F473205
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 281 | 657 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300048915|Ga0496112_0169415|Ga0496112_0169415_1609_2103 |
| Length | 164 |
| Sequence | VSSTCVEIEAVMAADASPILAPLVKMLKIVAGPFTFRAQLEEERAPKTVAAIRSMLPFKSKLVHCKWSGESTWVPMGDTKIGDAGGLAFENHTSHPAPGQVLIYPGGISETEILFPYGSTLFSSKVGQLAGNHFATVIEGNDKLAEIGRLALWEGAQDFTIELA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 183 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 184 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 185 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 206 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 207 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 208 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 209 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 210 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 261 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 262 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 264 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.09 |
| Metatranscriptomes | 0.76 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.15 |
| Rhizoplane | 3.5 |
| Rhizosphere | 96.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10046681 | 3300003322 | Bacteria | 3337 |
| 2 | Ga0065712_10160555 | 3300005290 | Unclassified | 1305 |
| 3 | Ga0065707_10574066 | 3300005295 | Bacteria | 706 |
| 4 | Ga0070658_10154964 | 3300005327 | Bacteria | 1920 |
| 5 | Ga0070658_11998788 | 3300005327 | Bacteria | 500 |
| 6 | Ga0070676_10000556 | 3300005328 | Bacteria | 18022 |
| 7 | Ga0070683_100002327 | 3300005329 | Bacteria | 15074 |
| 8 | Ga0070690_100115282 | 3300005330 | Bacteria | 1797 |
| 9 | Ga0070690_100123765 | 3300005330 | Bacteria | 1739 |
| 10 | Ga0070670_100000596 | 3300005331 | Bacteria | 28525 |
| 11 | Ga0070677_10455320 | 3300005333 | Bacteria | 685 |
| 12 | Ga0068869_100000184 | 3300005334 | Bacteria | 32054 |
| 13 | Ga0070680_100001624 | 3300005336 | Bacteria | 16434 |
| 14 | Ga0070680_100801680 | 3300005336 | Bacteria | 811 |
| 15 | Ga0070682_100000464 | 3300005337 | Bacteria | 25534 |
| 16 | Ga0070660_100001374 | 3300005339 | Bacteria | 16522 |
| 17 | Ga0070689_100034790 | 3300005340 | Bacteria | 3845 |
| 18 | Ga0070689_100922031 | 3300005340 | Bacteria | 774 |
| 19 | Ga0070691_10002084 | 3300005341 | Bacteria | 8841 |
| 20 | Ga0070691_10004600 | 3300005341 | Bacteria | 6268 |
| 21 | Ga0070687_100018422 | 3300005343 | Bacteria | 3230 |
| 22 | Ga0070661_100001302 | 3300005344 | Bacteria | 17520 |
| 23 | Ga0070692_10000199 | 3300005345 | Bacteria | 16153 |
| 24 | Ga0070692_10904004 | 3300005345 | Bacteria | 611 |
| 25 | Ga0070669_100039045 | 3300005353 | Bacteria | 3448 |
| 26 | Ga0070669_100436615 | 3300005353 | Bacteria | 1077 |
| 27 | Ga0070671_100060257 | 3300005355 | Bacteria | 3160 |
| 28 | Ga0070674_101872252 | 3300005356 | Bacteria | 545 |
| 29 | Ga0070673_100027314 | 3300005364 | Bacteria | 4229 |
| 30 | Ga0070673_100631331 | 3300005364 | Bacteria | 979 |
| 31 | Ga0070659_100001042 | 3300005366 | Bacteria | 20273 |
| 32 | Ga0070659_100592164 | 3300005366 | Bacteria | 952 |
| 33 | Ga0070667_100030788 | 3300005367 | Bacteria | 4475 |
| 34 | Ga0070703_10000802 | 3300005406 | Bacteria | 10283 |
| 35 | Ga0070703_10001944 | 3300005406 | Bacteria | 6060 |
| 36 | Ga0070714_100003311 | 3300005435 | Bacteria | 12016 |
| 37 | Ga0070714_100016484 | 3300005435 | Bacteria | 5969 |
| 38 | Ga0070714_100286028 | 3300005435 | Bacteria | 1533 |
| 39 | Ga0070713_100004314 | 3300005436 | Bacteria | 9531 |
| 40 | Ga0070710_10006186 | 3300005437 | Bacteria | 5730 |
| 41 | Ga0070711_100042880 | 3300005439 | Bacteria | 3061 |
| 42 | Ga0070705_100000716 | 3300005440 | Bacteria | 18891 |
| 43 | Ga0070705_100010996 | 3300005440 | Bacteria | 4550 |
| 44 | Ga0070705_100120293 | 3300005440 | Bacteria | 1694 |
| 45 | Ga0070705_100620152 | 3300005440 | Bacteria | 839 |
| 46 | Ga0070700_100027826 | 3300005441 | Bacteria | 3357 |
| 47 | Ga0070694_100001937 | 3300005444 | Bacteria | 12265 |
| 48 | Ga0070694_100024552 | 3300005444 | Bacteria | 3891 |
| 49 | Ga0070694_100120095 | 3300005444 | Bacteria | 1885 |
| 50 | Ga0070694_100281082 | 3300005444 | Bacteria | 1269 |
| 51 | Ga0070694_100980321 | 3300005444 | Unclassified | 701 |
| 52 | Ga0070708_100000368 | 3300005445 | Bacteria | 34096 |
| 53 | Ga0070708_100002804 | 3300005445 | Bacteria | 13531 |
| 54 | Ga0070708_100013053 | 3300005445 | Bacteria | 6790 |
| 55 | Ga0070708_100042533 | 3300005445 | Bacteria | 3988 |
| 56 | Ga0070708_100043963 | 3300005445 | Unclassified | 3926 |
| 57 | Ga0070708_100051653 | 3300005445 | Bacteria | 3642 |
| 58 | Ga0070708_100097046 | 3300005445 | Unclassified | 2693 |
| 59 | Ga0070708_100221248 | 3300005445 | Bacteria | 1775 |
| 60 | Ga0070708_100340495 | 3300005445 | Bacteria | 1413 |
| 61 | Ga0070708_100667674 | 3300005445 | Bacteria | 979 |
| 62 | Ga0070708_100710370 | 3300005445 | Bacteria | 946 |
| 63 | Ga0070708_100733277 | 3300005445 | Bacteria | 929 |
| 64 | Ga0070708_101282398 | 3300005445 | Bacteria | 684 |
| 65 | Ga0070663_100010115 | 3300005455 | Bacteria | 5869 |
| 66 | Ga0070663_100475233 | 3300005455 | Unclassified | 1034 |
| 67 | Ga0070663_101056515 | 3300005455 | Bacteria | 708 |
| 68 | Ga0070662_100002733 | 3300005457 | Bacteria | 10899 |
| 69 | Ga0070662_101722853 | 3300005457 | Bacteria | 541 |
| 70 | Ga0070681_10047084 | 3300005458 | Bacteria | 4310 |
| 71 | Ga0070681_10060061 | 3300005458 | Bacteria | 3781 |
| 72 | Ga0070681_10077633 | 3300005458 | Bacteria | 3278 |
| 73 | Ga0070681_10166333 | 3300005458 | Bacteria | 2128 |
| 74 | Ga0070681_10627132 | 3300005458 | Bacteria | 990 |
| 75 | Ga0068867_100002240 | 3300005459 | Bacteria | 13591 |
| 76 | Ga0068867_100862199 | 3300005459 | Bacteria | 812 |
| 77 | Ga0070706_100003203 | 3300005467 | Bacteria | 16151 |
| 78 | Ga0070706_100005074 | 3300005467 | Bacteria | 12579 |
| 79 | Ga0070706_100005221 | 3300005467 | Bacteria | 12391 |
| 80 | Ga0070706_100016058 | 3300005467 | Bacteria | 6915 |
| 81 | Ga0070706_100055418 | 3300005467 | Bacteria | 3660 |
| 82 | Ga0070706_100089033 | 3300005467 | Bacteria | 2862 |
| 83 | Ga0070706_100143831 | 3300005467 | Bacteria | 2226 |
| 84 | Ga0070706_100216767 | 3300005467 | Bacteria | 1787 |
| 85 | Ga0070706_100364658 | 3300005467 | Bacteria | 1346 |
| 86 | Ga0070706_101099382 | 3300005467 | Bacteria | 732 |
| 87 | Ga0070706_101633440 | 3300005467 | Bacteria | 588 |
| 88 | Ga0070707_100000912 | 3300005468 | Bacteria | 29321 |
| 89 | Ga0070707_100015809 | 3300005468 | Bacteria | 7085 |
| 90 | Ga0070707_100040704 | 3300005468 | Bacteria | 4446 |
| 91 | Ga0070707_100052845 | 3300005468 | Unclassified | 3895 |
| 92 | Ga0070707_100078161 | 3300005468 | Bacteria | 3192 |
| 93 | Ga0070707_100156572 | 3300005468 | Bacteria | 2219 |
| 94 | Ga0070707_100193001 | 3300005468 | Bacteria | 1986 |
| 95 | Ga0070707_100219835 | 3300005468 | Unclassified | 1850 |
| 96 | Ga0070707_100404957 | 3300005468 | Bacteria | 1324 |
| 97 | Ga0070707_100430473 | 3300005468 | Bacteria | 1280 |
| 98 | Ga0070707_100518972 | 3300005468 | Bacteria | 1153 |
| 99 | Ga0070707_100696153 | 3300005468 | Bacteria | 979 |
| 100 | Ga0070707_100843340 | 3300005468 | Bacteria | 880 |
| 101 | Ga0070707_101672486 | 3300005468 | Bacteria | 604 |
| 102 | Ga0070698_100000003 | 3300005471 | Bacteria | 137957 |
| 103 | Ga0070698_100001505 | 3300005471 | Bacteria | 25863 |
| 104 | Ga0070698_100001689 | 3300005471 | Bacteria | 24629 |
| 105 | Ga0070698_100033653 | 3300005471 | Bacteria | 5309 |
| 106 | Ga0070698_100047579 | 3300005471 | Bacteria | 4384 |
| 107 | Ga0070698_100066915 | 3300005471 | Bacteria | 3614 |
| 108 | Ga0070698_100081139 | 3300005471 | Bacteria | 3238 |
| 109 | Ga0070698_100099359 | 3300005471 | Bacteria | 2883 |
| 110 | Ga0070698_100156766 | 3300005471 | Bacteria | 2222 |
| 111 | Ga0070698_100217984 | 3300005471 | Bacteria | 1842 |
| 112 | Ga0070698_100428821 | 3300005471 | Bacteria | 1257 |
| 113 | Ga0070698_100743938 | 3300005471 | Unclassified | 923 |
| 114 | Ga0070698_100744529 | 3300005471 | Bacteria | 923 |
| 115 | Ga0070698_100934312 | 3300005471 | Bacteria | 813 |
| 116 | Ga0070698_101629343 | 3300005471 | Bacteria | 597 |
| 117 | Ga0070699_100001430 | 3300005518 | Bacteria | 21926 |
| 118 | Ga0070699_100003711 | 3300005518 | Bacteria | 13498 |
| 119 | Ga0070699_100009254 | 3300005518 | Bacteria | 8534 |
| 120 | Ga0070699_100017005 | 3300005518 | Bacteria | 6245 |
| 121 | Ga0070699_100017391 | 3300005518 | Bacteria | 6172 |
| 122 | Ga0070699_100042912 | 3300005518 | Bacteria | 3915 |
| 123 | Ga0070699_100045524 | 3300005518 | Bacteria | 3797 |
| 124 | Ga0070699_100049616 | 3300005518 | Bacteria | 3633 |
| 125 | Ga0070699_100138833 | 3300005518 | Bacteria | 2145 |
| 126 | Ga0070699_100178956 | 3300005518 | Bacteria | 1881 |
| 127 | Ga0070699_100302615 | 3300005518 | Bacteria | 1435 |
| 128 | Ga0070699_100335899 | 3300005518 | Bacteria | 1359 |
| 129 | Ga0070699_100496192 | 3300005518 | Bacteria | 1109 |
| 130 | Ga0070699_100694096 | 3300005518 | Bacteria | 930 |
| 131 | Ga0070679_100000337 | 3300005530 | Bacteria | 39944 |
| 132 | Ga0070679_100026242 | 3300005530 | Bacteria | 5720 |
| 133 | Ga0070679_100057425 | 3300005530 | Bacteria | 3879 |
| 134 | Ga0070679_100354391 | 3300005530 | Bacteria | 1415 |
| 135 | Ga0070684_100001270 | 3300005535 | Bacteria | 18074 |
| 136 | Ga0070684_100027129 | 3300005535 | Bacteria | 4831 |
| 137 | Ga0070684_100100994 | 3300005535 | Bacteria | 2577 |
| 138 | Ga0070684_100119059 | 3300005535 | Bacteria | 2374 |
| 139 | Ga0070697_100000004 | 3300005536 | Bacteria | 284078 |
| 140 | Ga0070697_100000579 | 3300005536 | Bacteria | 27659 |
| 141 | Ga0070697_100006957 | 3300005536 | Bacteria | 8796 |
| 142 | Ga0070697_100012474 | 3300005536 | Bacteria | 6658 |
| 143 | Ga0070697_100014356 | 3300005536 | Bacteria | 6222 |
| 144 | Ga0070697_100018374 | 3300005536 | Bacteria | 5511 |
| 145 | Ga0070697_100090386 | 3300005536 | Bacteria | 2530 |
| 146 | Ga0070697_100237069 | 3300005536 | Bacteria | 1557 |
| 147 | Ga0070697_100598689 | 3300005536 | Bacteria | 969 |
| 148 | Ga0068853_100000111 | 3300005539 | Bacteria | 55607 |
| 149 | Ga0068853_100264821 | 3300005539 | Bacteria | 1581 |
| 150 | Ga0070686_100505165 | 3300005544 | Bacteria | 939 |
| 151 | Ga0070695_100000192 | 3300005545 | Bacteria | 29723 |
| 152 | Ga0070695_100000344 | 3300005545 | Bacteria | 23796 |
| 153 | Ga0070695_100023894 | 3300005545 | Bacteria | 3763 |
| 154 | Ga0070695_100314009 | 3300005545 | Bacteria | 1163 |
| 155 | Ga0070695_101453332 | 3300005545 | Archaea | 569 |
| 156 | Ga0070696_100004178 | 3300005546 | Bacteria | 9620 |
| 157 | Ga0070696_100099763 | 3300005546 | Bacteria | 2079 |
| 158 | Ga0070696_100206696 | 3300005546 | Unclassified | 1468 |
| 159 | Ga0070696_100225059 | 3300005546 | Unclassified | 1409 |
| 160 | Ga0070696_100525269 | 3300005546 | Unclassified | 945 |
| 161 | Ga0070693_100000173 | 3300005547 | Bacteria | 29921 |
| 162 | Ga0070665_102075915 | 3300005548 | Unclassified | 573 |
| 163 | Ga0070704_100001677 | 3300005549 | Bacteria | 12029 |
| 164 | Ga0070704_100138287 | 3300005549 | Bacteria | 1898 |
| 165 | Ga0068855_100000219 | 3300005563 | Bacteria | 72993 |
| 166 | Ga0068855_100029103 | 3300005563 | Bacteria | 6606 |
| 167 | Ga0070664_100001899 | 3300005564 | Bacteria | 16778 |
| 168 | Ga0070664_100260426 | 3300005564 | Bacteria | 1561 |
| 169 | Ga0068857_100001268 | 3300005577 | Bacteria | 19798 |
| 170 | Ga0068857_100015971 | 3300005577 | Bacteria | 6576 |
| 171 | Ga0068857_100254421 | 3300005577 | Bacteria | 1611 |
| 172 | Ga0068857_100295862 | 3300005577 | Bacteria | 1492 |
| 173 | Ga0068854_100000800 | 3300005578 | Bacteria | 18745 |
| 174 | Ga0068854_100198117 | 3300005578 | Bacteria | 1577 |
| 175 | Ga0068854_101075876 | 3300005578 | Bacteria | 715 |
| 176 | Ga0068856_100003539 | 3300005614 | Bacteria | 15735 |
| 177 | Ga0068856_100006383 | 3300005614 | Bacteria | 11565 |
| 178 | Ga0068856_100046447 | 3300005614 | Bacteria | 4277 |
| 179 | Ga0068856_100683891 | 3300005614 | Bacteria | 1046 |
| 180 | Ga0070702_100038006 | 3300005615 | Bacteria | 2677 |
| 181 | Ga0068852_100009459 | 3300005616 | Bacteria | 7240 |
| 182 | Ga0068859_100004490 | 3300005617 | Bacteria | 14232 |
| 183 | Ga0068859_100129394 | 3300005617 | Bacteria | 2595 |
| 184 | Ga0068859_100379301 | 3300005617 | Bacteria | 1509 |
| 185 | Ga0068859_100937593 | 3300005617 | Bacteria | 949 |
| 186 | Ga0068864_100142633 | 3300005618 | Bacteria | 2162 |
| 187 | Ga0068864_100247577 | 3300005618 | Bacteria | 1653 |
| 188 | Ga0068864_100305042 | 3300005618 | Bacteria | 1491 |
| 189 | Ga0068861_100001718 | 3300005719 | Bacteria | 14042 |
| 190 | Ga0068851_10404805 | 3300005834 | Bacteria | 803 |
| 191 | Ga0068870_10000173 | 3300005840 | Bacteria | 23147 |
| 192 | Ga0068858_100018563 | 3300005842 | Bacteria | 6513 |
| 193 | Ga0068860_100010782 | 3300005843 | Bacteria | 9021 |
| 194 | Ga0068860_100137747 | 3300005843 | Bacteria | 2345 |
| 195 | Ga0068862_100000611 | 3300005844 | Bacteria | 37118 |
| 196 | Ga0070717_10000681 | 3300006028 | Bacteria | 21901 |
| 197 | Ga0070717_10001530 | 3300006028 | Bacteria | 16022 |
| 198 | Ga0070717_10011531 | 3300006028 | Bacteria | 6715 |
| 199 | Ga0070717_10505074 | 3300006028 | Bacteria | 1093 |
| 200 | Ga0070717_10574274 | 3300006028 | Bacteria | 1022 |
| 201 | Ga0070717_10669980 | 3300006028 | Bacteria | 942 |
| 202 | Ga0070717_12142509 | 3300006028 | Bacteria | 503 |
| 203 | Ga0075432_10277928 | 3300006058 | Unclassified | 688 |
| 204 | Ga0070715_10055704 | 3300006163 | Bacteria | 1717 |
| 205 | Ga0070715_10082698 | 3300006163 | Bacteria | 1461 |
| 206 | Ga0070715_10125353 | 3300006163 | Bacteria | 1229 |
| 207 | Ga0070715_10155727 | 3300006163 | Unclassified | 1124 |
| 208 | Ga0070716_100010546 | 3300006173 | Bacteria | 4636 |
| 209 | Ga0070716_100018989 | 3300006173 | Bacteria | 3589 |
| 210 | Ga0070716_100281302 | 3300006173 | Bacteria | 1148 |
| 211 | Ga0070712_100057677 | 3300006175 | Bacteria | 2729 |
| 212 | Ga0070712_100367042 | 3300006175 | Bacteria | 1182 |
| 213 | Ga0070712_100681585 | 3300006175 | Bacteria | 875 |
| 214 | Ga0097621_100152185 | 3300006237 | Bacteria | 1984 |
| 215 | Ga0068871_100034860 | 3300006358 | Bacteria | 3996 |
| 216 | Ga0075428_100414122 | 3300006844 | Bacteria | 1444 |
| 217 | Ga0075430_101099253 | 3300006846 | Unclassified | 655 |
| 218 | Ga0075431_100024903 | 3300006847 | Bacteria | 6136 |
| 219 | Ga0075431_100747105 | 3300006847 | Unclassified | 954 |
| 220 | Ga0075431_101198146 | 3300006847 | Bacteria | 722 |
| 221 | Ga0075431_101659824 | 3300006847 | Unclassified | 596 |
| 222 | Ga0075433_10013373 | 3300006852 | Bacteria | 6669 |
| 223 | Ga0075433_10020684 | 3300006852 | Bacteria | 5507 |
| 224 | Ga0075433_10026432 | 3300006852 | Bacteria | 4914 |
| 225 | Ga0075433_10037423 | 3300006852 | Bacteria | 4187 |
| 226 | Ga0075433_10044720 | 3300006852 | Bacteria | 3848 |
| 227 | Ga0075433_10165317 | 3300006852 | Bacteria | 1969 |
| 228 | Ga0075434_100056859 | 3300006871 | Bacteria | 3888 |
| 229 | Ga0075434_100114131 | 3300006871 | Bacteria | 2714 |
| 230 | Ga0075434_100126322 | 3300006871 | Bacteria | 2574 |
| 231 | Ga0075434_100136087 | 3300006871 | Bacteria | 2476 |
| 232 | Ga0075434_100328435 | 3300006871 | Bacteria | 1550 |
| 233 | Ga0075434_101051893 | 3300006871 | Unclassified | 828 |
| 234 | Ga0075429_100001122 | 3300006880 | Bacteria | 21576 |
| 235 | Ga0075436_100010351 | 3300006914 | Bacteria | 6390 |
| 236 | Ga0075436_100020611 | 3300006914 | Bacteria | 4524 |
| 237 | Ga0075436_100039187 | 3300006914 | Bacteria | 3270 |
| 238 | Ga0075436_100051093 | 3300006914 | Bacteria | 2853 |
| 239 | Ga0075436_100079795 | 3300006914 | Bacteria | 2267 |
| 240 | Ga0075436_100146213 | 3300006914 | Bacteria | 1662 |
| 241 | Ga0075436_100224672 | 3300006914 | Bacteria | 1333 |
| 242 | Ga0075436_100377282 | 3300006914 | Bacteria | 1025 |
| 243 | Ga0097620_100004490 | 3300006931 | Bacteria | 14232 |
| 244 | Ga0097620_100129395 | 3300006931 | Bacteria | 2595 |
| 245 | Ga0097620_100379307 | 3300006931 | Bacteria | 1509 |
| 246 | Ga0097620_100937562 | 3300006931 | Bacteria | 949 |
| 247 | Ga0075435_100011096 | 3300007076 | Bacteria | 6608 |
| 248 | Ga0075435_100027776 | 3300007076 | Bacteria | 4430 |
| 249 | Ga0075435_100053369 | 3300007076 | Bacteria | 3260 |
| 250 | Ga0075435_100063261 | 3300007076 | Bacteria | 3005 |
| 251 | Ga0075435_100148552 | 3300007076 | Bacteria | 1969 |
| 252 | Ga0075435_100259785 | 3300007076 | Bacteria | 1479 |
| 253 | Ga0075435_100613831 | 3300007076 | Bacteria | 943 |
| 254 | Ga0075435_100836270 | 3300007076 | Bacteria | 802 |
| 255 | Ga0099794_10027607 | 3300007265 | Bacteria | 2633 |
| 256 | Ga0099794_10062699 | 3300007265 | Bacteria | 1808 |
| 257 | Ga0111539_10915035 | 3300009094 | Unclassified | 1020 |
| 258 | Ga0105245_10449198 | 3300009098 | Bacteria | 1297 |
| 259 | Ga0105247_10365609 | 3300009101 | Bacteria | 1019 |
| 260 | Ga0114129_10009751 | 3300009147 | Bacteria | 13697 |
| 261 | Ga0114129_10161721 | 3300009147 | Unclassified | 3058 |
| 262 | Ga0114129_10166399 | 3300009147 | Bacteria | 3009 |
| 263 | Ga0114129_10332883 | 3300009147 | Bacteria | 2015 |
| 264 | Ga0114129_10474690 | 3300009147 | Bacteria | 1637 |
| 265 | Ga0114129_10566308 | 3300009147 | Bacteria | 1476 |
| 266 | Ga0114129_10703641 | 3300009147 | Bacteria | 1298 |
| 267 | Ga0114129_11079641 | 3300009147 | Bacteria | 1006 |
| 268 | Ga0105243_10371785 | 3300009148 | Bacteria | 1319 |
| 269 | Ga0105243_11014962 | 3300009148 | Bacteria | 833 |
| 270 | Ga0105241_10000394 | 3300009174 | Bacteria | 33141 |
| 271 | Ga0105241_10621389 | 3300009174 | Bacteria | 978 |
| 272 | Ga0105241_10986923 | 3300009174 | Bacteria | 787 |
| 273 | Ga0105242_10189718 | 3300009176 | Bacteria | 1819 |
| 274 | Ga0105248_10177030 | 3300009177 | Bacteria | 2404 |
| 275 | Ga0105237_10004386 | 3300009545 | Bacteria | 16356 |
| 276 | Ga0105237_10101218 | 3300009545 | Bacteria | 2873 |
| 277 | Ga0105237_10160278 | 3300009545 | Bacteria | 2248 |
| 278 | Ga0105238_10042520 | 3300009551 | Bacteria | 4601 |
| 279 | Ga0105238_10230934 | 3300009551 | Bacteria | 1827 |
| 280 | Ga0105238_11376319 | 3300009551 | Bacteria | 732 |
| 281 | Ga0105249_10396233 | 3300009553 | Bacteria | 1410 |
| 282 | Ga0099796_10051647 | 3300010159 | Unclassified | 1429 |
| 283 | Ga0105239_10816112 | 3300010375 | Bacteria | 1069 |
| 284 | Ga0105246_10110617 | 3300011119 | Unclassified | 2018 |
| 285 | Ga0157373_10000051 | 3300013100 | Bacteria | 105264 |
| 286 | Ga0157373_10185371 | 3300013100 | Bacteria | 1466 |
| 287 | Ga0157371_10307315 | 3300013102 | Bacteria | 1149 |
| 288 | Ga0157370_10371724 | 3300013104 | Bacteria | 1317 |
| 289 | Ga0157369_10010586 | 3300013105 | Bacteria | 10499 |
| 290 | Ga0157369_10025725 | 3300013105 | Bacteria | 6530 |
| 291 | Ga0163162_10389334 | 3300013306 | Bacteria | 1527 |
| 292 | Ga0163162_11098915 | 3300013306 | Bacteria | 901 |
| 293 | Ga0157372_10001083 | 3300013307 | Bacteria | 29625 |
| 294 | Ga0157372_10032114 | 3300013307 | Bacteria | 5754 |
| 295 | Ga0157372_10497580 | 3300013307 | Bacteria | 1421 |
| 296 | Ga0157372_10797068 | 3300013307 | Bacteria | 1098 |
| 297 | Ga0157372_12343289 | 3300013307 | Bacteria | 613 |
| 298 | Ga0157372_12466530 | 3300013307 | Unclassified | 597 |
| 299 | Ga0163163_10062290 | 3300014325 | Bacteria | 3696 |
| 300 | Ga0157377_10041102 | 3300014745 | Bacteria | 2564 |
| 301 | Ga0157379_10244762 | 3300014968 | Unclassified | 1627 |
| 302 | Ga0182007_10029010 | 3300015262 | Bacteria | 1896 |
| 303 | Ga0163161_10439200 | 3300017792 | Unclassified | 1053 |
| 304 | Ga0206350_10295288 | 3300020080 | Bacteria | 700 |
| 305 | Ga0206350_10646724 | 3300020080 | Bacteria | 771 |
| 306 | Ga0154015_1169539 | 3300020610 | Bacteria | 1161 |
| 307 | Ga0154015_1662471 | 3300020610 | Bacteria | 544 |
| 308 | Ga0224712_10010958 | 3300022467 | Unclassified | 2793 |
| 309 | Ga0207653_10000824 | 3300025885 | Bacteria | 10350 |
| 310 | Ga0207653_10001098 | 3300025885 | Bacteria | 8874 |
| 311 | Ga0207653_10002427 | 3300025885 | Bacteria | 5922 |
| 312 | Ga0207710_10075550 | 3300025900 | Unclassified | 1553 |
| 313 | Ga0207680_10149862 | 3300025903 | Bacteria | 1554 |
| 314 | Ga0207647_10136191 | 3300025904 | Bacteria | 1441 |
| 315 | Ga0207685_10137365 | 3300025905 | Bacteria | 1092 |
| 316 | Ga0207699_10176956 | 3300025906 | Bacteria | 1431 |
| 317 | Ga0207645_10000062 | 3300025907 | Bacteria | 76875 |
| 318 | Ga0207645_10229836 | 3300025907 | Bacteria | 1224 |
| 319 | Ga0207643_10000219 | 3300025908 | Bacteria | 40245 |
| 320 | Ga0207705_10792929 | 3300025909 | Bacteria | 735 |
| 321 | Ga0207684_10000035 | 3300025910 | Bacteria | 289353 |
| 322 | Ga0207684_10005095 | 3300025910 | Bacteria | 12248 |
| 323 | Ga0207684_10005357 | 3300025910 | Bacteria | 11852 |
| 324 | Ga0207684_10006721 | 3300025910 | Bacteria | 10445 |
| 325 | Ga0207684_10010175 | 3300025910 | Bacteria | 8283 |
| 326 | Ga0207684_10013567 | 3300025910 | Bacteria | 7043 |
| 327 | Ga0207684_10051786 | 3300025910 | Bacteria | 3484 |
| 328 | Ga0207684_10080139 | 3300025910 | Bacteria | 2777 |
| 329 | Ga0207684_10114708 | 3300025910 | Bacteria | 2307 |
| 330 | Ga0207684_10242639 | 3300025910 | Bacteria | 1554 |
| 331 | Ga0207684_10291647 | 3300025910 | Bacteria | 1407 |
| 332 | Ga0207654_10016553 | 3300025911 | Bacteria | 3842 |
| 333 | Ga0207654_10987586 | 3300025911 | Bacteria | 612 |
| 334 | Ga0207707_10000047 | 3300025912 | Bacteria | 118016 |
| 335 | Ga0207707_10080058 | 3300025912 | Bacteria | 2853 |
| 336 | Ga0207707_10154217 | 3300025912 | Bacteria | 2008 |
| 337 | Ga0207707_10200898 | 3300025912 | Bacteria | 1738 |
| 338 | Ga0207671_10016883 | 3300025914 | Bacteria | 5652 |
| 339 | Ga0207671_10365736 | 3300025914 | Bacteria | 1145 |
| 340 | Ga0207693_10013161 | 3300025915 | Bacteria | 6674 |
| 341 | Ga0207693_10115810 | 3300025915 | Bacteria | 2104 |
| 342 | Ga0207693_11147283 | 3300025915 | Bacteria | 588 |
| 343 | Ga0207663_10037521 | 3300025916 | Bacteria | 2922 |
| 344 | Ga0207663_10074795 | 3300025916 | Bacteria | 2196 |
| 345 | Ga0207660_10001817 | 3300025917 | Bacteria | 14216 |
| 346 | Ga0207660_11411135 | 3300025917 | Bacteria | 564 |
| 347 | Ga0207662_11067552 | 3300025918 | Unclassified | 574 |
| 348 | Ga0207657_10000021 | 3300025919 | Bacteria | 155900 |
| 349 | Ga0207649_10008334 | 3300025920 | Bacteria | 5650 |
| 350 | Ga0207649_10373260 | 3300025920 | Unclassified | 1061 |
| 351 | Ga0207652_10000922 | 3300025921 | Bacteria | 27650 |
| 352 | Ga0207652_10016152 | 3300025921 | Bacteria | 6089 |
| 353 | Ga0207652_10170693 | 3300025921 | Bacteria | 1952 |
| 354 | Ga0207646_10000127 | 3300025922 | Bacteria | 103693 |
| 355 | Ga0207646_10001275 | 3300025922 | Bacteria | 31514 |
| 356 | Ga0207646_10006816 | 3300025922 | Bacteria | 11749 |
| 357 | Ga0207646_10009589 | 3300025922 | Bacteria | 9551 |
| 358 | Ga0207646_10011893 | 3300025922 | Bacteria | 8396 |
| 359 | Ga0207646_10013824 | 3300025922 | Bacteria | 7697 |
| 360 | Ga0207646_10026904 | 3300025922 | Bacteria | 5244 |
| 361 | Ga0207646_10027191 | 3300025922 | Bacteria | 5217 |
| 362 | Ga0207646_10054273 | 3300025922 | Bacteria | 3585 |
| 363 | Ga0207646_10061957 | 3300025922 | Bacteria | 3339 |
| 364 | Ga0207646_10064236 | 3300025922 | Bacteria | 3276 |
| 365 | Ga0207646_10078842 | 3300025922 | Bacteria | 2944 |
| 366 | Ga0207646_10106352 | 3300025922 | Bacteria | 2517 |
| 367 | Ga0207646_10123585 | 3300025922 | Bacteria | 2327 |
| 368 | Ga0207646_10123778 | 3300025922 | Bacteria | 2324 |
| 369 | Ga0207646_10167098 | 3300025922 | Bacteria | 1986 |
| 370 | Ga0207646_10260137 | 3300025922 | Unclassified | 1568 |
| 371 | Ga0207646_10334694 | 3300025922 | Bacteria | 1368 |
| 372 | Ga0207646_10442863 | 3300025922 | Bacteria | 1172 |
| 373 | Ga0207681_10031576 | 3300025923 | Bacteria | 3460 |
| 374 | Ga0207694_10069964 | 3300025924 | Bacteria | 2742 |
| 375 | Ga0207694_10884110 | 3300025924 | Bacteria | 755 |
| 376 | Ga0207650_10015740 | 3300025925 | Bacteria | 5273 |
| 377 | Ga0207687_10299589 | 3300025927 | Bacteria | 1295 |
| 378 | Ga0207700_10003827 | 3300025928 | Bacteria | 8789 |
| 379 | Ga0207700_10065566 | 3300025928 | Bacteria | 2771 |
| 380 | Ga0207700_10114039 | 3300025928 | Bacteria | 2180 |
| 381 | Ga0207664_10007423 | 3300025929 | Bacteria | 7599 |
| 382 | Ga0207664_10066742 | 3300025929 | Bacteria | 2885 |
| 383 | Ga0207664_10158478 | 3300025929 | Bacteria | 1929 |
| 384 | Ga0207664_10253130 | 3300025929 | Bacteria | 1538 |
| 385 | Ga0207690_10004322 | 3300025932 | Bacteria | 8390 |
| 386 | Ga0207690_10763568 | 3300025932 | Bacteria | 798 |
| 387 | Ga0207706_10005155 | 3300025933 | Bacteria | 12197 |
| 388 | Ga0207686_10615159 | 3300025934 | Bacteria | 856 |
| 389 | Ga0207709_10193929 | 3300025935 | Bacteria | 1445 |
| 390 | Ga0207709_11608687 | 3300025935 | Bacteria | 540 |
| 391 | Ga0207670_10024124 | 3300025936 | Bacteria | 3798 |
| 392 | Ga0207669_10873078 | 3300025937 | Bacteria | 750 |
| 393 | Ga0207665_10000261 | 3300025939 | Bacteria | 36619 |
| 394 | Ga0207665_10016024 | 3300025939 | Bacteria | 4922 |
| 395 | Ga0207665_10134477 | 3300025939 | Bacteria | 1758 |
| 396 | Ga0207665_10763233 | 3300025939 | Bacteria | 763 |
| 397 | Ga0207711_10131410 | 3300025941 | Bacteria | 2245 |
| 398 | Ga0207711_10281233 | 3300025941 | Bacteria | 1532 |
| 399 | Ga0207689_10000516 | 3300025942 | Bacteria | 36653 |
| 400 | Ga0207689_10130414 | 3300025942 | Bacteria | 2069 |
| 401 | Ga0207661_10000910 | 3300025944 | Bacteria | 19412 |
| 402 | Ga0207661_10001421 | 3300025944 | Bacteria | 16130 |
| 403 | Ga0207661_10193629 | 3300025944 | Bacteria | 1784 |
| 404 | Ga0207679_10000705 | 3300025945 | Bacteria | 22298 |
| 405 | Ga0207679_10804514 | 3300025945 | Bacteria | 857 |
| 406 | Ga0207679_10928523 | 3300025945 | Bacteria | 796 |
| 407 | Ga0207667_10005241 | 3300025949 | Bacteria | 15816 |
| 408 | Ga0207667_10874410 | 3300025949 | Bacteria | 892 |
| 409 | Ga0207712_10436679 | 3300025961 | Bacteria | 1108 |
| 410 | Ga0207640_10005506 | 3300025981 | Bacteria | 6903 |
| 411 | Ga0207640_10795682 | 3300025981 | Bacteria | 819 |
| 412 | Ga0207640_11092251 | 3300025981 | Bacteria | 705 |
| 413 | Ga0207658_10068623 | 3300025986 | Bacteria | 2676 |
| 414 | Ga0207703_10247677 | 3300026035 | Bacteria | 1604 |
| 415 | Ga0207703_10889950 | 3300026035 | Bacteria | 852 |
| 416 | Ga0207639_10010246 | 3300026041 | Bacteria | 6486 |
| 417 | Ga0207639_10076362 | 3300026041 | Bacteria | 2638 |
| 418 | Ga0207639_10932104 | 3300026041 | Bacteria | 812 |
| 419 | Ga0207678_10001391 | 3300026067 | Bacteria | 22252 |
| 420 | Ga0207678_10839978 | 3300026067 | Bacteria | 811 |
| 421 | Ga0207708_10040893 | 3300026075 | Bacteria | 3535 |
| 422 | Ga0207702_10001148 | 3300026078 | Bacteria | 27096 |
| 423 | Ga0207702_10016684 | 3300026078 | Bacteria | 6078 |
| 424 | Ga0207702_10018134 | 3300026078 | Bacteria | 5823 |
| 425 | Ga0207702_10874148 | 3300026078 | Bacteria | 890 |
| 426 | Ga0207641_10035878 | 3300026088 | Bacteria | 4135 |
| 427 | Ga0207648_10009287 | 3300026089 | Bacteria | 9433 |
| 428 | Ga0207648_10466842 | 3300026089 | Bacteria | 1151 |
| 429 | Ga0207648_10887512 | 3300026089 | Bacteria | 832 |
| 430 | Ga0207676_10148550 | 3300026095 | Bacteria | 2015 |
| 431 | Ga0207676_10208545 | 3300026095 | Bacteria | 1732 |
| 432 | Ga0207674_10000137 | 3300026116 | Bacteria | 84955 |
| 433 | Ga0207674_10002627 | 3300026116 | Bacteria | 22496 |
| 434 | Ga0207674_10080429 | 3300026116 | Bacteria | 3262 |
| 435 | Ga0207674_10874622 | 3300026116 | Bacteria | 866 |
| 436 | Ga0207675_100005591 | 3300026118 | Bacteria | 12031 |
| 437 | Ga0207675_100108774 | 3300026118 | Bacteria | 2615 |
| 438 | Ga0207698_10013879 | 3300026142 | Bacteria | 5334 |
| 439 | Ga0209996_1004023 | 3300027395 | Bacteria | 1863 |
| 440 | Ga0209968_1001059 | 3300027526 | Bacteria | 4195 |
| 441 | Ga0209970_1005879 | 3300027614 | Bacteria | 2016 |
| 442 | Ga0209971_1000030 | 3300027682 | Bacteria | 50605 |
| 443 | Ga0209966_1000518 | 3300027695 | Bacteria | 9982 |
| 444 | Ga0209998_10000007 | 3300027717 | Bacteria | 99753 |
| 445 | Ga0209974_10005666 | 3300027876 | Bacteria | 4384 |
| 446 | Ga0207428_10463056 | 3300027907 | Unclassified | 923 |
| 447 | Ga0268265_10008195 | 3300028380 | Bacteria | 7059 |
| 448 | Ga0268265_10124103 | 3300028380 | Bacteria | 2133 |
| 449 | Ga0268264_10255667 | 3300028381 | Bacteria | 1629 |
| 450 | Ga0268264_11679737 | 3300028381 | Bacteria | 646 |
| 451 | Ga0268264_12226500 | 3300028381 | Bacteria | 556 |
| 452 | Ga0265338_10021958 | 3300028800 | Bacteria | 6632 |
| 453 | Ga0307406_11111089 | 3300031901 | Bacteria | 683 |
| 454 | Ga0307406_12080911 | 3300031901 | Bacteria | 508 |
| 455 | Ga0307407_10179460 | 3300031903 | Bacteria | 1402 |
| 456 | Ga0307407_10991351 | 3300031903 | Bacteria | 649 |
| 457 | Ga0307412_10594322 | 3300031911 | Unclassified | 936 |
| 458 | Ga0307409_100388941 | 3300031995 | Bacteria | 1328 |
| 459 | Ga0307409_100390543 | 3300031995 | Bacteria | 1326 |
| 460 | Ga0307416_100036888 | 3300032002 | Bacteria | 3755 |
| 461 | Ga0307416_101002724 | 3300032002 | Bacteria | 938 |
| 462 | Ga0307416_101335460 | 3300032002 | Bacteria | 823 |
| 463 | Ga0307414_10053595 | 3300032004 | Unclassified | 2814 |
| 464 | Ga0307415_100145941 | 3300032126 | Bacteria | 1814 |
| 465 | Ga0373948_0007310 | 3300034817 | Bacteria | 1854 |
| 466 | Ga0373950_0005212 | 3300034818 | Bacteria | 1933 |
| 467 | Ga0373929_0030774 | 3300035085 | Bacteria | 1146 |
| 468 | Ga0373940_0168555 | 3300035088 | Bacteria | 706 |
| 469 | Ga0373940_0181411 | 3300035088 | Bacteria | 684 |
| 470 | Ga0373944_0148940 | 3300035089 | Unclassified | 824 |
| 471 | Ga0373949_0102571 | 3300035090 | Bacteria | 785 |
| 472 | Ga0373951_0005575 | 3300035091 | Bacteria | 2919 |
| 473 | Ga0373939_0101818 | 3300035114 | Bacteria | 987 |
| 474 | Ga0373941_0069242 | 3300035115 | Bacteria | 1167 |
| 475 | Ga0373941_0257795 | 3300035115 | Unclassified | 683 |
| 476 | Ga0373953_0030319 | 3300035117 | Bacteria | 2097 |
| 477 | Ga0373960_0021009 | 3300035121 | Bacteria | 1731 |
| 478 | Ga0373943_0011516 | 3300035170 | Bacteria | 3981 |
| 479 | Ga0373955_0064542 | 3300035172 | Bacteria | 2030 |
| 480 | Ga0373961_0196905 | 3300035241 | Unclassified | 709 |
| 481 | Ga0373962_0086344 | 3300035242 | Bacteria | 960 |
| 482 | Ga0373931_0030828 | 3300035691 | Bacteria | 2763 |
| 483 | Ga0373931_0071700 | 3300035691 | Bacteria | 1893 |
| 484 | Ga0373935_0769913 | 3300035692 | Unclassified | 710 |
| 485 | Ga0373927_0177637 | 3300035695 | Bacteria | 1396 |
| 486 | Ga0373947_0018173 | 3300035725 | Bacteria | 4046 |
| 487 | Ga0373947_0290725 | 3300035725 | Bacteria | 1088 |
| 488 | Ga0373937_0464517 | 3300036401 | Unclassified | 1202 |
| 489 | Ga0373937_0658199 | 3300036401 | Bacteria | 993 |
| 490 | Ga0373937_1616910 | 3300036401 | Bacteria | 595 |
| 491 | Ga0373925_1683592 | 3300037068 | Bacteria | 518 |
| 492 | Ga0242420_128848 | 3300038996 | Bacteria | 557 |
| 493 | Ga0451839_1328708 | 3300041496 | Unclassified | 585 |
| 494 | Ga0439448_0012354 | 3300042005 | Bacteria | 2556 |
| 495 | Ga0439450_005787 | 3300042008 | Bacteria | 2193 |
| 496 | Ga0439455_0029996 | 3300042012 | Bacteria | 1347 |
| 497 | Ga0439459_0007577 | 3300042438 | Bacteria | 1837 |
| 498 | Ga0439460_0000543 | 3300042461 | Bacteria | 8259 |
| 499 | Ga0451577_0007768 | 3300042876 | Bacteria | 10512 |
| 500 | Ga0451577_0099946 | 3300042876 | Bacteria | 2591 |
| 501 | Ga0451577_0284121 | 3300042876 | Bacteria | 1499 |
| 502 | Ga0466969_0385503 | 3300044656 | Bacteria | 636 |
| 503 | Ga0466966_0213154 | 3300044684 | Bacteria | 1167 |
| 504 | Ga0453684_0097361 | 3300044712 | Bacteria | 3611 |
| 505 | Ga0453684_0654914 | 3300044712 | Bacteria | 1146 |
| 506 | Ga0451576_0006733 | 3300045051 | Bacteria | 13998 |
| 507 | Ga0451576_0181980 | 3300045051 | Bacteria | 2194 |
| 508 | Ga0451576_0421452 | 3300045051 | Bacteria | 1400 |
| 509 | Ga0451576_0435155 | 3300045051 | Bacteria | 1376 |
| 510 | Ga0466967_1498033 | 3300045976 | Bacteria | 672 |
| 511 | Ga0495618_0020262 | 3300046514 | Bacteria | 4095 |
| 512 | Ga0495628_0037485 | 3300046516 | Bacteria | 3887 |
| 513 | Ga0495630_0057279 | 3300046517 | Bacteria | 2920 |
| 514 | Ga0495640_0086872 | 3300046533 | Bacteria | 2070 |
| 515 | Ga0495586_0155989 | 3300046535 | Bacteria | 1286 |
| 516 | Ga0495634_0116211 | 3300046642 | Bacteria | 1716 |
| 517 | Ga0495658_0253652 | 3300046683 | Bacteria | 1107 |
| 518 | Ga0495674_0225847 | 3300047319 | Bacteria | 1547 |
| 519 | Ga0495674_0434742 | 3300047319 | Bacteria | 1056 |
| 520 | Ga0495686_0463077 | 3300047472 | Bacteria | 672 |
| 521 | Ga0496101_1295154 | 3300048904 | Bacteria | 570 |
| 522 | Ga0496102_0571845 | 3300048905 | Bacteria | 1053 |
| 523 | Ga0496104_0003857 | 3300048907 | Bacteria | 12971 |
| 524 | Ga0496105_0001646 | 3300048908 | Bacteria | 15908 |
| 525 | Ga0496106_0047042 | 3300048909 | Bacteria | 3245 |
| 526 | Ga0496106_0569942 | 3300048909 | Bacteria | 908 |
| 527 | Ga0496107_0094047 | 3300048910 | Bacteria | 2193 |
| 528 | Ga0496109_0342696 | 3300048912 | Bacteria | 1411 |
| 529 | Ga0496109_0376060 | 3300048912 | Bacteria | 1342 |
| 530 | Ga0496109_0410860 | 3300048912 | Bacteria | 1279 |
| 531 | Ga0496110_0080123 | 3300048913 | Bacteria | 2909 |
| 532 | Ga0496111_0851054 | 3300048914 | Bacteria | 658 |
| 533 | Ga0496112_0011876 | 3300048915 | Bacteria | 7976 |
| 534 | Ga0496112_0169415 | 3300048915 | Bacteria | 2149 |
| 535 | Ga0496112_0472587 | 3300048915 | Bacteria | 1191 |
| 536 | Ga0496112_0750895 | 3300048915 | Bacteria | 902 |
| 537 | Ga0496112_1507336 | 3300048915 | Bacteria | 586 |
| 538 | Ga0496113_0921183 | 3300048916 | Bacteria | 691 |
| 539 | Ga0496114_0004681 | 3300048917 | Bacteria | 10641 |
| 540 | Ga0496115_0005310 | 3300048918 | Bacteria | 9368 |
| 541 | Ga0496115_0007377 | 3300048918 | Bacteria | 8092 |
| 542 | Ga0496115_0072359 | 3300048918 | Bacteria | 2797 |
| 543 | Ga0496115_0209302 | 3300048918 | Bacteria | 1611 |
| 544 | Ga0501032_0817353 | 3300049569 | Bacteria | 588 |
| 545 | Ga0501036_0050972 | 3300049572 | Bacteria | 3505 |
| 546 | Ga0501037_0104159 | 3300049573 | Bacteria | 2046 |
| 547 | Ga0501039_0045196 | 3300049575 | Bacteria | 3402 |
| 548 | Ga0501040_0037643 | 3300049576 | Bacteria | 3287 |
| 549 | Ga0501040_0079557 | 3300049576 | Bacteria | 2269 |
| 550 | Ga0501040_0116812 | 3300049576 | Bacteria | 1869 |
| 551 | Ga0501041_0003130 | 3300049577 | Bacteria | 9521 |
| 552 | Ga0501042_0162834 | 3300049578 | Bacteria | 1609 |
| 553 | Ga0501043_0024003 | 3300049579 | Bacteria | 4785 |
| 554 | Ga0501046_0001249 | 3300049580 | Bacteria | 24589 |
| 555 | Ga0501046_0115465 | 3300049580 | Bacteria | 2047 |
| 556 | Ga0501047_0161380 | 3300049581 | Bacteria | 2113 |
| 557 | Ga0501048_0001345 | 3300049582 | Bacteria | 18641 |
| 558 | Ga0501067_0001495 | 3300049583 | Bacteria | 12726 |
| 559 | Ga0501067_0013578 | 3300049583 | Bacteria | 4511 |
| 560 | Ga0501067_0046842 | 3300049583 | Bacteria | 2400 |
| 561 | Ga0501067_0252487 | 3300049583 | Bacteria | 982 |
| 562 | Ga0501068_0151979 | 3300049584 | Bacteria | 1455 |
| 563 | Ga0501068_0289680 | 3300049584 | Bacteria | 1047 |
| 564 | Ga0501069_0014678 | 3300049585 | Bacteria | 4190 |
| 565 | Ga0501069_0168077 | 3300049585 | Bacteria | 1265 |
| 566 | Ga0501070_0072501 | 3300049586 | Bacteria | 2851 |
| 567 | Ga0501070_0110047 | 3300049586 | Bacteria | 2277 |
| 568 | Ga0501070_1183212 | 3300049586 | Bacteria | 587 |
| 569 | Ga0501071_0028506 | 3300049587 | Bacteria | 3937 |
| 570 | Ga0501071_0369603 | 3300049587 | Bacteria | 1093 |
| 571 | Ga0501072_0073900 | 3300049588 | Bacteria | 2695 |
| 572 | Ga0501072_0679305 | 3300049588 | Bacteria | 810 |
| 573 | Ga0501075_0059316 | 3300049591 | Bacteria | 2882 |
| 574 | Ga0501075_0149397 | 3300049591 | Bacteria | 1781 |
| 575 | Ga0501075_0691354 | 3300049591 | Unclassified | 777 |
| 576 | Ga0501076_0008426 | 3300049592 | Bacteria | 7556 |
| 577 | Ga0501076_0135700 | 3300049592 | Bacteria | 1997 |
| 578 | Ga0501076_0430081 | 3300049592 | Bacteria | 1086 |
| 579 | Ga0501076_1031146 | 3300049592 | Bacteria | 678 |
| 580 | Ga0501077_0195330 | 3300049593 | Bacteria | 1285 |
| 581 | Ga0501199_031090 | 3300049650 | Bacteria | 659 |
| 582 | Ga0501202_166165 | 3300049652 | Bacteria | 587 |
| 583 | Ga0501235_161569 | 3300049669 | Bacteria | 586 |
| 584 | Ga0501257_117665 | 3300049686 | Bacteria | 709 |
| 585 | Ga0501079_0000310 | 3300049741 | Bacteria | 30465 |
| 586 | Ga0501079_0173858 | 3300049741 | Bacteria | 1679 |
| 587 | Ga0501079_0410973 | 3300049741 | Bacteria | 1062 |
| 588 | Ga0501080_0882551 | 3300049742 | Bacteria | 780 |
| 589 | Ga0501080_1053134 | 3300049742 | Bacteria | 704 |
| 590 | Ga0501083_0053862 | 3300049744 | Bacteria | 2700 |
| 591 | Ga0501035_0142670 | 3300049822 | Bacteria | 2082 |
| 592 | Ga0501044_0063758 | 3300049823 | Bacteria | 3763 |
| 593 | Ga0501044_0501574 | 3300049823 | Unclassified | 1115 |
| 594 | Ga0501045_0014624 | 3300049824 | Bacteria | 5564 |
| 595 | Ga0501045_0164502 | 3300049824 | Bacteria | 1652 |
| 596 | Ga0501045_0254066 | 3300049824 | Bacteria | 1308 |
| 597 | Ga0501045_0400265 | 3300049824 | Bacteria | 1022 |
| 598 | nmdc:mga05p37_1070541_c1 | 3300050507 | Bacteria | 848 |
| 599 | nmdc:mga05p37_123539_c1 | 3300050507 | Bacteria | 3180 |
| 600 | nmdc:mga05p37_2019013_c1 | 3300050507 | Bacteria | 545 |
| 601 | nmdc:mga05p37_223404_c1 | 3300050507 | Unclassified | 2272 |
| 602 | nmdc:mga05p37_310687_c1 | 3300050507 | Bacteria | 1868 |
| 603 | nmdc:mga05p37_452536_c1 | 3300050507 | Bacteria | 1485 |
| 604 | nmdc:mga05p37_515006_c1 | 3300050507 | Bacteria | 1370 |
| 605 | nmdc:mga05p37_578129_c1 | 3300050507 | Bacteria | 1273 |
| 606 | nmdc:mga05p37_74471_c1 | 3300050507 | Bacteria | 4179 |
| 607 | nmdc:mga05p37_830811_c1 | 3300050507 | Bacteria | 1006 |
| 608 | nmdc:mga05p37_85663_c1 | 3300050507 | Bacteria | 3883 |
| 609 | nmdc:mga09592_16057_c1 | 3300050508 | Bacteria | 6121 |
| 610 | nmdc:mga09592_224516_c1 | 3300050508 | Bacteria | 1627 |
| 611 | nmdc:mga06r32_1080124_c1 | 3300050510 | Bacteria | 752 |
| 612 | nmdc:mga06r32_429174_c1 | 3300050510 | Bacteria | 1302 |
| 613 | nmdc:mga06r32_602979_c1 | 3300050510 | Bacteria | 1069 |
| 614 | nmdc:mga06r32_69950_c1 | 3300050510 | Unclassified | 3393 |
| 615 | nmdc:mga08y16_828933_c1 | 3300050511 | Unclassified | 916 |
| 616 | nmdc:mga0n895_117732_c1 | 3300050512 | Unclassified | 2676 |
| 617 | nmdc:mga0n895_1247225_c1 | 3300050512 | Bacteria | 716 |
| 618 | nmdc:mga0n895_1664_c1 | 3300050512 | Bacteria | 12894 |
| 619 | nmdc:mga0n895_236865_c1 | 3300050512 | Bacteria | 1852 |
| 620 | nmdc:mga0n895_252472_c1 | 3300050512 | Bacteria | 1790 |
| 621 | nmdc:mga0n895_262738_c1 | 3300050512 | Bacteria | 1752 |
| 622 | nmdc:mga0rr50_122419_c1 | 3300050513 | Bacteria | 2073 |
| 623 | nmdc:mga0rr50_1259854_c1 | 3300050513 | Unclassified | 628 |
| 624 | nmdc:mga0rr50_1406211_c1 | 3300050513 | Bacteria | 591 |
| 625 | nmdc:mga0rr50_1435232_c1 | 3300050513 | Bacteria | 584 |
| 626 | nmdc:mga0rr50_15743_c1 | 3300050513 | Bacteria | 5001 |
| 627 | nmdc:mga0rr50_23893_c1 | 3300050513 | Bacteria | 4226 |
| 628 | nmdc:mga0rr50_429964_c1 | 3300050513 | Unclassified | 1118 |
| 629 | nmdc:mga0rr50_448015_c1 | 3300050513 | Bacteria | 1094 |
| 630 | nmdc:mga0rr50_51456_c1 | 3300050513 | Bacteria | 3056 |
| 631 | nmdc:mga0rr50_62886_c1 | 3300050513 | Bacteria | 2802 |
| 632 | nmdc:mga0rr50_67274_c1 | 3300050513 | Bacteria | 2721 |
| 633 | nmdc:mga08x19_1079941_c1 | 3300050514 | Bacteria | 570 |
| 634 | nmdc:mga08x19_130868_c1 | 3300050514 | Bacteria | 1688 |
| 635 | nmdc:mga08x19_199904_c1 | 3300050514 | Bacteria | 1370 |
| 636 | nmdc:mga08x19_233064_c1 | 3300050514 | Bacteria | 1268 |
| 637 | nmdc:mga08x19_24742_c1 | 3300050514 | Bacteria | 3736 |
| 638 | nmdc:mga08x19_24964_c1 | 3300050514 | Bacteria | 3720 |
| 639 | nmdc:mga08x19_38580_c1 | 3300050514 | Bacteria | 3034 |
| 640 | nmdc:mga08x19_50929_c1 | 3300050514 | Bacteria | 2658 |
| 641 | nmdc:mga08x19_571175_c1 | 3300050514 | Bacteria | 801 |
| 642 | nmdc:mga08x19_85527_c1 | 3300050514 | Bacteria | 2075 |
| 643 | nmdc:mga0a205_10622_c1 | 3300050515 | Bacteria | 8465 |
| 644 | nmdc:mga0a205_127397_c1 | 3300050515 | Bacteria | 2446 |
| 645 | nmdc:mga0a205_133168_c1 | 3300050515 | Unclassified | 2386 |
| 646 | nmdc:mga0a205_16621_c1 | 3300050515 | Bacteria | 6891 |
| 647 | nmdc:mga0a205_2400_c1 | 3300050515 | Bacteria | 16532 |
| 648 | nmdc:mga0a205_73463_c1 | 3300050515 | Bacteria | 3304 |
| 649 | Ga0495601_1053237 | 3300053077 | Bacteria | 510 |
| 650 | Ga0501084_0001384 | 3300054114 | Bacteria | 19196 |
| 651 | Ga0501084_0512701 | 3300054114 | Bacteria | 1014 |
| 652 | Ga0501084_1041254 | 3300054114 | Unclassified | 687 |
| 653 | Ga0501082_0001189 | 3300060353 | Bacteria | 22875 |
| 654 | Ga0501082_0351601 | 3300060353 | Bacteria | 1285 |
| 655 | Ga0501082_0740056 | 3300060353 | Bacteria | 861 |
| 656 | Ga0501082_0865154 | 3300060353 | Bacteria | 791 |
| 657 | Ga0530510_0054996 | 3300061734 | Bacteria | 2876 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0253652 | Ga0495658_0253652_342_746 | 130 |
| 2 | 3300009147 | Ga0114129_10161721 | Ga0114129_101617212 | 131 |
| 3 | 3300050507 | nmdc:mga05p37_223404_c1 | nmdc:mga05p37_223404_c1_398_799 | 131 |
| 4 | 3300050512 | nmdc:mga0n895_117732_c1 | nmdc:mga0n895_117732_c1_511_912 | 131 |
| 5 | 3300050515 | nmdc:mga0a205_133168_c1 | nmdc:mga0a205_133168_c1_409_810 | 131 |
| 6 | iso_pu_bacteria | 2894023352 | 2894026545 | 131 |
| 7 | 3300007265 | Ga0099794_10027607 | Ga0099794_100276071 | 133 |
| 8 | 3300045976 | Ga0466967_1498033 | Ga0466967_1498033_55_462 | 133 |
| 9 | 3300005290 | Ga0065712_10160555 | Ga0065712_101605552 | 134 |
| 10 | 3300005327 | Ga0070658_10154964 | Ga0070658_101549642 | 134 |
| 11 | 3300005327 | Ga0070658_11998788 | Ga0070658_119987881 | 134 |
| 12 | 3300005435 | Ga0070714_100016484 | Ga0070714_1000164842 | 134 |
| 13 | 3300005435 | Ga0070714_100286028 | Ga0070714_1002860282 | 134 |
| 14 | 3300005437 | Ga0070710_10006186 | Ga0070710_100061865 | 134 |
| 15 | 3300005445 | Ga0070708_100042533 | Ga0070708_1000425334 | 134 |
| 16 | 3300005445 | Ga0070708_100043963 | Ga0070708_1000439634 | 134 |
| 17 | 3300005445 | Ga0070708_100667674 | Ga0070708_1006676741 | 134 |
| 18 | 3300005467 | Ga0070706_100216767 | Ga0070706_1002167674 | 134 |
| 19 | 3300005467 | Ga0070706_100364658 | Ga0070706_1003646583 | 134 |
| 20 | 3300005468 | Ga0070707_100040704 | Ga0070707_1000407042 | 134 |
| 21 | 3300005468 | Ga0070707_100052845 | Ga0070707_1000528453 | 134 |
| 22 | 3300005468 | Ga0070707_100078161 | Ga0070707_1000781613 | 134 |
| 23 | 3300005468 | Ga0070707_100404957 | Ga0070707_1004049572 | 134 |
| 24 | 3300005468 | Ga0070707_100843340 | Ga0070707_1008433401 | 134 |
| 25 | 3300005471 | Ga0070698_100001505 | Ga0070698_1000015054 | 134 |
| 26 | 3300005471 | Ga0070698_100156766 | Ga0070698_1001567663 | 134 |
| 27 | 3300005471 | Ga0070698_100217984 | Ga0070698_1002179842 | 134 |
| 28 | 3300005471 | Ga0070698_100743938 | Ga0070698_1007439382 | 134 |
| 29 | 3300005471 | Ga0070698_100934312 | Ga0070698_1009343121 | 134 |
| 30 | 3300005471 | Ga0070698_101629343 | Ga0070698_1016293431 | 134 |
| 31 | 3300005518 | Ga0070699_100003711 | Ga0070699_1000037113 | 134 |
| 32 | 3300005518 | Ga0070699_100045524 | Ga0070699_1000455243 | 134 |
| 33 | 3300005518 | Ga0070699_100335899 | Ga0070699_1003358994 | 134 |
| 34 | 3300005530 | Ga0070679_100354391 | Ga0070679_1003543912 | 134 |
| 35 | 3300005535 | Ga0070684_100001270 | Ga0070684_10000127011 | 134 |
| 36 | 3300005535 | Ga0070684_100027129 | Ga0070684_1000271292 | 134 |
| 37 | 3300005536 | Ga0070697_100000004 | Ga0070697_100000004270 | 134 |
| 38 | 3300005536 | Ga0070697_100006957 | Ga0070697_1000069577 | 134 |
| 39 | 3300005536 | Ga0070697_100598689 | Ga0070697_1005986892 | 134 |
| 40 | 3300005548 | Ga0070665_102075915 | Ga0070665_1020759151 | 134 |
| 41 | 3300005614 | Ga0068856_100046447 | Ga0068856_1000464471 | 134 |
| 42 | 3300006028 | Ga0070717_10505074 | Ga0070717_105050743 | 134 |
| 43 | 3300006028 | Ga0070717_12142509 | Ga0070717_121425091 | 134 |
| 44 | 3300006058 | Ga0075432_10277928 | Ga0075432_102779281 | 134 |
| 45 | 3300006163 | Ga0070715_10082698 | Ga0070715_100826982 | 134 |
| 46 | 3300006163 | Ga0070715_10125353 | Ga0070715_101253532 | 134 |
| 47 | 3300006173 | Ga0070716_100010546 | Ga0070716_1000105466 | 134 |
| 48 | 3300006175 | Ga0070712_100057677 | Ga0070712_1000576773 | 134 |
| 49 | 3300006847 | Ga0075431_100747105 | Ga0075431_1007471052 | 134 |
| 50 | 3300006871 | Ga0075434_100136087 | Ga0075434_1001360873 | 134 |
| 51 | 3300007076 | Ga0075435_100836270 | Ga0075435_1008362702 | 134 |
| 52 | 3300007265 | Ga0099794_10062699 | Ga0099794_100626992 | 134 |
| 53 | 3300009094 | Ga0111539_10915035 | Ga0111539_109150352 | 134 |
| 54 | 3300009147 | Ga0114129_10474690 | Ga0114129_104746902 | 134 |
| 55 | 3300009545 | Ga0105237_10160278 | Ga0105237_101602782 | 134 |
| 56 | 3300009551 | Ga0105238_10042520 | Ga0105238_100425203 | 134 |
| 57 | 3300013105 | Ga0157369_10010586 | Ga0157369_100105867 | 134 |
| 58 | 3300013307 | Ga0157372_10497580 | Ga0157372_104975802 | 134 |
| 59 | 3300013307 | Ga0157372_10797068 | Ga0157372_107970682 | 134 |
| 60 | 3300013307 | Ga0157372_12466530 | Ga0157372_124665302 | 134 |
| 61 | 3300025885 | Ga0207653_10002427 | Ga0207653_100024273 | 134 |
| 62 | 3300025905 | Ga0207685_10137365 | Ga0207685_101373651 | 134 |
| 63 | 3300025910 | Ga0207684_10010175 | Ga0207684_100101753 | 134 |
| 64 | 3300025910 | Ga0207684_10114708 | Ga0207684_101147082 | 134 |
| 65 | 3300025910 | Ga0207684_10291647 | Ga0207684_102916474 | 134 |
| 66 | 3300025915 | Ga0207693_10013161 | Ga0207693_100131616 | 134 |
| 67 | 3300025915 | Ga0207693_10115810 | Ga0207693_101158102 | 134 |
| 68 | 3300025922 | Ga0207646_10013824 | Ga0207646_100138245 | 134 |
| 69 | 3300025922 | Ga0207646_10026904 | Ga0207646_100269043 | 134 |
| 70 | 3300025922 | Ga0207646_10027191 | Ga0207646_100271917 | 134 |
| 71 | 3300025922 | Ga0207646_10123778 | Ga0207646_101237782 | 134 |
| 72 | 3300025922 | Ga0207646_10334694 | Ga0207646_103346942 | 134 |
| 73 | 3300025928 | Ga0207700_10003827 | Ga0207700_100038274 | 134 |
| 74 | 3300025929 | Ga0207664_10007423 | Ga0207664_100074235 | 134 |
| 75 | 3300025929 | Ga0207664_10253130 | Ga0207664_102531302 | 134 |
| 76 | 3300025939 | Ga0207665_10016024 | Ga0207665_100160243 | 134 |
| 77 | 3300025939 | Ga0207665_10763233 | Ga0207665_107632332 | 134 |
| 78 | 3300025944 | Ga0207661_10000910 | Ga0207661_100009103 | 134 |
| 79 | 3300026078 | Ga0207702_10018134 | Ga0207702_100181342 | 134 |
| 80 | 3300026078 | Ga0207702_10874148 | Ga0207702_108741482 | 134 |
| 81 | 3300026116 | Ga0207674_10002627 | Ga0207674_1000262712 | 134 |
| 82 | 3300027907 | Ga0207428_10463056 | Ga0207428_104630562 | 134 |
| 83 | 3300031901 | Ga0307406_12080911 | Ga0307406_120809111 | 134 |
| 84 | 3300035089 | Ga0373944_0148940 | Ga0373944_0148940_40_459 | 134 |
| 85 | 3300035114 | Ga0373939_0101818 | Ga0373939_0101818_111_518 | 134 |
| 86 | 3300035115 | Ga0373941_0257795 | Ga0373941_0257795_233_652 | 134 |
| 87 | 3300035170 | Ga0373943_0011516 | Ga0373943_0011516_1708_2127 | 134 |
| 88 | 3300035172 | Ga0373955_0064542 | Ga0373955_0064542_65_475 | 134 |
| 89 | 3300035691 | Ga0373931_0071700 | Ga0373931_0071700_428_835 | 134 |
| 90 | 3300035692 | Ga0373935_0769913 | Ga0373935_0769913_149_568 | 134 |
| 91 | 3300035695 | Ga0373927_0177637 | Ga0373927_0177637_387_806 | 134 |
| 92 | 3300035725 | Ga0373947_0290725 | Ga0373947_0290725_433_852 | 134 |
| 93 | 3300036401 | Ga0373937_1616910 | Ga0373937_1616910_112_522 | 134 |
| 94 | 3300041496 | Ga0451839_1328708 | Ga0451839_1328708_159_569 | 134 |
| 95 | 3300044684 | Ga0466966_0213154 | Ga0466966_0213154_490_897 | 134 |
| 96 | 3300047319 | Ga0495674_0225847 | Ga0495674_0225847_1025_1435 | 134 |
| 97 | 3300048912 | Ga0496109_0342696 | Ga0496109_0342696_60_479 | 134 |
| 98 | 3300048912 | Ga0496109_0410860 | Ga0496109_0410860_498_908 | 134 |
| 99 | 3300048913 | Ga0496110_0080123 | Ga0496110_0080123_1247_1657 | 134 |
| 100 | 3300048914 | Ga0496111_0851054 | Ga0496111_0851054_116_523 | 134 |
| 101 | 3300048915 | Ga0496112_0011876 | Ga0496112_0011876_7546_7956 | 134 |
| 102 | 3300048915 | Ga0496112_1507336 | Ga0496112_1507336_18_425 | 134 |
| 103 | 3300048918 | Ga0496115_0072359 | Ga0496115_0072359_1905_2312 | 134 |
| 104 | 3300048918 | Ga0496115_0209302 | Ga0496115_0209302_244_654 | 134 |
| 105 | 3300049569 | Ga0501032_0817353 | Ga0501032_0817353_29_436 | 134 |
| 106 | 3300049576 | Ga0501040_0079557 | Ga0501040_0079557_1305_1712 | 134 |
| 107 | 3300049583 | Ga0501067_0001495 | Ga0501067_0001495_1326_1733 | 134 |
| 108 | 3300049584 | Ga0501068_0151979 | Ga0501068_0151979_1000_1407 | 134 |
| 109 | 3300049585 | Ga0501069_0014678 | Ga0501069_0014678_3732_4139 | 134 |
| 110 | 3300049586 | Ga0501070_0072501 | Ga0501070_0072501_2152_2559 | 134 |
| 111 | 3300049586 | Ga0501070_0110047 | Ga0501070_0110047_475_885 | 134 |
| 112 | 3300049587 | Ga0501071_0028506 | Ga0501071_0028506_1501_1908 | 134 |
| 113 | 3300049587 | Ga0501071_0369603 | Ga0501071_0369603_533_940 | 134 |
| 114 | 3300049588 | Ga0501072_0073900 | Ga0501072_0073900_1566_1973 | 134 |
| 115 | 3300049591 | Ga0501075_0149397 | Ga0501075_0149397_29_436 | 134 |
| 116 | 3300049592 | Ga0501076_0135700 | Ga0501076_0135700_884_1291 | 134 |
| 117 | 3300049741 | Ga0501079_0173858 | Ga0501079_0173858_115_522 | 134 |
| 118 | 3300049822 | Ga0501035_0142670 | Ga0501035_0142670_1285_1692 | 134 |
| 119 | 3300049824 | Ga0501045_0254066 | Ga0501045_0254066_611_1018 | 134 |
| 120 | 3300049824 | Ga0501045_0400265 | Ga0501045_0400265_336_749 | 134 |
| 121 | 3300050507 | nmdc:mga05p37_1070541_c1 | nmdc:mga05p37_1070541_c1_177_590 | 134 |
| 122 | 3300050507 | nmdc:mga05p37_452536_c1 | nmdc:mga05p37_452536_c1_797_1204 | 134 |
| 123 | 3300050511 | nmdc:mga08y16_828933_c1 | nmdc:mga08y16_828933_c1_104_511 | 134 |
| 124 | 3300050513 | nmdc:mga0rr50_23893_c1 | nmdc:mga0rr50_23893_c1_828_1247 | 134 |
| 125 | 3300050514 | nmdc:mga08x19_24964_c1 | nmdc:mga08x19_24964_c1_1089_1508 | 134 |
| 126 | 3300054114 | Ga0501084_1041254 | Ga0501084_1041254_135_542 | 134 |
| 127 | 3300060353 | Ga0501082_0351601 | Ga0501082_0351601_723_1130 | 134 |
| 128 | 3300060353 | Ga0501082_0865154 | Ga0501082_0865154_218_628 | 134 |
| 129 | 3300005333 | Ga0070677_10455320 | Ga0070677_104553202 | 135 |
| 130 | 3300005353 | Ga0070669_100039045 | Ga0070669_1000390453 | 135 |
| 131 | 3300005364 | Ga0070673_100027314 | Ga0070673_1000273142 | 135 |
| 132 | 3300005406 | Ga0070703_10001944 | Ga0070703_100019445 | 135 |
| 133 | 3300005440 | Ga0070705_100010996 | Ga0070705_1000109962 | 135 |
| 134 | 3300005440 | Ga0070705_100620152 | Ga0070705_1006201521 | 135 |
| 135 | 3300005444 | Ga0070694_100281082 | Ga0070694_1002810822 | 135 |
| 136 | 3300005444 | Ga0070694_100980321 | Ga0070694_1009803211 | 135 |
| 137 | 3300005445 | Ga0070708_100002804 | Ga0070708_1000028049 | 135 |
| 138 | 3300005445 | Ga0070708_100013053 | Ga0070708_1000130533 | 135 |
| 139 | 3300005445 | Ga0070708_100733277 | Ga0070708_1007332771 | 135 |
| 140 | 3300005467 | Ga0070706_100005221 | Ga0070706_10000522110 | 135 |
| 141 | 3300005467 | Ga0070706_100016058 | Ga0070706_1000160582 | 135 |
| 142 | 3300005467 | Ga0070706_100143831 | Ga0070706_1001438312 | 135 |
| 143 | 3300005468 | Ga0070707_100015809 | Ga0070707_1000158096 | 135 |
| 144 | 3300005468 | Ga0070707_100156572 | Ga0070707_1001565722 | 135 |
| 145 | 3300005468 | Ga0070707_100696153 | Ga0070707_1006961531 | 135 |
| 146 | 3300005471 | Ga0070698_100001689 | Ga0070698_1000016899 | 135 |
| 147 | 3300005471 | Ga0070698_100066915 | Ga0070698_1000669152 | 135 |
| 148 | 3300005471 | Ga0070698_100099359 | Ga0070698_1000993592 | 135 |
| 149 | 3300005518 | Ga0070699_100001430 | Ga0070699_1000014307 | 135 |
| 150 | 3300005518 | Ga0070699_100009254 | Ga0070699_1000092549 | 135 |
| 151 | 3300005518 | Ga0070699_100049616 | Ga0070699_1000496162 | 135 |
| 152 | 3300005518 | Ga0070699_100178956 | Ga0070699_1001789562 | 135 |
| 153 | 3300005518 | Ga0070699_100496192 | Ga0070699_1004961922 | 135 |
| 154 | 3300005536 | Ga0070697_100000579 | Ga0070697_1000005794 | 135 |
| 155 | 3300005536 | Ga0070697_100012474 | Ga0070697_1000124744 | 135 |
| 156 | 3300005536 | Ga0070697_100014356 | Ga0070697_1000143564 | 135 |
| 157 | 3300005536 | Ga0070697_100090386 | Ga0070697_1000903862 | 135 |
| 158 | 3300005536 | Ga0070697_100237069 | Ga0070697_1002370692 | 135 |
| 159 | 3300005545 | Ga0070695_100000192 | Ga0070695_10000019237 | 135 |
| 160 | 3300005545 | Ga0070695_100314009 | Ga0070695_1003140092 | 135 |
| 161 | 3300005545 | Ga0070695_101453332 | Ga0070695_1014533321 | 135 |
| 162 | 3300005546 | Ga0070696_100099763 | Ga0070696_1000997632 | 135 |
| 163 | 3300005546 | Ga0070696_100206696 | Ga0070696_1002066962 | 135 |
| 164 | 3300005546 | Ga0070696_100225059 | Ga0070696_1002250592 | 135 |
| 165 | 3300005578 | Ga0068854_100198117 | Ga0068854_1001981173 | 135 |
| 166 | 3300005615 | Ga0070702_100038006 | Ga0070702_1000380061 | 135 |
| 167 | 3300006028 | Ga0070717_10011531 | Ga0070717_100115312 | 135 |
| 168 | 3300006028 | Ga0070717_10574274 | Ga0070717_105742742 | 135 |
| 169 | 3300006163 | Ga0070715_10055704 | Ga0070715_100557042 | 135 |
| 170 | 3300006173 | Ga0070716_100018989 | Ga0070716_1000189896 | 135 |
| 171 | 3300006175 | Ga0070712_100681585 | Ga0070712_1006815852 | 135 |
| 172 | 3300006237 | Ga0097621_100152185 | Ga0097621_1001521852 | 135 |
| 173 | 3300006852 | Ga0075433_10020684 | Ga0075433_100206846 | 135 |
| 174 | 3300006852 | Ga0075433_10026432 | Ga0075433_100264321 | 135 |
| 175 | 3300006852 | Ga0075433_10044720 | Ga0075433_100447202 | 135 |
| 176 | 3300006852 | Ga0075433_10165317 | Ga0075433_101653172 | 135 |
| 177 | 3300006871 | Ga0075434_100056859 | Ga0075434_1000568596 | 135 |
| 178 | 3300006871 | Ga0075434_100114131 | Ga0075434_1001141313 | 135 |
| 179 | 3300006871 | Ga0075434_101051893 | Ga0075434_1010518931 | 135 |
| 180 | 3300006914 | Ga0075436_100020611 | Ga0075436_1000206112 | 135 |
| 181 | 3300006914 | Ga0075436_100039187 | Ga0075436_1000391873 | 135 |
| 182 | 3300006914 | Ga0075436_100079795 | Ga0075436_1000797952 | 135 |
| 183 | 3300006914 | Ga0075436_100146213 | Ga0075436_1001462132 | 135 |
| 184 | 3300006914 | Ga0075436_100377282 | Ga0075436_1003772822 | 135 |
| 185 | 3300007076 | Ga0075435_100053369 | Ga0075435_1000533694 | 135 |
| 186 | 3300007076 | Ga0075435_100148552 | Ga0075435_1001485522 | 135 |
| 187 | 3300007076 | Ga0075435_100259785 | Ga0075435_1002597852 | 135 |
| 188 | 3300007076 | Ga0075435_100613831 | Ga0075435_1006138312 | 135 |
| 189 | 3300009147 | Ga0114129_10166399 | Ga0114129_101663994 | 135 |
| 190 | 3300009147 | Ga0114129_10332883 | Ga0114129_103328832 | 135 |
| 191 | 3300009147 | Ga0114129_10703641 | Ga0114129_107036412 | 135 |
| 192 | 3300010159 | Ga0099796_10051647 | Ga0099796_100516472 | 135 |
| 193 | 3300011119 | Ga0105246_10110617 | Ga0105246_101106172 | 135 |
| 194 | 3300013307 | Ga0157372_10032114 | Ga0157372_100321142 | 135 |
| 195 | 3300025885 | Ga0207653_10001098 | Ga0207653_100010984 | 135 |
| 196 | 3300025906 | Ga0207699_10176956 | Ga0207699_101769562 | 135 |
| 197 | 3300025910 | Ga0207684_10000035 | Ga0207684_10000035120 | 135 |
| 198 | 3300025910 | Ga0207684_10006721 | Ga0207684_100067214 | 135 |
| 199 | 3300025910 | Ga0207684_10242639 | Ga0207684_102426392 | 135 |
| 200 | 3300025915 | Ga0207693_11147283 | Ga0207693_111472832 | 135 |
| 201 | 3300025916 | Ga0207663_10037521 | Ga0207663_100375213 | 135 |
| 202 | 3300025922 | Ga0207646_10000127 | Ga0207646_1000012780 | 135 |
| 203 | 3300025922 | Ga0207646_10054273 | Ga0207646_100542732 | 135 |
| 204 | 3300025922 | Ga0207646_10078842 | Ga0207646_100788422 | 135 |
| 205 | 3300025922 | Ga0207646_10123585 | Ga0207646_101235852 | 135 |
| 206 | 3300025922 | Ga0207646_10442863 | Ga0207646_104428631 | 135 |
| 207 | 3300025929 | Ga0207664_10066742 | Ga0207664_100667423 | 135 |
| 208 | 3300025929 | Ga0207664_10158478 | Ga0207664_101584782 | 135 |
| 209 | 3300025939 | Ga0207665_10000261 | Ga0207665_1000026133 | 135 |
| 210 | 3300025949 | Ga0207667_10874410 | Ga0207667_108744102 | 135 |
| 211 | 3300027395 | Ga0209996_1004023 | Ga0209996_10040232 | 135 |
| 212 | 3300027526 | Ga0209968_1001059 | Ga0209968_10010594 | 135 |
| 213 | 3300027614 | Ga0209970_1005879 | Ga0209970_10058792 | 135 |
| 214 | 3300027682 | Ga0209971_1000030 | Ga0209971_100003025 | 135 |
| 215 | 3300027695 | Ga0209966_1000518 | Ga0209966_10005189 | 135 |
| 216 | 3300027717 | Ga0209998_10000007 | Ga0209998_1000000795 | 135 |
| 217 | 3300027876 | Ga0209974_10005666 | Ga0209974_100056661 | 135 |
| 218 | 3300035088 | Ga0373940_0168555 | Ga0373940_0168555_280_690 | 135 |
| 219 | 3300035088 | Ga0373940_0181411 | Ga0373940_0181411_48_458 | 135 |
| 220 | 3300035090 | Ga0373949_0102571 | Ga0373949_0102571_269_679 | 135 |
| 221 | 3300035091 | Ga0373951_0005575 | Ga0373951_0005575_2057_2467 | 135 |
| 222 | 3300035115 | Ga0373941_0069242 | Ga0373941_0069242_655_1065 | 135 |
| 223 | 3300035241 | Ga0373961_0196905 | Ga0373961_0196905_42_452 | 135 |
| 224 | 3300035691 | Ga0373931_0030828 | Ga0373931_0030828_1257_1667 | 135 |
| 225 | 3300035725 | Ga0373947_0018173 | Ga0373947_0018173_865_1278 | 135 |
| 226 | 3300038996 | Ga0242420_128848 | Ga0242420_128848_73_486 | 135 |
| 227 | 3300042008 | Ga0439450_005787 | Ga0439450_005787_593_1018 | 135 |
| 228 | 3300042012 | Ga0439455_0029996 | Ga0439455_0029996_869_1294 | 135 |
| 229 | 3300042461 | Ga0439460_0000543 | Ga0439460_0000543_3893_4318 | 135 |
| 230 | 3300042876 | Ga0451577_0099946 | Ga0451577_0099946_1740_2165 | 135 |
| 231 | 3300042876 | Ga0451577_0284121 | Ga0451577_0284121_11_421 | 135 |
| 232 | 3300044656 | Ga0466969_0385503 | Ga0466969_0385503_95_505 | 135 |
| 233 | 3300045051 | Ga0451576_0006733 | Ga0451576_0006733_6257_6667 | 135 |
| 234 | 3300045051 | Ga0451576_0181980 | Ga0451576_0181980_447_872 | 135 |
| 235 | 3300048918 | Ga0496115_0005310 | Ga0496115_0005310_3219_3629 | 135 |
| 236 | 3300049572 | Ga0501036_0050972 | Ga0501036_0050972_1201_1626 | 135 |
| 237 | 3300049575 | Ga0501039_0045196 | Ga0501039_0045196_535_960 | 135 |
| 238 | 3300049576 | Ga0501040_0037643 | Ga0501040_0037643_1824_2249 | 135 |
| 239 | 3300049577 | Ga0501041_0003130 | Ga0501041_0003130_1908_2333 | 135 |
| 240 | 3300049578 | Ga0501042_0162834 | Ga0501042_0162834_982_1407 | 135 |
| 241 | 3300049579 | Ga0501043_0024003 | Ga0501043_0024003_982_1407 | 135 |
| 242 | 3300049580 | Ga0501046_0001249 | Ga0501046_0001249_20341_20766 | 135 |
| 243 | 3300049581 | Ga0501047_0161380 | Ga0501047_0161380_1230_1655 | 135 |
| 244 | 3300049582 | Ga0501048_0001345 | Ga0501048_0001345_2582_3007 | 135 |
| 245 | 3300049583 | Ga0501067_0013578 | Ga0501067_0013578_1603_2013 | 135 |
| 246 | 3300049583 | Ga0501067_0252487 | Ga0501067_0252487_527_940 | 135 |
| 247 | 3300049586 | Ga0501070_1183212 | Ga0501070_1183212_19_429 | 135 |
| 248 | 3300049591 | Ga0501075_0059316 | Ga0501075_0059316_649_1074 | 135 |
| 249 | 3300049592 | Ga0501076_0008426 | Ga0501076_0008426_6452_6877 | 135 |
| 250 | 3300049593 | Ga0501077_0195330 | Ga0501077_0195330_704_1129 | 135 |
| 251 | 3300049741 | Ga0501079_0000310 | Ga0501079_0000310_20645_21070 | 135 |
| 252 | 3300049742 | Ga0501080_1053134 | Ga0501080_1053134_17_442 | 135 |
| 253 | 3300049744 | Ga0501083_0053862 | Ga0501083_0053862_768_1193 | 135 |
| 254 | 3300049824 | Ga0501045_0014624 | Ga0501045_0014624_4630_5055 | 135 |
| 255 | 3300050507 | nmdc:mga05p37_2019013_c1 | nmdc:mga05p37_2019013_c1_44_460 | 135 |
| 256 | 3300050507 | nmdc:mga05p37_310687_c1 | nmdc:mga05p37_310687_c1_927_1340 | 135 |
| 257 | 3300050507 | nmdc:mga05p37_578129_c1 | nmdc:mga05p37_578129_c1_285_695 | 135 |
| 258 | 3300050507 | nmdc:mga05p37_85663_c1 | nmdc:mga05p37_85663_c1_1399_1815 | 135 |
| 259 | 3300050510 | nmdc:mga06r32_602979_c1 | nmdc:mga06r32_602979_c1_448_858 | 135 |
| 260 | 3300050512 | nmdc:mga0n895_1664_c1 | nmdc:mga0n895_1664_c1_7084_7500 | 135 |
| 261 | 3300050512 | nmdc:mga0n895_252472_c1 | nmdc:mga0n895_252472_c1_896_1309 | 135 |
| 262 | 3300050513 | nmdc:mga0rr50_122419_c1 | nmdc:mga0rr50_122419_c1_138_554 | 135 |
| 263 | 3300050513 | nmdc:mga0rr50_1406211_c1 | nmdc:mga0rr50_1406211_c1_74_487 | 135 |
| 264 | 3300050513 | nmdc:mga0rr50_15743_c1 | nmdc:mga0rr50_15743_c1_2517_2933 | 135 |
| 265 | 3300050513 | nmdc:mga0rr50_429964_c1 | nmdc:mga0rr50_429964_c1_272_685 | 135 |
| 266 | 3300050513 | nmdc:mga0rr50_51456_c1 | nmdc:mga0rr50_51456_c1_311_724 | 135 |
| 267 | 3300050513 | nmdc:mga0rr50_67274_c1 | nmdc:mga0rr50_67274_c1_1241_1651 | 135 |
| 268 | 3300050514 | nmdc:mga08x19_1079941_c1 | nmdc:mga08x19_1079941_c1_31_441 | 135 |
| 269 | 3300050514 | nmdc:mga08x19_130868_c1 | nmdc:mga08x19_130868_c1_975_1388 | 135 |
| 270 | 3300050514 | nmdc:mga08x19_199904_c1 | nmdc:mga08x19_199904_c1_366_779 | 135 |
| 271 | 3300050514 | nmdc:mga08x19_233064_c1 | nmdc:mga08x19_233064_c1_257_673 | 135 |
| 272 | 3300050514 | nmdc:mga08x19_24742_c1 | nmdc:mga08x19_24742_c1_145_558 | 135 |
| 273 | 3300050514 | nmdc:mga08x19_50929_c1 | nmdc:mga08x19_50929_c1_1269_1685 | 135 |
| 274 | 3300050514 | nmdc:mga08x19_571175_c1 | nmdc:mga08x19_571175_c1_122_538 | 135 |
| 275 | 3300050515 | nmdc:mga0a205_127397_c1 | nmdc:mga0a205_127397_c1_704_1117 | 135 |
| 276 | 3300050515 | nmdc:mga0a205_2400_c1 | nmdc:mga0a205_2400_c1_8420_8836 | 135 |
| 277 | 3300050515 | nmdc:mga0a205_73463_c1 | nmdc:mga0a205_73463_c1_1207_1617 | 135 |
| 278 | 3300054114 | Ga0501084_0001384 | Ga0501084_0001384_3790_4215 | 135 |
| 279 | 3300060353 | Ga0501082_0001189 | Ga0501082_0001189_19692_20117 | 135 |
| 280 | 3300061734 | Ga0530510_0054996 | Ga0530510_0054996_1295_1720 | 135 |
| 281 | 3300005295 | Ga0065707_10574066 | Ga0065707_105740662 | 136 |
| 282 | 3300005328 | Ga0070676_10000556 | Ga0070676_100005569 | 136 |
| 283 | 3300005329 | Ga0070683_100002327 | Ga0070683_1000023273 | 136 |
| 284 | 3300005330 | Ga0070690_100115282 | Ga0070690_1001152822 | 136 |
| 285 | 3300005330 | Ga0070690_100123765 | Ga0070690_1001237652 | 136 |
| 286 | 3300005331 | Ga0070670_100000596 | Ga0070670_10000059624 | 136 |
| 287 | 3300005334 | Ga0068869_100000184 | Ga0068869_10000018424 | 136 |
| 288 | 3300005336 | Ga0070680_100001624 | Ga0070680_1000016248 | 136 |
| 289 | 3300005336 | Ga0070680_100801680 | Ga0070680_1008016801 | 136 |
| 290 | 3300005337 | Ga0070682_100000464 | Ga0070682_10000046415 | 136 |
| 291 | 3300005339 | Ga0070660_100001374 | Ga0070660_10000137414 | 136 |
| 292 | 3300005340 | Ga0070689_100034790 | Ga0070689_1000347902 | 136 |
| 293 | 3300005340 | Ga0070689_100922031 | Ga0070689_1009220311 | 136 |
| 294 | 3300005341 | Ga0070691_10002084 | Ga0070691_100020845 | 136 |
| 295 | 3300005341 | Ga0070691_10004600 | Ga0070691_100046003 | 136 |
| 296 | 3300005343 | Ga0070687_100018422 | Ga0070687_1000184223 | 136 |
| 297 | 3300005344 | Ga0070661_100001302 | Ga0070661_10000130211 | 136 |
| 298 | 3300005345 | Ga0070692_10000199 | Ga0070692_1000019915 | 136 |
| 299 | 3300005345 | Ga0070692_10904004 | Ga0070692_109040042 | 136 |
| 300 | 3300005353 | Ga0070669_100436615 | Ga0070669_1004366153 | 136 |
| 301 | 3300005355 | Ga0070671_100060257 | Ga0070671_1000602571 | 136 |
| 302 | 3300005356 | Ga0070674_101872252 | Ga0070674_1018722521 | 136 |
| 303 | 3300005364 | Ga0070673_100631331 | Ga0070673_1006313312 | 136 |
| 304 | 3300005366 | Ga0070659_100001042 | Ga0070659_10000104214 | 136 |
| 305 | 3300005366 | Ga0070659_100592164 | Ga0070659_1005921642 | 136 |
| 306 | 3300005367 | Ga0070667_100030788 | Ga0070667_1000307882 | 136 |
| 307 | 3300005406 | Ga0070703_10000802 | Ga0070703_1000080210 | 136 |
| 308 | 3300005435 | Ga0070714_100003311 | Ga0070714_1000033117 | 136 |
| 309 | 3300005436 | Ga0070713_100004314 | Ga0070713_1000043142 | 136 |
| 310 | 3300005439 | Ga0070711_100042880 | Ga0070711_1000428801 | 136 |
| 311 | 3300005440 | Ga0070705_100000716 | Ga0070705_10000071622 | 136 |
| 312 | 3300005440 | Ga0070705_100120293 | Ga0070705_1001202933 | 136 |
| 313 | 3300005441 | Ga0070700_100027826 | Ga0070700_1000278263 | 136 |
| 314 | 3300005444 | Ga0070694_100001937 | Ga0070694_10000193713 | 136 |
| 315 | 3300005444 | Ga0070694_100024552 | Ga0070694_1000245524 | 136 |
| 316 | 3300005444 | Ga0070694_100120095 | Ga0070694_1001200952 | 136 |
| 317 | 3300005445 | Ga0070708_100000368 | Ga0070708_1000003683 | 136 |
| 318 | 3300005445 | Ga0070708_100051653 | Ga0070708_1000516532 | 136 |
| 319 | 3300005445 | Ga0070708_100097046 | Ga0070708_1000970463 | 136 |
| 320 | 3300005445 | Ga0070708_100221248 | Ga0070708_1002212484 | 136 |
| 321 | 3300005445 | Ga0070708_100340495 | Ga0070708_1003404952 | 136 |
| 322 | 3300005445 | Ga0070708_100710370 | Ga0070708_1007103702 | 136 |
| 323 | 3300005445 | Ga0070708_101282398 | Ga0070708_1012823982 | 136 |
| 324 | 3300005455 | Ga0070663_100010115 | Ga0070663_1000101154 | 136 |
| 325 | 3300005455 | Ga0070663_100475233 | Ga0070663_1004752332 | 136 |
| 326 | 3300005455 | Ga0070663_101056515 | Ga0070663_1010565152 | 136 |
| 327 | 3300005457 | Ga0070662_100002733 | Ga0070662_1000027332 | 136 |
| 328 | 3300005457 | Ga0070662_101722853 | Ga0070662_1017228531 | 136 |
| 329 | 3300005458 | Ga0070681_10047084 | Ga0070681_100470843 | 136 |
| 330 | 3300005458 | Ga0070681_10060061 | Ga0070681_100600612 | 136 |
| 331 | 3300005458 | Ga0070681_10077633 | Ga0070681_100776332 | 136 |
| 332 | 3300005458 | Ga0070681_10166333 | Ga0070681_101663332 | 136 |
| 333 | 3300005458 | Ga0070681_10627132 | Ga0070681_106271321 | 136 |
| 334 | 3300005459 | Ga0068867_100002240 | Ga0068867_1000022408 | 136 |
| 335 | 3300005459 | Ga0068867_100862199 | Ga0068867_1008621992 | 136 |
| 336 | 3300005467 | Ga0070706_100003203 | Ga0070706_1000032037 | 136 |
| 337 | 3300005467 | Ga0070706_100005074 | Ga0070706_10000507410 | 136 |
| 338 | 3300005467 | Ga0070706_100055418 | Ga0070706_1000554184 | 136 |
| 339 | 3300005467 | Ga0070706_100089033 | Ga0070706_1000890332 | 136 |
| 340 | 3300005467 | Ga0070706_101099382 | Ga0070706_1010993822 | 136 |
| 341 | 3300005467 | Ga0070706_101633440 | Ga0070706_1016334401 | 136 |
| 342 | 3300005468 | Ga0070707_100000912 | Ga0070707_1000009124 | 136 |
| 343 | 3300005468 | Ga0070707_100193001 | Ga0070707_1001930012 | 136 |
| 344 | 3300005468 | Ga0070707_100219835 | Ga0070707_1002198352 | 136 |
| 345 | 3300005468 | Ga0070707_100430473 | Ga0070707_1004304731 | 136 |
| 346 | 3300005468 | Ga0070707_100518972 | Ga0070707_1005189722 | 136 |
| 347 | 3300005468 | Ga0070707_101672486 | Ga0070707_1016724861 | 136 |
| 348 | 3300005471 | Ga0070698_100000003 | Ga0070698_10000000363 | 136 |
| 349 | 3300005471 | Ga0070698_100033653 | Ga0070698_1000336534 | 136 |
| 350 | 3300005471 | Ga0070698_100047579 | Ga0070698_1000475792 | 136 |
| 351 | 3300005471 | Ga0070698_100081139 | Ga0070698_1000811392 | 136 |
| 352 | 3300005471 | Ga0070698_100428821 | Ga0070698_1004288212 | 136 |
| 353 | 3300005471 | Ga0070698_100744529 | Ga0070698_1007445292 | 136 |
| 354 | 3300005518 | Ga0070699_100017005 | Ga0070699_1000170054 | 136 |
| 355 | 3300005518 | Ga0070699_100017391 | Ga0070699_1000173912 | 136 |
| 356 | 3300005518 | Ga0070699_100042912 | Ga0070699_1000429124 | 136 |
| 357 | 3300005518 | Ga0070699_100138833 | Ga0070699_1001388333 | 136 |
| 358 | 3300005518 | Ga0070699_100302615 | Ga0070699_1003026152 | 136 |
| 359 | 3300005518 | Ga0070699_100694096 | Ga0070699_1006940961 | 136 |
| 360 | 3300005530 | Ga0070679_100000337 | Ga0070679_1000003375 | 136 |
| 361 | 3300005530 | Ga0070679_100026242 | Ga0070679_1000262424 | 136 |
| 362 | 3300005530 | Ga0070679_100057425 | Ga0070679_1000574253 | 136 |
| 363 | 3300005535 | Ga0070684_100100994 | Ga0070684_1001009942 | 136 |
| 364 | 3300005535 | Ga0070684_100119059 | Ga0070684_1001190593 | 136 |
| 365 | 3300005536 | Ga0070697_100018374 | Ga0070697_1000183745 | 136 |
| 366 | 3300005539 | Ga0068853_100000111 | Ga0068853_10000011155 | 136 |
| 367 | 3300005539 | Ga0068853_100264821 | Ga0068853_1002648211 | 136 |
| 368 | 3300005544 | Ga0070686_100505165 | Ga0070686_1005051652 | 136 |
| 369 | 3300005545 | Ga0070695_100000344 | Ga0070695_10000034421 | 136 |
| 370 | 3300005545 | Ga0070695_100023894 | Ga0070695_1000238944 | 136 |
| 371 | 3300005546 | Ga0070696_100004178 | Ga0070696_1000041783 | 136 |
| 372 | 3300005546 | Ga0070696_100525269 | Ga0070696_1005252692 | 136 |
| 373 | 3300005547 | Ga0070693_100000173 | Ga0070693_10000017327 | 136 |
| 374 | 3300005549 | Ga0070704_100001677 | Ga0070704_1000016777 | 136 |
| 375 | 3300005549 | Ga0070704_100138287 | Ga0070704_1001382874 | 136 |
| 376 | 3300005563 | Ga0068855_100000219 | Ga0068855_10000021974 | 136 |
| 377 | 3300005563 | Ga0068855_100029103 | Ga0068855_1000291035 | 136 |
| 378 | 3300005564 | Ga0070664_100001899 | Ga0070664_1000018998 | 136 |
| 379 | 3300005564 | Ga0070664_100260426 | Ga0070664_1002604262 | 136 |
| 380 | 3300005577 | Ga0068857_100001268 | Ga0068857_1000012688 | 136 |
| 381 | 3300005577 | Ga0068857_100015971 | Ga0068857_1000159712 | 136 |
| 382 | 3300005577 | Ga0068857_100254421 | Ga0068857_1002544213 | 136 |
| 383 | 3300005577 | Ga0068857_100295862 | Ga0068857_1002958622 | 136 |
| 384 | 3300005578 | Ga0068854_100000800 | Ga0068854_10000080014 | 136 |
| 385 | 3300005578 | Ga0068854_101075876 | Ga0068854_1010758762 | 136 |
| 386 | 3300005614 | Ga0068856_100003539 | Ga0068856_1000035395 | 136 |
| 387 | 3300005614 | Ga0068856_100006383 | Ga0068856_1000063832 | 136 |
| 388 | 3300005614 | Ga0068856_100683891 | Ga0068856_1006838912 | 136 |
| 389 | 3300005616 | Ga0068852_100009459 | Ga0068852_1000094596 | 136 |
| 390 | 3300005617 | Ga0068859_100004490 | Ga0068859_10000449014 | 136 |
| 391 | 3300005617 | Ga0068859_100129394 | Ga0068859_1001293942 | 136 |
| 392 | 3300005617 | Ga0068859_100379301 | Ga0068859_1003793012 | 136 |
| 393 | 3300005617 | Ga0068859_100937593 | Ga0068859_1009375932 | 136 |
| 394 | 3300005618 | Ga0068864_100142633 | Ga0068864_1001426332 | 136 |
| 395 | 3300005618 | Ga0068864_100247577 | Ga0068864_1002475772 | 136 |
| 396 | 3300005618 | Ga0068864_100305042 | Ga0068864_1003050422 | 136 |
| 397 | 3300005719 | Ga0068861_100001718 | Ga0068861_10000171813 | 136 |
| 398 | 3300005834 | Ga0068851_10404805 | Ga0068851_104048051 | 136 |
| 399 | 3300005840 | Ga0068870_10000173 | Ga0068870_1000017314 | 136 |
| 400 | 3300005842 | Ga0068858_100018563 | Ga0068858_1000185633 | 136 |
| 401 | 3300005843 | Ga0068860_100010782 | Ga0068860_1000107822 | 136 |
| 402 | 3300005843 | Ga0068860_100137747 | Ga0068860_1001377473 | 136 |
| 403 | 3300005844 | Ga0068862_100000611 | Ga0068862_10000061121 | 136 |
| 404 | 3300006028 | Ga0070717_10000681 | Ga0070717_1000068117 | 136 |
| 405 | 3300006028 | Ga0070717_10001530 | Ga0070717_100015307 | 136 |
| 406 | 3300006028 | Ga0070717_10669980 | Ga0070717_106699802 | 136 |
| 407 | 3300006163 | Ga0070715_10155727 | Ga0070715_101557272 | 136 |
| 408 | 3300006173 | Ga0070716_100281302 | Ga0070716_1002813022 | 136 |
| 409 | 3300006175 | Ga0070712_100367042 | Ga0070712_1003670421 | 136 |
| 410 | 3300006358 | Ga0068871_100034860 | Ga0068871_1000348604 | 136 |
| 411 | 3300006844 | Ga0075428_100414122 | Ga0075428_1004141222 | 136 |
| 412 | 3300006846 | Ga0075430_101099253 | Ga0075430_1010992532 | 136 |
| 413 | 3300006847 | Ga0075431_100024903 | Ga0075431_1000249034 | 136 |
| 414 | 3300006847 | Ga0075431_101198146 | Ga0075431_1011981462 | 136 |
| 415 | 3300006847 | Ga0075431_101659824 | Ga0075431_1016598242 | 136 |
| 416 | 3300006852 | Ga0075433_10013373 | Ga0075433_100133733 | 136 |
| 417 | 3300006852 | Ga0075433_10037423 | Ga0075433_100374237 | 136 |
| 418 | 3300006871 | Ga0075434_100126322 | Ga0075434_1001263222 | 136 |
| 419 | 3300006871 | Ga0075434_100328435 | Ga0075434_1003284352 | 136 |
| 420 | 3300006880 | Ga0075429_100001122 | Ga0075429_10000112211 | 136 |
| 421 | 3300006914 | Ga0075436_100010351 | Ga0075436_10001035111 | 136 |
| 422 | 3300006914 | Ga0075436_100051093 | Ga0075436_1000510934 | 136 |
| 423 | 3300006914 | Ga0075436_100224672 | Ga0075436_1002246722 | 136 |
| 424 | 3300006931 | Ga0097620_100004490 | Ga0097620_10000449014 | 136 |
| 425 | 3300006931 | Ga0097620_100129395 | Ga0097620_1001293952 | 136 |
| 426 | 3300006931 | Ga0097620_100379307 | Ga0097620_1003793072 | 136 |
| 427 | 3300006931 | Ga0097620_100937562 | Ga0097620_1009375622 | 136 |
| 428 | 3300007076 | Ga0075435_100011096 | Ga0075435_1000110962 | 136 |
| 429 | 3300007076 | Ga0075435_100027776 | Ga0075435_1000277762 | 136 |
| 430 | 3300007076 | Ga0075435_100063261 | Ga0075435_1000632613 | 136 |
| 431 | 3300009098 | Ga0105245_10449198 | Ga0105245_104491982 | 136 |
| 432 | 3300009101 | Ga0105247_10365609 | Ga0105247_103656092 | 136 |
| 433 | 3300009147 | Ga0114129_10009751 | Ga0114129_100097519 | 136 |
| 434 | 3300009147 | Ga0114129_10566308 | Ga0114129_105663082 | 136 |
| 435 | 3300009147 | Ga0114129_11079641 | Ga0114129_110796412 | 136 |
| 436 | 3300009148 | Ga0105243_10371785 | Ga0105243_103717853 | 136 |
| 437 | 3300009148 | Ga0105243_11014962 | Ga0105243_110149622 | 136 |
| 438 | 3300009174 | Ga0105241_10000394 | Ga0105241_100003942 | 136 |
| 439 | 3300009174 | Ga0105241_10621389 | Ga0105241_106213892 | 136 |
| 440 | 3300009174 | Ga0105241_10986923 | Ga0105241_109869232 | 136 |
| 441 | 3300009176 | Ga0105242_10189718 | Ga0105242_101897182 | 136 |
| 442 | 3300009177 | Ga0105248_10177030 | Ga0105248_101770304 | 136 |
| 443 | 3300009545 | Ga0105237_10004386 | Ga0105237_1000438611 | 136 |
| 444 | 3300009545 | Ga0105237_10101218 | Ga0105237_101012184 | 136 |
| 445 | 3300009551 | Ga0105238_10230934 | Ga0105238_102309343 | 136 |
| 446 | 3300009551 | Ga0105238_11376319 | Ga0105238_113763192 | 136 |
| 447 | 3300009553 | Ga0105249_10396233 | Ga0105249_103962331 | 136 |
| 448 | 3300010375 | Ga0105239_10816112 | Ga0105239_108161122 | 136 |
| 449 | 3300013100 | Ga0157373_10000051 | Ga0157373_1000005180 | 136 |
| 450 | 3300013100 | Ga0157373_10185371 | Ga0157373_101853712 | 136 |
| 451 | 3300013102 | Ga0157371_10307315 | Ga0157371_103073152 | 136 |
| 452 | 3300013104 | Ga0157370_10371724 | Ga0157370_103717242 | 136 |
| 453 | 3300013105 | Ga0157369_10025725 | Ga0157369_100257252 | 136 |
| 454 | 3300013306 | Ga0163162_10389334 | Ga0163162_103893342 | 136 |
| 455 | 3300013306 | Ga0163162_11098915 | Ga0163162_110989152 | 136 |
| 456 | 3300013307 | Ga0157372_10001083 | Ga0157372_1000108324 | 136 |
| 457 | 3300013307 | Ga0157372_12343289 | Ga0157372_123432891 | 136 |
| 458 | 3300014325 | Ga0163163_10062290 | Ga0163163_100622904 | 136 |
| 459 | 3300014745 | Ga0157377_10041102 | Ga0157377_100411022 | 136 |
| 460 | 3300014968 | Ga0157379_10244762 | Ga0157379_102447622 | 136 |
| 461 | 3300015262 | Ga0182007_10029010 | Ga0182007_100290102 | 136 |
| 462 | 3300017792 | Ga0163161_10439200 | Ga0163161_104392001 | 136 |
| 463 | 3300020080 | Ga0206350_10295288 | Ga0206350_102952881 | 136 |
| 464 | 3300020080 | Ga0206350_10646724 | Ga0206350_106467241 | 136 |
| 465 | 3300020610 | Ga0154015_1169539 | Ga0154015_11695392 | 136 |
| 466 | 3300020610 | Ga0154015_1662471 | Ga0154015_16624711 | 136 |
| 467 | 3300022467 | Ga0224712_10010958 | Ga0224712_100109583 | 136 |
| 468 | 3300025885 | Ga0207653_10000824 | Ga0207653_1000082410 | 136 |
| 469 | 3300025900 | Ga0207710_10075550 | Ga0207710_100755502 | 136 |
| 470 | 3300025903 | Ga0207680_10149862 | Ga0207680_101498622 | 136 |
| 471 | 3300025904 | Ga0207647_10136191 | Ga0207647_101361912 | 136 |
| 472 | 3300025907 | Ga0207645_10000062 | Ga0207645_1000006243 | 136 |
| 473 | 3300025907 | Ga0207645_10229836 | Ga0207645_102298362 | 136 |
| 474 | 3300025908 | Ga0207643_10000219 | Ga0207643_100002198 | 136 |
| 475 | 3300025909 | Ga0207705_10792929 | Ga0207705_107929291 | 136 |
| 476 | 3300025910 | Ga0207684_10005095 | Ga0207684_1000509512 | 136 |
| 477 | 3300025910 | Ga0207684_10005357 | Ga0207684_100053577 | 136 |
| 478 | 3300025910 | Ga0207684_10013567 | Ga0207684_100135673 | 136 |
| 479 | 3300025910 | Ga0207684_10051786 | Ga0207684_100517863 | 136 |
| 480 | 3300025910 | Ga0207684_10080139 | Ga0207684_100801392 | 136 |
| 481 | 3300025911 | Ga0207654_10016553 | Ga0207654_100165532 | 136 |
| 482 | 3300025911 | Ga0207654_10987586 | Ga0207654_109875862 | 136 |
| 483 | 3300025912 | Ga0207707_10000047 | Ga0207707_1000004741 | 136 |
| 484 | 3300025912 | Ga0207707_10080058 | Ga0207707_100800584 | 136 |
| 485 | 3300025912 | Ga0207707_10154217 | Ga0207707_101542172 | 136 |
| 486 | 3300025912 | Ga0207707_10200898 | Ga0207707_102008982 | 136 |
| 487 | 3300025914 | Ga0207671_10016883 | Ga0207671_100168834 | 136 |
| 488 | 3300025914 | Ga0207671_10365736 | Ga0207671_103657362 | 136 |
| 489 | 3300025916 | Ga0207663_10074795 | Ga0207663_100747953 | 136 |
| 490 | 3300025917 | Ga0207660_10001817 | Ga0207660_100018173 | 136 |
| 491 | 3300025917 | Ga0207660_11411135 | Ga0207660_114111351 | 136 |
| 492 | 3300025918 | Ga0207662_11067552 | Ga0207662_110675522 | 136 |
| 493 | 3300025919 | Ga0207657_10000021 | Ga0207657_1000002192 | 136 |
| 494 | 3300025920 | Ga0207649_10008334 | Ga0207649_100083344 | 136 |
| 495 | 3300025920 | Ga0207649_10373260 | Ga0207649_103732602 | 136 |
| 496 | 3300025921 | Ga0207652_10000922 | Ga0207652_1000092216 | 136 |
| 497 | 3300025921 | Ga0207652_10016152 | Ga0207652_100161525 | 136 |
| 498 | 3300025921 | Ga0207652_10170693 | Ga0207652_101706932 | 136 |
| 499 | 3300025922 | Ga0207646_10001275 | Ga0207646_1000127523 | 136 |
| 500 | 3300025922 | Ga0207646_10006816 | Ga0207646_100068167 | 136 |
| 501 | 3300025922 | Ga0207646_10009589 | Ga0207646_100095894 | 136 |
| 502 | 3300025922 | Ga0207646_10011893 | Ga0207646_100118933 | 136 |
| 503 | 3300025922 | Ga0207646_10061957 | Ga0207646_100619572 | 136 |
| 504 | 3300025922 | Ga0207646_10064236 | Ga0207646_100642364 | 136 |
| 505 | 3300025922 | Ga0207646_10106352 | Ga0207646_101063521 | 136 |
| 506 | 3300025922 | Ga0207646_10167098 | Ga0207646_101670982 | 136 |
| 507 | 3300025922 | Ga0207646_10260137 | Ga0207646_102601372 | 136 |
| 508 | 3300025923 | Ga0207681_10031576 | Ga0207681_100315762 | 136 |
| 509 | 3300025924 | Ga0207694_10069964 | Ga0207694_100699641 | 136 |
| 510 | 3300025924 | Ga0207694_10884110 | Ga0207694_108841102 | 136 |
| 511 | 3300025925 | Ga0207650_10015740 | Ga0207650_100157402 | 136 |
| 512 | 3300025927 | Ga0207687_10299589 | Ga0207687_102995892 | 136 |
| 513 | 3300025928 | Ga0207700_10065566 | Ga0207700_100655663 | 136 |
| 514 | 3300025928 | Ga0207700_10114039 | Ga0207700_101140392 | 136 |
| 515 | 3300025932 | Ga0207690_10004322 | Ga0207690_100043227 | 136 |
| 516 | 3300025932 | Ga0207690_10763568 | Ga0207690_107635682 | 136 |
| 517 | 3300025933 | Ga0207706_10005155 | Ga0207706_100051552 | 136 |
| 518 | 3300025934 | Ga0207686_10615159 | Ga0207686_106151592 | 136 |
| 519 | 3300025935 | Ga0207709_10193929 | Ga0207709_101939292 | 136 |
| 520 | 3300025935 | Ga0207709_11608687 | Ga0207709_116086871 | 136 |
| 521 | 3300025936 | Ga0207670_10024124 | Ga0207670_100241242 | 136 |
| 522 | 3300025937 | Ga0207669_10873078 | Ga0207669_108730781 | 136 |
| 523 | 3300025939 | Ga0207665_10134477 | Ga0207665_101344772 | 136 |
| 524 | 3300025941 | Ga0207711_10131410 | Ga0207711_101314104 | 136 |
| 525 | 3300025941 | Ga0207711_10281233 | Ga0207711_102812332 | 136 |
| 526 | 3300025942 | Ga0207689_10000516 | Ga0207689_1000051612 | 136 |
| 527 | 3300025942 | Ga0207689_10130414 | Ga0207689_101304142 | 136 |
| 528 | 3300025944 | Ga0207661_10001421 | Ga0207661_100014211 | 136 |
| 529 | 3300025944 | Ga0207661_10193629 | Ga0207661_101936293 | 136 |
| 530 | 3300025945 | Ga0207679_10000705 | Ga0207679_1000070510 | 136 |
| 531 | 3300025945 | Ga0207679_10804514 | Ga0207679_108045142 | 136 |
| 532 | 3300025945 | Ga0207679_10928523 | Ga0207679_109285232 | 136 |
| 533 | 3300025949 | Ga0207667_10005241 | Ga0207667_100052414 | 136 |
| 534 | 3300025961 | Ga0207712_10436679 | Ga0207712_104366793 | 136 |
| 535 | 3300025981 | Ga0207640_10005506 | Ga0207640_100055065 | 136 |
| 536 | 3300025981 | Ga0207640_10795682 | Ga0207640_107956822 | 136 |
| 537 | 3300025981 | Ga0207640_11092251 | Ga0207640_110922512 | 136 |
| 538 | 3300025986 | Ga0207658_10068623 | Ga0207658_100686234 | 136 |
| 539 | 3300026035 | Ga0207703_10247677 | Ga0207703_102476773 | 136 |
| 540 | 3300026035 | Ga0207703_10889950 | Ga0207703_108899502 | 136 |
| 541 | 3300026041 | Ga0207639_10010246 | Ga0207639_100102462 | 136 |
| 542 | 3300026041 | Ga0207639_10076362 | Ga0207639_100763623 | 136 |
| 543 | 3300026041 | Ga0207639_10932104 | Ga0207639_109321042 | 136 |
| 544 | 3300026067 | Ga0207678_10001391 | Ga0207678_100013918 | 136 |
| 545 | 3300026067 | Ga0207678_10839978 | Ga0207678_108399782 | 136 |
| 546 | 3300026075 | Ga0207708_10040893 | Ga0207708_100408933 | 136 |
| 547 | 3300026078 | Ga0207702_10001148 | Ga0207702_1000114815 | 136 |
| 548 | 3300026078 | Ga0207702_10016684 | Ga0207702_100166846 | 136 |
| 549 | 3300026088 | Ga0207641_10035878 | Ga0207641_100358782 | 136 |
| 550 | 3300026089 | Ga0207648_10009287 | Ga0207648_100092874 | 136 |
| 551 | 3300026089 | Ga0207648_10466842 | Ga0207648_104668422 | 136 |
| 552 | 3300026089 | Ga0207648_10887512 | Ga0207648_108875122 | 136 |
| 553 | 3300026095 | Ga0207676_10148550 | Ga0207676_101485503 | 136 |
| 554 | 3300026095 | Ga0207676_10208545 | Ga0207676_102085452 | 136 |
| 555 | 3300026116 | Ga0207674_10000137 | Ga0207674_1000013716 | 136 |
| 556 | 3300026116 | Ga0207674_10080429 | Ga0207674_100804292 | 136 |
| 557 | 3300026116 | Ga0207674_10874622 | Ga0207674_108746222 | 136 |
| 558 | 3300026118 | Ga0207675_100005591 | Ga0207675_1000055915 | 136 |
| 559 | 3300026118 | Ga0207675_100108774 | Ga0207675_1001087743 | 136 |
| 560 | 3300026142 | Ga0207698_10013879 | Ga0207698_100138793 | 136 |
| 561 | 3300028380 | Ga0268265_10008195 | Ga0268265_100081953 | 136 |
| 562 | 3300028380 | Ga0268265_10124103 | Ga0268265_101241034 | 136 |
| 563 | 3300028381 | Ga0268264_10255667 | Ga0268264_102556672 | 136 |
| 564 | 3300028381 | Ga0268264_11679737 | Ga0268264_116797372 | 136 |
| 565 | 3300028381 | Ga0268264_12226500 | Ga0268264_122265001 | 136 |
| 566 | 3300028800 | Ga0265338_10021958 | Ga0265338_100219582 | 136 |
| 567 | 3300031901 | Ga0307406_11111089 | Ga0307406_111110892 | 136 |
| 568 | 3300031903 | Ga0307407_10179460 | Ga0307407_101794602 | 136 |
| 569 | 3300031903 | Ga0307407_10991351 | Ga0307407_109913512 | 136 |
| 570 | 3300031911 | Ga0307412_10594322 | Ga0307412_105943222 | 136 |
| 571 | 3300031995 | Ga0307409_100388941 | Ga0307409_1003889411 | 136 |
| 572 | 3300031995 | Ga0307409_100390543 | Ga0307409_1003905432 | 136 |
| 573 | 3300032002 | Ga0307416_100036888 | Ga0307416_1000368882 | 136 |
| 574 | 3300032002 | Ga0307416_101002724 | Ga0307416_1010027241 | 136 |
| 575 | 3300032002 | Ga0307416_101335460 | Ga0307416_1013354601 | 136 |
| 576 | 3300032004 | Ga0307414_10053595 | Ga0307414_100535954 | 136 |
| 577 | 3300032126 | Ga0307415_100145941 | Ga0307415_1001459411 | 136 |
| 578 | 3300034817 | Ga0373948_0007310 | Ga0373948_0007310_337_792 | 136 |
| 579 | 3300034818 | Ga0373950_0005212 | Ga0373950_0005212_210_665 | 136 |
| 580 | 3300035085 | Ga0373929_0030774 | Ga0373929_0030774_415_870 | 136 |
| 581 | 3300035117 | Ga0373953_0030319 | Ga0373953_0030319_950_1366 | 136 |
| 582 | 3300035121 | Ga0373960_0021009 | Ga0373960_0021009_916_1371 | 136 |
| 583 | 3300035242 | Ga0373962_0086344 | Ga0373962_0086344_270_725 | 136 |
| 584 | 3300036401 | Ga0373937_0464517 | Ga0373937_0464517_343_756 | 136 |
| 585 | 3300036401 | Ga0373937_0658199 | Ga0373937_0658199_36_452 | 136 |
| 586 | 3300037068 | Ga0373925_1683592 | Ga0373925_1683592_24_440 | 136 |
| 587 | 3300042005 | Ga0439448_0012354 | Ga0439448_0012354_154_609 | 136 |
| 588 | 3300042438 | Ga0439459_0007577 | Ga0439459_0007577_548_1003 | 136 |
| 589 | 3300042876 | Ga0451577_0007768 | Ga0451577_0007768_9974_10429 | 136 |
| 590 | 3300044712 | Ga0453684_0097361 | Ga0453684_0097361_209_664 | 136 |
| 591 | 3300044712 | Ga0453684_0654914 | Ga0453684_0654914_470_883 | 136 |
| 592 | 3300045051 | Ga0451576_0421452 | Ga0451576_0421452_285_701 | 136 |
| 593 | 3300045051 | Ga0451576_0435155 | Ga0451576_0435155_394_849 | 136 |
| 594 | 3300046514 | Ga0495618_0020262 | Ga0495618_0020262_798_1220 | 136 |
| 595 | 3300046516 | Ga0495628_0037485 | Ga0495628_0037485_382_804 | 136 |
| 596 | 3300046517 | Ga0495630_0057279 | Ga0495630_0057279_225_647 | 136 |
| 597 | 3300046533 | Ga0495640_0086872 | Ga0495640_0086872_1636_2058 | 136 |
| 598 | 3300046535 | Ga0495586_0155989 | Ga0495586_0155989_726_1148 | 136 |
| 599 | 3300046642 | Ga0495634_0116211 | Ga0495634_0116211_1252_1674 | 136 |
| 600 | 3300047319 | Ga0495674_0434742 | Ga0495674_0434742_600_1022 | 136 |
| 601 | 3300047472 | Ga0495686_0463077 | Ga0495686_0463077_59_475 | 136 |
| 602 | 3300048904 | Ga0496101_1295154 | Ga0496101_1295154_50_526 | 136 |
| 603 | 3300048905 | Ga0496102_0571845 | Ga0496102_0571845_229_642 | 136 |
| 604 | 3300048907 | Ga0496104_0003857 | Ga0496104_0003857_5847_6323 | 136 |
| 605 | 3300048908 | Ga0496105_0001646 | Ga0496105_0001646_11639_12115 | 136 |
| 606 | 3300048909 | Ga0496106_0047042 | Ga0496106_0047042_272_727 | 136 |
| 607 | 3300048909 | Ga0496106_0569942 | Ga0496106_0569942_105_581 | 136 |
| 608 | 3300048910 | Ga0496107_0094047 | Ga0496107_0094047_475_951 | 136 |
| 609 | 3300048912 | Ga0496109_0376060 | Ga0496109_0376060_569_1024 | 136 |
| 610 | 3300048915 | Ga0496112_0169415 | Ga0496112_0169415_1609_2103 | 136 |
| 611 | 3300048915 | Ga0496112_0472587 | Ga0496112_0472587_752_1168 | 136 |
| 612 | 3300048915 | Ga0496112_0750895 | Ga0496112_0750895_45_461 | 136 |
| 613 | 3300048916 | Ga0496113_0921183 | Ga0496113_0921183_215_631 | 136 |
| 614 | 3300048917 | Ga0496114_0004681 | Ga0496114_0004681_4468_4944 | 136 |
| 615 | 3300048918 | Ga0496115_0007377 | Ga0496115_0007377_6656_7132 | 136 |
| 616 | 3300049573 | Ga0501037_0104159 | Ga0501037_0104159_1374_1790 | 136 |
| 617 | 3300049576 | Ga0501040_0116812 | Ga0501040_0116812_1141_1638 | 136 |
| 618 | 3300049580 | Ga0501046_0115465 | Ga0501046_0115465_1012_1509 | 136 |
| 619 | 3300049584 | Ga0501068_0289680 | Ga0501068_0289680_171_584 | 136 |
| 620 | 3300049592 | Ga0501076_1031146 | Ga0501076_1031146_125_622 | 136 |
| 621 | 3300049650 | Ga0501199_031090 | Ga0501199_031090_36_452 | 136 |
| 622 | 3300049652 | Ga0501202_166165 | Ga0501202_166165_15_431 | 136 |
| 623 | 3300049669 | Ga0501235_161569 | Ga0501235_161569_17_442 | 136 |
| 624 | 3300049686 | Ga0501257_117665 | Ga0501257_117665_94_510 | 136 |
| 625 | 3300049823 | Ga0501044_0063758 | Ga0501044_0063758_1351_1767 | 136 |
| 626 | 3300049823 | Ga0501044_0501574 | Ga0501044_0501574_40_456 | 136 |
| 627 | 3300049824 | Ga0501045_0164502 | Ga0501045_0164502_273_770 | 136 |
| 628 | 3300050507 | nmdc:mga05p37_123539_c1 | nmdc:mga05p37_123539_c1_2745_3161 | 136 |
| 629 | 3300050507 | nmdc:mga05p37_515006_c1 | nmdc:mga05p37_515006_c1_247_687 | 136 |
| 630 | 3300050507 | nmdc:mga05p37_74471_c1 | nmdc:mga05p37_74471_c1_864_1277 | 136 |
| 631 | 3300050507 | nmdc:mga05p37_830811_c1 | nmdc:mga05p37_830811_c1_433_849 | 136 |
| 632 | 3300050508 | nmdc:mga09592_16057_c1 | nmdc:mga09592_16057_c1_2390_2806 | 136 |
| 633 | 3300050508 | nmdc:mga09592_224516_c1 | nmdc:mga09592_224516_c1_911_1324 | 136 |
| 634 | 3300050510 | nmdc:mga06r32_1080124_c1 | nmdc:mga06r32_1080124_c1_131_544 | 136 |
| 635 | 3300050510 | nmdc:mga06r32_429174_c1 | nmdc:mga06r32_429174_c1_628_1041 | 136 |
| 636 | 3300050510 | nmdc:mga06r32_69950_c1 | nmdc:mga06r32_69950_c1_2809_3225 | 136 |
| 637 | 3300050512 | nmdc:mga0n895_1247225_c1 | nmdc:mga0n895_1247225_c1_244_660 | 136 |
| 638 | 3300050512 | nmdc:mga0n895_236865_c1 | nmdc:mga0n895_236865_c1_1374_1814 | 136 |
| 639 | 3300050512 | nmdc:mga0n895_262738_c1 | nmdc:mga0n895_262738_c1_855_1310 | 136 |
| 640 | 3300050513 | nmdc:mga0rr50_1259854_c1 | nmdc:mga0rr50_1259854_c1_15_476 | 136 |
| 641 | 3300050513 | nmdc:mga0rr50_1435232_c1 | nmdc:mga0rr50_1435232_c1_116_529 | 136 |
| 642 | 3300050513 | nmdc:mga0rr50_448015_c1 | nmdc:mga0rr50_448015_c1_571_1026 | 136 |
| 643 | 3300050513 | nmdc:mga0rr50_62886_c1 | nmdc:mga0rr50_62886_c1_985_1401 | 136 |
| 644 | 3300050514 | nmdc:mga08x19_38580_c1 | nmdc:mga08x19_38580_c1_2055_2480 | 136 |
| 645 | 3300050514 | nmdc:mga08x19_85527_c1 | nmdc:mga08x19_85527_c1_548_961 | 136 |
| 646 | 3300050515 | nmdc:mga0a205_10622_c1 | nmdc:mga0a205_10622_c1_3782_4198 | 136 |
| 647 | 3300050515 | nmdc:mga0a205_16621_c1 | nmdc:mga0a205_16621_c1_2254_2694 | 136 |
| 648 | 3300053077 | Ga0495601_1053237 | Ga0495601_1053237_82_498 | 136 |
| 649 | 3300049588 | Ga0501072_0679305 | Ga0501072_0679305_87_509 | 139 |
| 650 | 3300049591 | Ga0501075_0691354 | Ga0501075_0691354_129_551 | 139 |
| 651 | 3300049592 | Ga0501076_0430081 | Ga0501076_0430081_16_438 | 139 |
| 652 | 3300049741 | Ga0501079_0410973 | Ga0501079_0410973_471_893 | 139 |
| 653 | 3300049742 | Ga0501080_0882551 | Ga0501080_0882551_239_661 | 139 |
| 654 | 3300054114 | Ga0501084_0512701 | Ga0501084_0512701_455_877 | 139 |
| 655 | 3300060353 | Ga0501082_0740056 | Ga0501082_0740056_239_661 | 139 |
| 656 | 3300003322 | rootL2_10046681 | rootL2_100466813 | 148 |
| 657 | 3300049583 | Ga0501067_0046842 | Ga0501067_0046842_195_647 | 148 |
| 658 | 3300049585 | Ga0501069_0168077 | Ga0501069_0168077_171_623 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kop-assembly1.cif.gz_B | crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution | 0.7874 | 6 | 148 |
| 3x27-assembly2.cif.gz_C | structure of mcbb in complex with tryptophan | 0.7704 | 8 | 146 |
| 3kop-assembly1.cif.gz_F | crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution | 0.7652 | 6 | 148 |
| 3kop-assembly1.cif.gz_B | crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution | 0.7579 | 6 | 148 |
| 3kop-assembly1.cif.gz_D | crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution | 0.752 | 6 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3x27B01 | Mainly Beta;Beta Barrel;Cyclophilin; | 0.7724 | 8 | 146 | 2.40.100.20 |
| 3kopF01 | Mainly Beta;Beta Barrel;Cyclophilin; | 0.7573 | 5 | 148 | 2.40.100.20 |
| 2ka0A00 | Mainly Beta;Beta Barrel;Cyclophilin; | 0.75 | 8 | 148 | 2.40.100.20 |
| 3kopF01 | Mainly Beta;Beta Barrel;Cyclophilin; | 0.734 | 5 | 148 | 2.40.100.20 |
| 2ka0A00 | Mainly Beta;Beta Barrel;Cyclophilin; | 0.7239 | 8 | 148 | 2.40.100.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522AQS3-F1-model_v4 | DUF3830 family protein | 0.9746 | 7 | 101 |
|
| AF-A0A537UNQ7-F1-model_v4 | DUF3830 family protein | 0.9608 | 5 | 114 |
|
| AF-T1XAE7-F1-model_v4 | Cyclophilin-like superfamily protein | 0.9598 | 15 | 146 |
|
| AF-A0A538HA05-F1-model_v4 | DUF3830 family protein | 0.9588 | 8 | 148 |
|
| AF-A0A2M6VRG0-F1-model_v4 | Cyclophilin-like superfamily protein | 0.9562 | 5 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar