060 Ga0495596_0005855
1061 Ga0495596_0013347
1062 Ga0495607_0086954
1063 Ga0495583_0004968
1064 Ga0495608_0000025
1065 Ga0495608_0017317
1066 Ga0495608_0144348
1067 Ga0495616_0010848
1068 Ga0495618_0000040
1069 Ga0495618_0043585
1070 Ga0495628_0000011
1071 Ga0495630_0004426
1072 Ga0495630_0012700
1073 Ga0495630_0037737
1074 Ga0495630_0072188
1075 Ga0495648_0001911
1076 Ga0495666_0012877
1077 Ga0495666_0023499
1078 Ga0495666_0042284
1079 Ga0495642_0014346
1080 Ga0495652_0000014
1081 Ga0495652_0027911
1082 Ga0495652_0040159
1083 Ga0495652_0089875
1084 Ga0495652_0111629
1085 Ga0495665_0004423
1086 Ga0495665_0010279
1087 Ga0495665_0016341
1088 Ga0495665_0032509
1089 Ga0495640_0000008
1090 Ga0495640_0002950
1091 Ga0495640_0009570
1092 Ga0495640_0010709
1093 Ga0495640_0057608
1094 Ga0495640_0068791
1095 Ga0495586_0069190
1096 Ga0495586_0070611
1097 Ga0495587_0000015
1098 Ga0495587_0011567
1099 Ga0495621_0015396
1100 Ga0495645_0000020
1101 Ga0495645_0005566
1102 Ga0495645_0030525
1103 Ga0495645_0037034
1104 Ga0495622_0000020
1105 Ga0495622_0000147
1106 Ga0495667_0000013
1107 Ga0495667_0006693
1108 Ga0495667_0095585
1109 Ga0495634_0000415
1110 Ga0495634_0001639
1111 Ga0495634_0009154
1112 Ga0495634_0047841
1113 Ga0495634_0048393
1114 Ga0495611_0008932
1115 Ga0495635_0000012
1116 Ga0495635_0001827
1117 Ga0495635_0021654
1118 Ga0495635_0107091
1119 Ga0495661_0005088
1120 Ga0495661_0030740
1121 Ga0495588_0079603
1122 Ga0495657_0000815
1123 Ga0495657_0008582
1124 Ga0495599_0000008
1125 Ga0495599_0126763
1126 Ga0495623_0000002
1127 Ga0495623_0026799
1128 Ga0495623_0062267
1129 Ga0495646_0000004
1130 Ga0495646_0001238
1131 Ga0495646_0007246
1132 Ga0495647_0002749
1133 Ga0495658_0009054
1134 Ga0495658_0012691
1135 Ga0495658_0043870
1136 Ga0495669_0020421
1137 Ga0495669_0045753
1138 Ga0495613_0010776
1139 Ga0495613_0014563
1140 Ga0495613_0159436
1141 Ga0495624_0003694
1142 Ga0495624_0011365
1143 Ga0495624_0039101
1144 Ga0495624_0040600
1145 Ga0495670_0034671
1146 Ga0495670_0056462
1147 Ga0495671_0030914
1148 Ga0495649_0031537
1149 Ga0495649_0060383
1150 Ga0495589_0000876
1151 Ga0495589_0002891
1152 Ga0495600_0000024
1153 Ga0495600_0016171
1154 Ga0495581_0015723
1155 Ga0495581_0036668
1156 Ga0495581_0043406
1157 Ga0495604_0000001
1158 Ga0495604_0007948
1159 Ga0495604_0015166
1160 Ga0495674_0000023
1161 Ga0495674_0001761
1162 Ga0495674_0007612
1163 Ga0495674_0026948
1164 Ga0495674_0029316
1165 Ga0495674_0219483
1166 Ga0495676_0010728
1167 Ga0495676_0127482
1168 Ga0495680_0001451
1169 Ga0495680_0003698
1170 Ga0495680_0061555
1171 Ga0495680_0102512
1172 Ga0495683_0007144
1173 Ga0495687_028804
1174 Ga0495675_0000392
1175 Ga0495675_0004093
1176 Ga0495675_0042674
1177 Ga0495679_000036
1178 Ga0495679_001250
1179 Ga0495673_0017287
1180 Ga0495673_0024931
1181 Ga0495684_0000007
1182 Ga0495684_0006845
1183 Ga0495684_0017916
1184 Ga0495684_0062050
1185 Ga0495686_0124273
1186 Ga0495593_0000886
1187 Ga0495593_0001189
1188 Ga0495593_0028383
1189 Ga0495602_0000045
1190 Ga0495602_0021399
1191 Ga0495602_0036711
1192 Ga0495614_0003498
1193 Ga0495626_0025537
1194 Ga0496101_0023051
1195 Ga0496101_0026610
1196 Ga0496101_0040043
1197 Ga0496101_0075791
1198 Ga0496102_0012310
1199 Ga0496102_0187647
1200 Ga0496102_0238118
1201 Ga0496104_0036562
1202 Ga0496104_0074929
1203 Ga0496104_0080014
1204 Ga0496104_0085980
1205 Ga0496104_0086681
1206 Ga0496104_0309842
1207 Ga0496105_0044324
1208 Ga0496105_0094136
1209 Ga0496105_0109115
1210 Ga0496105_0186454
1211 Ga0496106_0026019
1212 Ga0496106_0117793
1213 Ga0496106_0160363
1214 Ga0496107_0020118
1215 Ga0496107_0045573
1216 Ga0496107_0058658
1217 Ga0496108_0000249
1218 Ga0496108_0002673
1219 Ga0496108_0047436
1220 Ga0496108_0073425
1221 Ga0496109_0000754
1222 Ga0496109_0001468
1223 Ga0496110_0000037
1224 Ga0496110_0003356
1225 Ga0496110_0162983
1226 Ga0496110_0178520
1227 Ga0496111_0002935
1228 Ga0496111_0151488
1229 Ga0496112_0007789
1230 Ga0496112_0015644
1231 Ga0496113_0000455
1232 Ga0496113_0000937
1233 Ga0496113_0066187
1234 Ga0496114_0013377
1235 Ga0496114_0084644
1236 Ga0496114_0300737
1237 Ga0496115_0079809
1238 Ga0496115_0163201
1239 Ga0496116_0022456
1240 Ga0496116_0094798
1241 Ga0496117_0031450
1242 Ga0496118_0021608
1243 Ga0496118_0025416
1244 Ga0496121_0000186
1245 Ga0496121_0002020
1246 Ga0496122_0003710
1247 Ga0496123_0001431
1248 Ga0496126_0001613
1249 Ga0495678_032607
1250 Ga0495682_0014033
1251 Ga0501034_0118824
1252 Ga0501043_0301095
1253 Ga0501047_0034081
1254 Ga0501070_0203032
1255 Ga0501075_0199288
1256 Ga0501080_0082130
1257 Ga0501035_0004649
1258 Ga0501044_0024057
1259 Ga0501044_0029787
1260 nmdc:mga03n38_22539_c1
1261 nmdc:mga0yw44_96930_c1
1262 nmdc:mga05p37_37242_c1
1263 nmdc:mga05p37_97872_c1
1264 nmdc:mga09592_37452_c1
1265 nmdc:mga09592_43549_c1
1266 nmdc:mga0qj67_21925_c1
1267 nmdc:mga06r32_140023_c1
1268 nmdc:mga06r32_151626_c1
1269 nmdc:mga08y16_128345_c1
1270 nmdc:mga08y16_136408_c1
1271 nmdc:mga0n895_112995_c1
1272 nmdc:mga0n895_113742_c1
1273 nmdc:mga0n895_14307_c1
1274 nmdc:mga0n895_42361_c1
1275 nmdc:mga08x19_16913_c1
1276 nmdc:mga08x19_7348_c1
1277 Ga0495601_0000014
1278 Ga0495601_0000579
1279 Ga0495601_0000751
1280 Ga0495601_0007390
1281 Ga0495601_0009463
1282 Ga0495601_0074811
1283 Ga0495612_0000014
1284 Ga0495612_0000428
1285 Ga0495612_0000961
1286 Ga0495595_0000038
1287 Ga0495595_0000614
1288 Ga0495595_0001366
1289 Ga0495619_0000006
1290 Ga0495619_0000706
1291 Ga0495619_0007500
1292 Ga0495619_0015998
1293 Ga0495619_0032522
1294 Ga0495619_0033808
1295 Ga0495619_0036007
1296 Ga0495619_0045438
1297 Ga0495619_0064626
1298 Ga0495619_0116689
1299 Ga0500593_000017
1300 Ga0500568_0000002
1301 Ga0500568_0045391
1302 2511247512
1303 2563063718
1304 2713474604
1305 2792833410
1306 2842333171
1307 2855731098
1308 2855770301
1309 2881414522
1310 2884816980
1311 2884840915
1312 2884857489
1313 2885277139
1314 2896158429
1315 2904623224
1316 2921643541

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19305

MmgE_PrpD_C

MmgE/PrpD C-terminal domain

330

503

0.96

PF03972

MmgE_PrpD_N

MmgE/PrpD N-terminal domain

73

308

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e9d-assembly1.cif.gz_B h102a mutant of irg1 from bacillus 0.8715 12 463
7e9d-assembly1.cif.gz_B h102a mutant of irg1 from bacillus 0.8605 12 463
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8548 12 460
7bra-assembly1.cif.gz_B bacillus subtilis irg1 0.8545 12 463
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8459 12 460
ID Description Score Start End Superfamily
2hp3B01 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.8488 12 277 1.10.4100.10
1szqB02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8427 276 410 3.30.1330.120
3w5mA02 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.8314 390 406 2.60.120.260
2chsI00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8269 284 315 3.30.1330.40
1szqB02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8153 276 410 3.30.1330.120
ID Description Score Start End GO Terms
AF-A0A537B7X7-F1-model_v4 MmgE/PrpD family protein 0.978 268 463 GO:0016829
AF-A0A536WTG6-F1-model_v4 MmgE/PrpD family protein 0.9688 11 466 GO:0016829
AF-A0A2N1QLR3-F1-model_v4 MmgE/PrpD family protein 0.9661 12 196 GO:0016829
AF-A0A537FLW6-F1-model_v4 MmgE/PrpD family protein 0.956 11 466 GO:0016829
AF-A0A1V5E911-F1-model_v4 2-methylcitrate dehydratase 0.955 256 463 GO:0016829

Map