F473205

General Info

Members Datasets Scaffolds Average Seq Length
658 281 657 141

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0169415|Ga0496112_0169415_1609_2103
Length 164
Sequence VSSTCVEIEAVMAADASPILAPLVKMLKIVAGPFTFRAQLEEERAPKTVAAIRSMLPFKSKLVHCKWSGESTWVPMGDTKIGDAGGLAFENHTSHPAPGQVLIYPGGISETEILFPYGSTLFSSKVGQLAGNHFATVIEGNDKLAEIGRLALWEGAQDFTIELA

Samples

Sample ID Description Type Environment
1 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
261 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
262 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.76
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.15
Rhizoplane 3.5
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10046681 3300003322 Bacteria 3337
2 Ga0065712_10160555 3300005290 Unclassified 1305
3 Ga0065707_10574066 3300005295 Bacteria 706
4 Ga0070658_10154964 3300005327 Bacteria 1920
5 Ga0070658_11998788 3300005327 Bacteria 500
6 Ga0070676_10000556 3300005328 Bacteria 18022
7 Ga0070683_100002327 3300005329 Bacteria 15074
8 Ga0070690_100115282 3300005330 Bacteria 1797
9 Ga0070690_100123765 3300005330 Bacteria 1739
10 Ga0070670_100000596 3300005331 Bacteria 28525
11 Ga0070677_10455320 3300005333 Bacteria 685
12 Ga0068869_100000184 3300005334 Bacteria 32054
13 Ga0070680_100001624 3300005336 Bacteria 16434
14 Ga0070680_100801680 3300005336 Bacteria 811
15 Ga0070682_100000464 3300005337 Bacteria 25534
16 Ga0070660_100001374 3300005339 Bacteria 16522
17 Ga0070689_100034790 3300005340 Bacteria 3845
18 Ga0070689_100922031 3300005340 Bacteria 774
19 Ga0070691_10002084 3300005341 Bacteria 8841
20 Ga0070691_10004600 3300005341 Bacteria 6268
21 Ga0070687_100018422 3300005343 Bacteria 3230
22 Ga0070661_100001302 3300005344 Bacteria 17520
23 Ga0070692_10000199 3300005345 Bacteria 16153
24 Ga0070692_10904004 3300005345 Bacteria 611
25 Ga0070669_100039045 3300005353 Bacteria 3448
26 Ga0070669_100436615 3300005353 Bacteria 1077
27 Ga0070671_100060257 3300005355 Bacteria 3160
28 Ga0070674_101872252 3300005356 Bacteria 545
29 Ga0070673_100027314 3300005364 Bacteria 4229
30 Ga0070673_100631331 3300005364 Bacteria 979
31 Ga0070659_100001042 3300005366 Bacteria 20273
32 Ga0070659_100592164 3300005366 Bacteria 952
33 Ga0070667_100030788 3300005367 Bacteria 4475
34 Ga0070703_10000802 3300005406 Bacteria 10283
35 Ga0070703_10001944 3300005406 Bacteria 6060
36 Ga0070714_100003311 3300005435 Bacteria 12016
37 Ga0070714_100016484 3300005435 Bacteria 5969
38 Ga0070714_100286028 3300005435 Bacteria 1533
39 Ga0070713_100004314 3300005436 Bacteria 9531
40 Ga0070710_10006186 3300005437 Bacteria 5730
41 Ga0070711_100042880 3300005439 Bacteria 3061
42 Ga0070705_100000716 3300005440 Bacteria 18891
43 Ga0070705_100010996 3300005440 Bacteria 4550
44 Ga0070705_100120293 3300005440 Bacteria 1694
45 Ga0070705_100620152 3300005440 Bacteria 839
46 Ga0070700_100027826 3300005441 Bacteria 3357
47 Ga0070694_100001937 3300005444 Bacteria 12265
48 Ga0070694_100024552 3300005444 Bacteria 3891
49 Ga0070694_100120095 3300005444 Bacteria 1885
50 Ga0070694_100281082 3300005444 Bacteria 1269
51 Ga0070694_100980321 3300005444 Unclassified 701
52 Ga0070708_100000368 3300005445 Bacteria 34096
53 Ga0070708_100002804 3300005445 Bacteria 13531
54 Ga0070708_100013053 3300005445 Bacteria 6790
55 Ga0070708_100042533 3300005445 Bacteria 3988
56 Ga0070708_100043963 3300005445 Unclassified 3926
57 Ga0070708_100051653 3300005445 Bacteria 3642
58 Ga0070708_100097046 3300005445 Unclassified 2693
59 Ga0070708_100221248 3300005445 Bacteria 1775
60 Ga0070708_100340495 3300005445 Bacteria 1413
61 Ga0070708_100667674 3300005445 Bacteria 979
62 Ga0070708_100710370 3300005445 Bacteria 946
63 Ga0070708_100733277 3300005445 Bacteria 929
64 Ga0070708_101282398 3300005445 Bacteria 684
65 Ga0070663_100010115 3300005455 Bacteria 5869
66 Ga0070663_100475233 3300005455 Unclassified 1034
67 Ga0070663_101056515 3300005455 Bacteria 708
68 Ga0070662_100002733 3300005457 Bacteria 10899
69 Ga0070662_101722853 3300005457 Bacteria 541
70 Ga0070681_10047084 3300005458 Bacteria 4310
71 Ga0070681_10060061 3300005458 Bacteria 3781
72 Ga0070681_10077633 3300005458 Bacteria 3278
73 Ga0070681_10166333 3300005458 Bacteria 2128
74 Ga0070681_10627132 3300005458 Bacteria 990
75 Ga0068867_100002240 3300005459 Bacteria 13591
76 Ga0068867_100862199 3300005459 Bacteria 812
77 Ga0070706_100003203 3300005467 Bacteria 16151
78 Ga0070706_100005074 3300005467 Bacteria 12579
79 Ga0070706_100005221 3300005467 Bacteria 12391
80 Ga0070706_100016058 3300005467 Bacteria 6915
81 Ga0070706_100055418 3300005467 Bacteria 3660
82 Ga0070706_100089033 3300005467 Bacteria 2862
83 Ga0070706_100143831 3300005467 Bacteria 2226
84 Ga0070706_100216767 3300005467 Bacteria 1787
85 Ga0070706_100364658 3300005467 Bacteria 1346
86 Ga0070706_101099382 3300005467 Bacteria 732
87 Ga0070706_101633440 3300005467 Bacteria 588
88 Ga0070707_100000912 3300005468 Bacteria 29321
89 Ga0070707_100015809 3300005468 Bacteria 7085
90 Ga0070707_100040704 3300005468 Bacteria 4446
91 Ga0070707_100052845 3300005468 Unclassified 3895
92 Ga0070707_100078161 3300005468 Bacteria 3192
93 Ga0070707_100156572 3300005468 Bacteria 2219
94 Ga0070707_100193001 3300005468 Bacteria 1986
95 Ga0070707_100219835 3300005468 Unclassified 1850
96 Ga0070707_100404957 3300005468 Bacteria 1324
97 Ga0070707_100430473 3300005468 Bacteria 1280
98 Ga0070707_100518972 3300005468 Bacteria 1153
99 Ga0070707_100696153 3300005468 Bacteria 979
100 Ga0070707_100843340 3300005468 Bacteria 880
101 Ga0070707_101672486 3300005468 Bacteria 604
102 Ga0070698_100000003 3300005471 Bacteria 137957
103 Ga0070698_100001505 3300005471 Bacteria 25863
104 Ga0070698_100001689 3300005471 Bacteria 24629
105 Ga0070698_100033653 3300005471 Bacteria 5309
106 Ga0070698_100047579 3300005471 Bacteria 4384
107 Ga0070698_100066915 3300005471 Bacteria 3614
108 Ga0070698_100081139 3300005471 Bacteria 3238
109 Ga0070698_100099359 3300005471 Bacteria 2883
110 Ga0070698_100156766 3300005471 Bacteria 2222
111 Ga0070698_100217984 3300005471 Bacteria 1842
112 Ga0070698_100428821 3300005471 Bacteria 1257
113 Ga0070698_100743938 3300005471 Unclassified 923
114 Ga0070698_100744529 3300005471 Bacteria 923
115 Ga0070698_100934312 3300005471 Bacteria 813
116 Ga0070698_101629343 3300005471 Bacteria 597
117 Ga0070699_100001430 3300005518 Bacteria 21926
118 Ga0070699_100003711 3300005518 Bacteria 13498
119 Ga0070699_100009254 3300005518 Bacteria 8534
120 Ga0070699_100017005 3300005518 Bacteria 6245
121 Ga0070699_100017391 3300005518 Bacteria 6172
122 Ga0070699_100042912 3300005518 Bacteria 3915
123 Ga0070699_100045524 3300005518 Bacteria 3797
124 Ga0070699_100049616 3300005518 Bacteria 3633
125 Ga0070699_100138833 3300005518 Bacteria 2145
126 Ga0070699_100178956 3300005518 Bacteria 1881
127 Ga0070699_100302615 3300005518 Bacteria 1435
128 Ga0070699_100335899 3300005518 Bacteria 1359
129 Ga0070699_100496192 3300005518 Bacteria 1109
130 Ga0070699_100694096 3300005518 Bacteria 930
131 Ga0070679_100000337 3300005530 Bacteria 39944
132 Ga0070679_100026242 3300005530 Bacteria 5720
133 Ga0070679_100057425 3300005530 Bacteria 3879
134 Ga0070679_100354391 3300005530 Bacteria 1415
135 Ga0070684_100001270 3300005535 Bacteria 18074
136 Ga0070684_100027129 3300005535 Bacteria 4831
137 Ga0070684_100100994 3300005535 Bacteria 2577
138 Ga0070684_100119059 3300005535 Bacteria 2374
139 Ga0070697_100000004 3300005536 Bacteria 284078
140 Ga0070697_100000579 3300005536 Bacteria 27659
141 Ga0070697_100006957 3300005536 Bacteria 8796
142 Ga0070697_100012474 3300005536 Bacteria 6658
143 Ga0070697_100014356 3300005536 Bacteria 6222
144 Ga0070697_100018374 3300005536 Bacteria 5511
145 Ga0070697_100090386 3300005536 Bacteria 2530
146 Ga0070697_100237069 3300005536 Bacteria 1557
147 Ga0070697_100598689 3300005536 Bacteria 969
148 Ga0068853_100000111 3300005539 Bacteria 55607
149 Ga0068853_100264821 3300005539 Bacteria 1581
150 Ga0070686_100505165 3300005544 Bacteria 939
151 Ga0070695_100000192 3300005545 Bacteria 29723
152 Ga0070695_100000344 3300005545 Bacteria 23796
153 Ga0070695_100023894 3300005545 Bacteria 3763
154 Ga0070695_100314009 3300005545 Bacteria 1163
155 Ga0070695_101453332 3300005545 Archaea 569
156 Ga0070696_100004178 3300005546 Bacteria 9620
157 Ga0070696_100099763 3300005546 Bacteria 2079
158 Ga0070696_100206696 3300005546 Unclassified 1468
159 Ga0070696_100225059 3300005546 Unclassified 1409
160 Ga0070696_100525269 3300005546 Unclassified 945
161 Ga0070693_100000173 3300005547 Bacteria 29921
162 Ga0070665_102075915 3300005548 Unclassified 573
163 Ga0070704_100001677 3300005549 Bacteria 12029
164 Ga0070704_100138287 3300005549 Bacteria 1898
165 Ga0068855_100000219 3300005563 Bacteria 72993
166 Ga0068855_100029103 3300005563 Bacteria 6606
167 Ga0070664_100001899 3300005564 Bacteria 16778
168 Ga0070664_100260426 3300005564 Bacteria 1561
169 Ga0068857_100001268 3300005577 Bacteria 19798
170 Ga0068857_100015971 3300005577 Bacteria 6576
171 Ga0068857_100254421 3300005577 Bacteria 1611
172 Ga0068857_100295862 3300005577 Bacteria 1492
173 Ga0068854_100000800 3300005578 Bacteria 18745
174 Ga0068854_100198117 3300005578 Bacteria 1577
175 Ga0068854_101075876 3300005578 Bacteria 715
176 Ga0068856_100003539 3300005614 Bacteria 15735
177 Ga0068856_100006383 3300005614 Bacteria 11565
178 Ga0068856_100046447 3300005614 Bacteria 4277
179 Ga0068856_100683891 3300005614 Bacteria 1046
180 Ga0070702_100038006 3300005615 Bacteria 2677
181 Ga0068852_100009459 3300005616 Bacteria 7240
182 Ga0068859_100004490 3300005617 Bacteria 14232
183 Ga0068859_100129394 3300005617 Bacteria 2595
184 Ga0068859_100379301 3300005617 Bacteria 1509
185 Ga0068859_100937593 3300005617 Bacteria 949
186 Ga0068864_100142633 3300005618 Bacteria 2162
187 Ga0068864_100247577 3300005618 Bacteria 1653
188 Ga0068864_100305042 3300005618 Bacteria 1491
189 Ga0068861_100001718 3300005719 Bacteria 14042
190 Ga0068851_10404805 3300005834 Bacteria 803
191 Ga0068870_10000173 3300005840 Bacteria 23147
192 Ga0068858_100018563 3300005842 Bacteria 6513
193 Ga0068860_100010782 3300005843 Bacteria 9021
194 Ga0068860_100137747 3300005843 Bacteria 2345
195 Ga0068862_100000611 3300005844 Bacteria 37118
196 Ga0070717_10000681 3300006028 Bacteria 21901
197 Ga0070717_10001530 3300006028 Bacteria 16022
198 Ga0070717_10011531 3300006028 Bacteria 6715
199 Ga0070717_10505074 3300006028 Bacteria 1093
200 Ga0070717_10574274 3300006028 Bacteria 1022
201 Ga0070717_10669980 3300006028 Bacteria 942
202 Ga0070717_12142509 3300006028 Bacteria 503
203 Ga0075432_10277928 3300006058 Unclassified 688
204 Ga0070715_10055704 3300006163 Bacteria 1717
205 Ga0070715_10082698 3300006163 Bacteria 1461
206 Ga0070715_10125353 3300006163 Bacteria 1229
207 Ga0070715_10155727 3300006163 Unclassified 1124
208 Ga0070716_100010546 3300006173 Bacteria 4636
209 Ga0070716_100018989 3300006173 Bacteria 3589
210 Ga0070716_100281302 3300006173 Bacteria 1148
211 Ga0070712_100057677 3300006175 Bacteria 2729
212 Ga0070712_100367042 3300006175 Bacteria 1182
213 Ga0070712_100681585 3300006175 Bacteria 875
214 Ga0097621_100152185 3300006237 Bacteria 1984
215 Ga0068871_100034860 3300006358 Bacteria 3996
216 Ga0075428_100414122 3300006844 Bacteria 1444
217 Ga0075430_101099253 3300006846 Unclassified 655
218 Ga0075431_100024903 3300006847 Bacteria 6136
219 Ga0075431_100747105 3300006847 Unclassified 954
220 Ga0075431_101198146 3300006847 Bacteria 722
221 Ga0075431_101659824 3300006847 Unclassified 596
222 Ga0075433_10013373 3300006852 Bacteria 6669
223 Ga0075433_10020684 3300006852 Bacteria 5507
224 Ga0075433_10026432 3300006852 Bacteria 4914
225 Ga0075433_10037423 3300006852 Bacteria 4187
226 Ga0075433_10044720 3300006852 Bacteria 3848
227 Ga0075433_10165317 3300006852 Bacteria 1969
228 Ga0075434_100056859 3300006871 Bacteria 3888
229 Ga0075434_100114131 3300006871 Bacteria 2714
230 Ga0075434_100126322 3300006871 Bacteria 2574
231 Ga0075434_100136087 3300006871 Bacteria 2476
232 Ga0075434_100328435 3300006871 Bacteria 1550
233 Ga0075434_101051893 3300006871 Unclassified 828
234 Ga0075429_100001122 3300006880 Bacteria 21576
235 Ga0075436_100010351 3300006914 Bacteria 6390
236 Ga0075436_100020611 3300006914 Bacteria 4524
237 Ga0075436_100039187 3300006914 Bacteria 3270
238 Ga0075436_100051093 3300006914 Bacteria 2853
239 Ga0075436_100079795 3300006914 Bacteria 2267
240 Ga0075436_100146213 3300006914 Bacteria 1662
241 Ga0075436_100224672 3300006914 Bacteria 1333
242 Ga0075436_100377282 3300006914 Bacteria 1025
243 Ga0097620_100004490 3300006931 Bacteria 14232
244 Ga0097620_100129395 3300006931 Bacteria 2595
245 Ga0097620_100379307 3300006931 Bacteria 1509
246 Ga0097620_100937562 3300006931 Bacteria 949
247 Ga0075435_100011096 3300007076 Bacteria 6608
248 Ga0075435_100027776 3300007076 Bacteria 4430
249 Ga0075435_100053369 3300007076 Bacteria 3260
250 Ga0075435_100063261 3300007076 Bacteria 3005
251 Ga0075435_100148552 3300007076 Bacteria 1969
252 Ga0075435_100259785 3300007076 Bacteria 1479
253 Ga0075435_100613831 3300007076 Bacteria 943
254 Ga0075435_100836270 3300007076 Bacteria 802
255 Ga0099794_10027607 3300007265 Bacteria 2633
256 Ga0099794_10062699 3300007265 Bacteria 1808
257 Ga0111539_10915035 3300009094 Unclassified 1020
258 Ga0105245_10449198 3300009098 Bacteria 1297
259 Ga0105247_10365609 3300009101 Bacteria 1019
260 Ga0114129_10009751 3300009147 Bacteria 13697
261 Ga0114129_10161721 3300009147 Unclassified 3058
262 Ga0114129_10166399 3300009147 Bacteria 3009
263 Ga0114129_10332883 3300009147 Bacteria 2015
264 Ga0114129_10474690 3300009147 Bacteria 1637
265 Ga0114129_10566308 3300009147 Bacteria 1476
266 Ga0114129_10703641 3300009147 Bacteria 1298
267 Ga0114129_11079641 3300009147 Bacteria 1006
268 Ga0105243_10371785 3300009148 Bacteria 1319
269 Ga0105243_11014962 3300009148 Bacteria 833
270 Ga0105241_10000394 3300009174 Bacteria 33141
271 Ga0105241_10621389 3300009174 Bacteria 978
272 Ga0105241_10986923 3300009174 Bacteria 787
273 Ga0105242_10189718 3300009176 Bacteria 1819
274 Ga0105248_10177030 3300009177 Bacteria 2404
275 Ga0105237_10004386 3300009545 Bacteria 16356
276 Ga0105237_10101218 3300009545 Bacteria 2873
277 Ga0105237_10160278 3300009545 Bacteria 2248
278 Ga0105238_10042520 3300009551 Bacteria 4601
279 Ga0105238_10230934 3300009551 Bacteria 1827
280 Ga0105238_11376319 3300009551 Bacteria 732
281 Ga0105249_10396233 3300009553 Bacteria 1410
282 Ga0099796_10051647 3300010159 Unclassified 1429
283 Ga0105239_10816112 3300010375 Bacteria 1069
284 Ga0105246_10110617 3300011119 Unclassified 2018
285 Ga0157373_10000051 3300013100 Bacteria 105264
286 Ga0157373_10185371 3300013100 Bacteria 1466
287 Ga0157371_10307315 3300013102 Bacteria 1149
288 Ga0157370_10371724 3300013104 Bacteria 1317
289 Ga0157369_10010586 3300013105 Bacteria 10499
290 Ga0157369_10025725 3300013105 Bacteria 6530
291 Ga0163162_10389334 3300013306 Bacteria 1527
292 Ga0163162_11098915 3300013306 Bacteria 901
293 Ga0157372_10001083 3300013307 Bacteria 29625
294 Ga0157372_10032114 3300013307 Bacteria 5754
295 Ga0157372_10497580 3300013307 Bacteria 1421
296 Ga0157372_10797068 3300013307 Bacteria 1098
297 Ga0157372_12343289 3300013307 Bacteria 613
298 Ga0157372_12466530 3300013307 Unclassified 597
299 Ga0163163_10062290 3300014325 Bacteria 3696
300 Ga0157377_10041102 3300014745 Bacteria 2564
301 Ga0157379_10244762 3300014968 Unclassified 1627
302 Ga0182007_10029010 3300015262 Bacteria 1896
303 Ga0163161_10439200 3300017792 Unclassified 1053
304 Ga0206350_10295288 3300020080 Bacteria 700
305 Ga0206350_10646724 3300020080 Bacteria 771
306 Ga0154015_1169539 3300020610 Bacteria 1161
307 Ga0154015_1662471 3300020610 Bacteria 544
308 Ga0224712_10010958 3300022467 Unclassified 2793
309 Ga0207653_10000824 3300025885 Bacteria 10350
310 Ga0207653_10001098 3300025885 Bacteria 8874
311 Ga0207653_10002427 3300025885 Bacteria 5922
312 Ga0207710_10075550 3300025900 Unclassified 1553
313 Ga0207680_10149862 3300025903 Bacteria 1554
314 Ga0207647_10136191 3300025904 Bacteria 1441
315 Ga0207685_10137365 3300025905 Bacteria 1092
316 Ga0207699_10176956 3300025906 Bacteria 1431
317 Ga0207645_10000062 3300025907 Bacteria 76875
318 Ga0207645_10229836 3300025907 Bacteria 1224
319 Ga0207643_10000219 3300025908 Bacteria 40245
320 Ga0207705_10792929 3300025909 Bacteria 735
321 Ga0207684_10000035 3300025910 Bacteria 289353
322 Ga0207684_10005095 3300025910 Bacteria 12248
323 Ga0207684_10005357 3300025910 Bacteria 11852
324 Ga0207684_10006721 3300025910 Bacteria 10445
325 Ga0207684_10010175 3300025910 Bacteria 8283
326 Ga0207684_10013567 3300025910 Bacteria 7043
327 Ga0207684_10051786 3300025910 Bacteria 3484
328 Ga0207684_10080139 3300025910 Bacteria 2777
329 Ga0207684_10114708 3300025910 Bacteria 2307
330 Ga0207684_10242639 3300025910 Bacteria 1554
331 Ga0207684_10291647 3300025910 Bacteria 1407
332 Ga0207654_10016553 3300025911 Bacteria 3842
333 Ga0207654_10987586 3300025911 Bacteria 612
334 Ga0207707_10000047 3300025912 Bacteria 118016
335 Ga0207707_10080058 3300025912 Bacteria 2853
336 Ga0207707_10154217 3300025912 Bacteria 2008
337 Ga0207707_10200898 3300025912 Bacteria 1738
338 Ga0207671_10016883 3300025914 Bacteria 5652
339 Ga0207671_10365736 3300025914 Bacteria 1145
340 Ga0207693_10013161 3300025915 Bacteria 6674
341 Ga0207693_10115810 3300025915 Bacteria 2104
342 Ga0207693_11147283 3300025915 Bacteria 588
343 Ga0207663_10037521 3300025916 Bacteria 2922
344 Ga0207663_10074795 3300025916 Bacteria 2196
345 Ga0207660_10001817 3300025917 Bacteria 14216
346 Ga0207660_11411135 3300025917 Bacteria 564
347 Ga0207662_11067552 3300025918 Unclassified 574
348 Ga0207657_10000021 3300025919 Bacteria 155900
349 Ga0207649_10008334 3300025920 Bacteria 5650
350 Ga0207649_10373260 3300025920 Unclassified 1061
351 Ga0207652_10000922 3300025921 Bacteria 27650
352 Ga0207652_10016152 3300025921 Bacteria 6089
353 Ga0207652_10170693 3300025921 Bacteria 1952
354 Ga0207646_10000127 3300025922 Bacteria 103693
355 Ga0207646_10001275 3300025922 Bacteria 31514
356 Ga0207646_10006816 3300025922 Bacteria 11749
357 Ga0207646_10009589 3300025922 Bacteria 9551
358 Ga0207646_10011893 3300025922 Bacteria 8396
359 Ga0207646_10013824 3300025922 Bacteria 7697
360 Ga0207646_10026904 3300025922 Bacteria 5244
361 Ga0207646_10027191 3300025922 Bacteria 5217
362 Ga0207646_10054273 3300025922 Bacteria 3585
363 Ga0207646_10061957 3300025922 Bacteria 3339
364 Ga0207646_10064236 3300025922 Bacteria 3276
365 Ga0207646_10078842 3300025922 Bacteria 2944
366 Ga0207646_10106352 3300025922 Bacteria 2517
367 Ga0207646_10123585 3300025922 Bacteria 2327
368 Ga0207646_10123778 3300025922 Bacteria 2324
369 Ga0207646_10167098 3300025922 Bacteria 1986
370 Ga0207646_10260137 3300025922 Unclassified 1568
371 Ga0207646_10334694 3300025922 Bacteria 1368
372 Ga0207646_10442863 3300025922 Bacteria 1172
373 Ga0207681_10031576 3300025923 Bacteria 3460
374 Ga0207694_10069964 3300025924 Bacteria 2742
375 Ga0207694_10884110 3300025924 Bacteria 755
376 Ga0207650_10015740 3300025925 Bacteria 5273
377 Ga0207687_10299589 3300025927 Bacteria 1295
378 Ga0207700_10003827 3300025928 Bacteria 8789
379 Ga0207700_10065566 3300025928 Bacteria 2771
380 Ga0207700_10114039 3300025928 Bacteria 2180
381 Ga0207664_10007423 3300025929 Bacteria 7599
382 Ga0207664_10066742 3300025929 Bacteria 2885
383 Ga0207664_10158478 3300025929 Bacteria 1929
384 Ga0207664_10253130 3300025929 Bacteria 1538
385 Ga0207690_10004322 3300025932 Bacteria 8390
386 Ga0207690_10763568 3300025932 Bacteria 798
387 Ga0207706_10005155 3300025933 Bacteria 12197
388 Ga0207686_10615159 3300025934 Bacteria 856
389 Ga0207709_10193929 3300025935 Bacteria 1445
390 Ga0207709_11608687 3300025935 Bacteria 540
391 Ga0207670_10024124 3300025936 Bacteria 3798
392 Ga0207669_10873078 3300025937 Bacteria 750
393 Ga0207665_10000261 3300025939 Bacteria 36619
394 Ga0207665_10016024 3300025939 Bacteria 4922
395 Ga0207665_10134477 3300025939 Bacteria 1758
396 Ga0207665_10763233 3300025939 Bacteria 763
397 Ga0207711_10131410 3300025941 Bacteria 2245
398 Ga0207711_10281233 3300025941 Bacteria 1532
399 Ga0207689_10000516 3300025942 Bacteria 36653
400 Ga0207689_10130414 3300025942 Bacteria 2069
401 Ga0207661_10000910 3300025944 Bacteria 19412
402 Ga0207661_10001421 3300025944 Bacteria 16130
403 Ga0207661_10193629 3300025944 Bacteria 1784
404 Ga0207679_10000705 3300025945 Bacteria 22298
405 Ga0207679_10804514 3300025945 Bacteria 857
406 Ga0207679_10928523 3300025945 Bacteria 796
407 Ga0207667_10005241 3300025949 Bacteria 15816
408 Ga0207667_10874410 3300025949 Bacteria 892
409 Ga0207712_10436679 3300025961 Bacteria 1108
410 Ga0207640_10005506 3300025981 Bacteria 6903
411 Ga0207640_10795682 3300025981 Bacteria 819
412 Ga0207640_11092251 3300025981 Bacteria 705
413 Ga0207658_10068623 3300025986 Bacteria 2676
414 Ga0207703_10247677 3300026035 Bacteria 1604
415 Ga0207703_10889950 3300026035 Bacteria 852
416 Ga0207639_10010246 3300026041 Bacteria 6486
417 Ga0207639_10076362 3300026041 Bacteria 2638
418 Ga0207639_10932104 3300026041 Bacteria 812
419 Ga0207678_10001391 3300026067 Bacteria 22252
420 Ga0207678_10839978 3300026067 Bacteria 811
421 Ga0207708_10040893 3300026075 Bacteria 3535
422 Ga0207702_10001148 3300026078 Bacteria 27096
423 Ga0207702_10016684 3300026078 Bacteria 6078
424 Ga0207702_10018134 3300026078 Bacteria 5823
425 Ga0207702_10874148 3300026078 Bacteria 890
426 Ga0207641_10035878 3300026088 Bacteria 4135
427 Ga0207648_10009287 3300026089 Bacteria 9433
428 Ga0207648_10466842 3300026089 Bacteria 1151
429 Ga0207648_10887512 3300026089 Bacteria 832
430 Ga0207676_10148550 3300026095 Bacteria 2015
431 Ga0207676_10208545 3300026095 Bacteria 1732
432 Ga0207674_10000137 3300026116 Bacteria 84955
433 Ga0207674_10002627 3300026116 Bacteria 22496
434 Ga0207674_10080429 3300026116 Bacteria 3262
435 Ga0207674_10874622 3300026116 Bacteria 866
436 Ga0207675_100005591 3300026118 Bacteria 12031
437 Ga0207675_100108774 3300026118 Bacteria 2615
438 Ga0207698_10013879 3300026142 Bacteria 5334
439 Ga0209996_1004023 3300027395 Bacteria 1863
440 Ga0209968_1001059 3300027526 Bacteria 4195
441 Ga0209970_1005879 3300027614 Bacteria 2016
442 Ga0209971_1000030 3300027682 Bacteria 50605
443 Ga0209966_1000518 3300027695 Bacteria 9982
444 Ga0209998_10000007 3300027717 Bacteria 99753
445 Ga0209974_10005666 3300027876 Bacteria 4384
446 Ga0207428_10463056 3300027907 Unclassified 923
447 Ga0268265_10008195 3300028380 Bacteria 7059
448 Ga0268265_10124103 3300028380 Bacteria 2133
449 Ga0268264_10255667 3300028381 Bacteria 1629
450 Ga0268264_11679737 3300028381 Bacteria 646
451 Ga0268264_12226500 3300028381 Bacteria 556
452 Ga0265338_10021958 3300028800 Bacteria 6632
453 Ga0307406_11111089 3300031901 Bacteria 683
454 Ga0307406_12080911 3300031901 Bacteria 508
455 Ga0307407_10179460 3300031903 Bacteria 1402
456 Ga0307407_10991351 3300031903 Bacteria 649
457 Ga0307412_10594322 3300031911 Unclassified 936
458 Ga0307409_100388941 3300031995 Bacteria 1328
459 Ga0307409_100390543 3300031995 Bacteria 1326
460 Ga0307416_100036888 3300032002 Bacteria 3755
461 Ga0307416_101002724 3300032002 Bacteria 938
462 Ga0307416_101335460 3300032002 Bacteria 823
463 Ga0307414_10053595 3300032004 Unclassified 2814
464 Ga0307415_100145941 3300032126 Bacteria 1814
465 Ga0373948_0007310 3300034817 Bacteria 1854
466 Ga0373950_0005212 3300034818 Bacteria 1933
467 Ga0373929_0030774 3300035085 Bacteria 1146
468 Ga0373940_0168555 3300035088 Bacteria 706
469 Ga0373940_0181411 3300035088 Bacteria 684
470 Ga0373944_0148940 3300035089 Unclassified 824
471 Ga0373949_0102571 3300035090 Bacteria 785
472 Ga0373951_0005575 3300035091 Bacteria 2919
473 Ga0373939_0101818 3300035114 Bacteria 987
474 Ga0373941_0069242 3300035115 Bacteria 1167
475 Ga0373941_0257795 3300035115 Unclassified 683
476 Ga0373953_0030319 3300035117 Bacteria 2097
477 Ga0373960_0021009 3300035121 Bacteria 1731
478 Ga0373943_0011516 3300035170 Bacteria 3981
479 Ga0373955_0064542 3300035172 Bacteria 2030
480 Ga0373961_0196905 3300035241 Unclassified 709
481 Ga0373962_0086344 3300035242 Bacteria 960
482 Ga0373931_0030828 3300035691 Bacteria 2763
483 Ga0373931_0071700 3300035691 Bacteria 1893
484 Ga0373935_0769913 3300035692 Unclassified 710
485 Ga0373927_0177637 3300035695 Bacteria 1396
486 Ga0373947_0018173 3300035725 Bacteria 4046
487 Ga0373947_0290725 3300035725 Bacteria 1088
488 Ga0373937_0464517 3300036401 Unclassified 1202
489 Ga0373937_0658199 3300036401 Bacteria 993
490 Ga0373937_1616910 3300036401 Bacteria 595
491 Ga0373925_1683592 3300037068 Bacteria 518
492 Ga0242420_128848 3300038996 Bacteria 557
493 Ga0451839_1328708 3300041496 Unclassified 585
494 Ga0439448_0012354 3300042005 Bacteria 2556
495 Ga0439450_005787 3300042008 Bacteria 2193
496 Ga0439455_0029996 3300042012 Bacteria 1347
497 Ga0439459_0007577 3300042438 Bacteria 1837
498 Ga0439460_0000543 3300042461 Bacteria 8259
499 Ga0451577_0007768 3300042876 Bacteria 10512
500 Ga0451577_0099946 3300042876 Bacteria 2591
501 Ga0451577_0284121 3300042876 Bacteria 1499
502 Ga0466969_0385503 3300044656 Bacteria 636
503 Ga0466966_0213154 3300044684 Bacteria 1167
504 Ga0453684_0097361 3300044712 Bacteria 3611
505 Ga0453684_0654914 3300044712 Bacteria 1146
506 Ga0451576_0006733 3300045051 Bacteria 13998
507 Ga0451576_0181980 3300045051 Bacteria 2194
508 Ga0451576_0421452 3300045051 Bacteria 1400
509 Ga0451576_0435155 3300045051 Bacteria 1376
510 Ga0466967_1498033 3300045976 Bacteria 672
511 Ga0495618_0020262 3300046514 Bacteria 4095
512 Ga0495628_0037485 3300046516 Bacteria 3887
513 Ga0495630_0057279 3300046517 Bacteria 2920
514 Ga0495640_0086872 3300046533 Bacteria 2070
515 Ga0495586_0155989 3300046535 Bacteria 1286
516 Ga0495634_0116211 3300046642 Bacteria 1716
517 Ga0495658_0253652 3300046683 Bacteria 1107
518 Ga0495674_0225847 3300047319 Bacteria 1547
519 Ga0495674_0434742 3300047319 Bacteria 1056
520 Ga0495686_0463077 3300047472 Bacteria 672
521 Ga0496101_1295154 3300048904 Bacteria 570
522 Ga0496102_0571845 3300048905 Bacteria 1053
523 Ga0496104_0003857 3300048907 Bacteria 12971
524 Ga0496105_0001646 3300048908 Bacteria 15908
525 Ga0496106_0047042 3300048909 Bacteria 3245
526 Ga0496106_0569942 3300048909 Bacteria 908
527 Ga0496107_0094047 3300048910 Bacteria 2193
528 Ga0496109_0342696 3300048912 Bacteria 1411
529 Ga0496109_0376060 3300048912 Bacteria 1342
530 Ga0496109_0410860 3300048912 Bacteria 1279
531 Ga0496110_0080123 3300048913 Bacteria 2909
532 Ga0496111_0851054 3300048914 Bacteria 658
533 Ga0496112_0011876 3300048915 Bacteria 7976
534 Ga0496112_0169415 3300048915 Bacteria 2149
535 Ga0496112_0472587 3300048915 Bacteria 1191
536 Ga0496112_0750895 3300048915 Bacteria 902
537 Ga0496112_1507336 3300048915 Bacteria 586
538 Ga0496113_0921183 3300048916 Bacteria 691
539 Ga0496114_0004681 3300048917 Bacteria 10641
540 Ga0496115_0005310 3300048918 Bacteria 9368
541 Ga0496115_0007377 3300048918 Bacteria 8092
542 Ga0496115_0072359 3300048918 Bacteria 2797
543 Ga0496115_0209302 3300048918 Bacteria 1611
544 Ga0501032_0817353 3300049569 Bacteria 588
545 Ga0501036_0050972 3300049572 Bacteria 3505
546 Ga0501037_0104159 3300049573 Bacteria 2046
547 Ga0501039_0045196 3300049575 Bacteria 3402
548 Ga0501040_0037643 3300049576 Bacteria 3287
549 Ga0501040_0079557 3300049576 Bacteria 2269
550 Ga0501040_0116812 3300049576 Bacteria 1869
551 Ga0501041_0003130 3300049577 Bacteria 9521
552 Ga0501042_0162834 3300049578 Bacteria 1609
553 Ga0501043_0024003 3300049579 Bacteria 4785
554 Ga0501046_0001249 3300049580 Bacteria 24589
555 Ga0501046_0115465 3300049580 Bacteria 2047
556 Ga0501047_0161380 3300049581 Bacteria 2113
557 Ga0501048_0001345 3300049582 Bacteria 18641
558 Ga0501067_0001495 3300049583 Bacteria 12726
559 Ga0501067_0013578 3300049583 Bacteria 4511
560 Ga0501067_0046842 3300049583 Bacteria 2400
561 Ga0501067_0252487 3300049583 Bacteria 982
562 Ga0501068_0151979 3300049584 Bacteria 1455
563 Ga0501068_0289680 3300049584 Bacteria 1047
564 Ga0501069_0014678 3300049585 Bacteria 4190
565 Ga0501069_0168077 3300049585 Bacteria 1265
566 Ga0501070_0072501 3300049586 Bacteria 2851
567 Ga0501070_0110047 3300049586 Bacteria 2277
568 Ga0501070_1183212 3300049586 Bacteria 587
569 Ga0501071_0028506 3300049587 Bacteria 3937
570 Ga0501071_0369603 3300049587 Bacteria 1093
571 Ga0501072_0073900 3300049588 Bacteria 2695
572 Ga0501072_0679305 3300049588 Bacteria 810
573 Ga0501075_0059316 3300049591 Bacteria 2882
574 Ga0501075_0149397 3300049591 Bacteria 1781
575 Ga0501075_0691354 3300049591 Unclassified 777
576 Ga0501076_0008426 3300049592 Bacteria 7556
577 Ga0501076_0135700 3300049592 Bacteria 1997
578 Ga0501076_0430081 3300049592 Bacteria 1086
579 Ga0501076_1031146 3300049592 Bacteria 678
580 Ga0501077_0195330 3300049593 Bacteria 1285
581 Ga0501199_031090 3300049650 Bacteria 659
582 Ga0501202_166165 3300049652 Bacteria 587
583 Ga0501235_161569 3300049669 Bacteria 586
584 Ga0501257_117665 3300049686 Bacteria 709
585 Ga0501079_0000310 3300049741 Bacteria 30465
586 Ga0501079_0173858 3300049741 Bacteria 1679
587 Ga0501079_0410973 3300049741 Bacteria 1062
588 Ga0501080_0882551 3300049742 Bacteria 780
589 Ga0501080_1053134 3300049742 Bacteria 704
590 Ga0501083_0053862 3300049744 Bacteria 2700
591 Ga0501035_0142670 3300049822 Bacteria 2082
592 Ga0501044_0063758 3300049823 Bacteria 3763
593 Ga0501044_0501574 3300049823 Unclassified 1115
594 Ga0501045_0014624 3300049824 Bacteria 5564
595 Ga0501045_0164502 3300049824 Bacteria 1652
596 Ga0501045_0254066 3300049824 Bacteria 1308
597 Ga0501045_0400265 3300049824 Bacteria 1022
598 nmdc:mga05p37_1070541_c1 3300050507 Bacteria 848
599 nmdc:mga05p37_123539_c1 3300050507 Bacteria 3180
600 nmdc:mga05p37_2019013_c1 3300050507 Bacteria 545
601 nmdc:mga05p37_223404_c1 3300050507 Unclassified 2272
602 nmdc:mga05p37_310687_c1 3300050507 Bacteria 1868
603 nmdc:mga05p37_452536_c1 3300050507 Bacteria 1485
604 nmdc:mga05p37_515006_c1 3300050507 Bacteria 1370
605 nmdc:mga05p37_578129_c1 3300050507 Bacteria 1273
606 nmdc:mga05p37_74471_c1 3300050507 Bacteria 4179
607 nmdc:mga05p37_830811_c1 3300050507 Bacteria 1006
608 nmdc:mga05p37_85663_c1 3300050507 Bacteria 3883
609 nmdc:mga09592_16057_c1 3300050508 Bacteria 6121
610 nmdc:mga09592_224516_c1 3300050508 Bacteria 1627
611 nmdc:mga06r32_1080124_c1 3300050510 Bacteria 752
612 nmdc:mga06r32_429174_c1 3300050510 Bacteria 1302
613 nmdc:mga06r32_602979_c1 3300050510 Bacteria 1069
614 nmdc:mga06r32_69950_c1 3300050510 Unclassified 3393
615 nmdc:mga08y16_828933_c1 3300050511 Unclassified 916
616 nmdc:mga0n895_117732_c1 3300050512 Unclassified 2676
617 nmdc:mga0n895_1247225_c1 3300050512 Bacteria 716
618 nmdc:mga0n895_1664_c1 3300050512 Bacteria 12894
619 nmdc:mga0n895_236865_c1 3300050512 Bacteria 1852
620 nmdc:mga0n895_252472_c1 3300050512 Bacteria 1790
621 nmdc:mga0n895_262738_c1 3300050512 Bacteria 1752
622 nmdc:mga0rr50_122419_c1 3300050513 Bacteria 2073
623 nmdc:mga0rr50_1259854_c1 3300050513 Unclassified 628
624 nmdc:mga0rr50_1406211_c1 3300050513 Bacteria 591
625 nmdc:mga0rr50_1435232_c1 3300050513 Bacteria 584
626 nmdc:mga0rr50_15743_c1 3300050513 Bacteria 5001
627 nmdc:mga0rr50_23893_c1 3300050513 Bacteria 4226
628 nmdc:mga0rr50_429964_c1 3300050513 Unclassified 1118
629 nmdc:mga0rr50_448015_c1 3300050513 Bacteria 1094
630 nmdc:mga0rr50_51456_c1 3300050513 Bacteria 3056
631 nmdc:mga0rr50_62886_c1 3300050513 Bacteria 2802
632 nmdc:mga0rr50_67274_c1 3300050513 Bacteria 2721
633 nmdc:mga08x19_1079941_c1 3300050514 Bacteria 570
634 nmdc:mga08x19_130868_c1 3300050514 Bacteria 1688
635 nmdc:mga08x19_199904_c1 3300050514 Bacteria 1370
636 nmdc:mga08x19_233064_c1 3300050514 Bacteria 1268
637 nmdc:mga08x19_24742_c1 3300050514 Bacteria 3736
638 nmdc:mga08x19_24964_c1 3300050514 Bacteria 3720
639 nmdc:mga08x19_38580_c1 3300050514 Bacteria 3034
640 nmdc:mga08x19_50929_c1 3300050514 Bacteria 2658
641 nmdc:mga08x19_571175_c1 3300050514 Bacteria 801
642 nmdc:mga08x19_85527_c1 3300050514 Bacteria 2075
643 nmdc:mga0a205_10622_c1 3300050515 Bacteria 8465
644 nmdc:mga0a205_127397_c1 3300050515 Bacteria 2446
645 nmdc:mga0a205_133168_c1 3300050515 Unclassified 2386
646 nmdc:mga0a205_16621_c1 3300050515 Bacteria 6891
647 nmdc:mga0a205_2400_c1 3300050515 Bacteria 16532
648 nmdc:mga0a205_73463_c1 3300050515 Bacteria 3304
649 Ga0495601_1053237 3300053077 Bacteria 510
650 Ga0501084_0001384 3300054114 Bacteria 19196
651 Ga0501084_0512701 3300054114 Bacteria 1014
652 Ga0501084_1041254 3300054114 Unclassified 687
653 Ga0501082_0001189 3300060353 Bacteria 22875
654 Ga0501082_0351601 3300060353 Bacteria 1285
655 Ga0501082_0740056 3300060353 Bacteria 861
656 Ga0501082_0865154 3300060353 Bacteria 791
657 Ga0530510_0054996 3300061734 Bacteria 2876

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0253652 Ga0495658_0253652_342_746 130
2 3300009147 Ga0114129_10161721 Ga0114129_101617212 131
3 3300050507 nmdc:mga05p37_223404_c1 nmdc:mga05p37_223404_c1_398_799 131
4 3300050512 nmdc:mga0n895_117732_c1 nmdc:mga0n895_117732_c1_511_912 131
5 3300050515 nmdc:mga0a205_133168_c1 nmdc:mga0a205_133168_c1_409_810 131
6 iso_pu_bacteria 2894023352 2894026545 131
7 3300007265 Ga0099794_10027607 Ga0099794_100276071 133
8 3300045976 Ga0466967_1498033 Ga0466967_1498033_55_462 133
9 3300005290 Ga0065712_10160555 Ga0065712_101605552 134
10 3300005327 Ga0070658_10154964 Ga0070658_101549642 134
11 3300005327 Ga0070658_11998788 Ga0070658_119987881 134
12 3300005435 Ga0070714_100016484 Ga0070714_1000164842 134
13 3300005435 Ga0070714_100286028 Ga0070714_1002860282 134
14 3300005437 Ga0070710_10006186 Ga0070710_100061865 134
15 3300005445 Ga0070708_100042533 Ga0070708_1000425334 134
16 3300005445 Ga0070708_100043963 Ga0070708_1000439634 134
17 3300005445 Ga0070708_100667674 Ga0070708_1006676741 134
18 3300005467 Ga0070706_100216767 Ga0070706_1002167674 134
19 3300005467 Ga0070706_100364658 Ga0070706_1003646583 134
20 3300005468 Ga0070707_100040704 Ga0070707_1000407042 134
21 3300005468 Ga0070707_100052845 Ga0070707_1000528453 134
22 3300005468 Ga0070707_100078161 Ga0070707_1000781613 134
23 3300005468 Ga0070707_100404957 Ga0070707_1004049572 134
24 3300005468 Ga0070707_100843340 Ga0070707_1008433401 134
25 3300005471 Ga0070698_100001505 Ga0070698_1000015054 134
26 3300005471 Ga0070698_100156766 Ga0070698_1001567663 134
27 3300005471 Ga0070698_100217984 Ga0070698_1002179842 134
28 3300005471 Ga0070698_100743938 Ga0070698_1007439382 134
29 3300005471 Ga0070698_100934312 Ga0070698_1009343121 134
30 3300005471 Ga0070698_101629343 Ga0070698_1016293431 134
31 3300005518 Ga0070699_100003711 Ga0070699_1000037113 134
32 3300005518 Ga0070699_100045524 Ga0070699_1000455243 134
33 3300005518 Ga0070699_100335899 Ga0070699_1003358994 134
34 3300005530 Ga0070679_100354391 Ga0070679_1003543912 134
35 3300005535 Ga0070684_100001270 Ga0070684_10000127011 134
36 3300005535 Ga0070684_100027129 Ga0070684_1000271292 134
37 3300005536 Ga0070697_100000004 Ga0070697_100000004270 134
38 3300005536 Ga0070697_100006957 Ga0070697_1000069577 134
39 3300005536 Ga0070697_100598689 Ga0070697_1005986892 134
40 3300005548 Ga0070665_102075915 Ga0070665_1020759151 134
41 3300005614 Ga0068856_100046447 Ga0068856_1000464471 134
42 3300006028 Ga0070717_10505074 Ga0070717_105050743 134
43 3300006028 Ga0070717_12142509 Ga0070717_121425091 134
44 3300006058 Ga0075432_10277928 Ga0075432_102779281 134
45 3300006163 Ga0070715_10082698 Ga0070715_100826982 134
46 3300006163 Ga0070715_10125353 Ga0070715_101253532 134
47 3300006173 Ga0070716_100010546 Ga0070716_1000105466 134
48 3300006175 Ga0070712_100057677 Ga0070712_1000576773 134
49 3300006847 Ga0075431_100747105 Ga0075431_1007471052 134
50 3300006871 Ga0075434_100136087 Ga0075434_1001360873 134
51 3300007076 Ga0075435_100836270 Ga0075435_1008362702 134
52 3300007265 Ga0099794_10062699 Ga0099794_100626992 134
53 3300009094 Ga0111539_10915035 Ga0111539_109150352 134
54 3300009147 Ga0114129_10474690 Ga0114129_104746902 134
55 3300009545 Ga0105237_10160278 Ga0105237_101602782 134
56 3300009551 Ga0105238_10042520 Ga0105238_100425203 134
57 3300013105 Ga0157369_10010586 Ga0157369_100105867 134
58 3300013307 Ga0157372_10497580 Ga0157372_104975802 134
59 3300013307 Ga0157372_10797068 Ga0157372_107970682 134
60 3300013307 Ga0157372_12466530 Ga0157372_124665302 134
61 3300025885 Ga0207653_10002427 Ga0207653_100024273 134
62 3300025905 Ga0207685_10137365 Ga0207685_101373651 134
63 3300025910 Ga0207684_10010175 Ga0207684_100101753 134
64 3300025910 Ga0207684_10114708 Ga0207684_101147082 134
65 3300025910 Ga0207684_10291647 Ga0207684_102916474 134
66 3300025915 Ga0207693_10013161 Ga0207693_100131616 134
67 3300025915 Ga0207693_10115810 Ga0207693_101158102 134
68 3300025922 Ga0207646_10013824 Ga0207646_100138245 134
69 3300025922 Ga0207646_10026904 Ga0207646_100269043 134
70 3300025922 Ga0207646_10027191 Ga0207646_100271917 134
71 3300025922 Ga0207646_10123778 Ga0207646_101237782 134
72 3300025922 Ga0207646_10334694 Ga0207646_103346942 134
73 3300025928 Ga0207700_10003827 Ga0207700_100038274 134
74 3300025929 Ga0207664_10007423 Ga0207664_100074235 134
75 3300025929 Ga0207664_10253130 Ga0207664_102531302 134
76 3300025939 Ga0207665_10016024 Ga0207665_100160243 134
77 3300025939 Ga0207665_10763233 Ga0207665_107632332 134
78 3300025944 Ga0207661_10000910 Ga0207661_100009103 134
79 3300026078 Ga0207702_10018134 Ga0207702_100181342 134
80 3300026078 Ga0207702_10874148 Ga0207702_108741482 134
81 3300026116 Ga0207674_10002627 Ga0207674_1000262712 134
82 3300027907 Ga0207428_10463056 Ga0207428_104630562 134
83 3300031901 Ga0307406_12080911 Ga0307406_120809111 134
84 3300035089 Ga0373944_0148940 Ga0373944_0148940_40_459 134
85 3300035114 Ga0373939_0101818 Ga0373939_0101818_111_518 134
86 3300035115 Ga0373941_0257795 Ga0373941_0257795_233_652 134
87 3300035170 Ga0373943_0011516 Ga0373943_0011516_1708_2127 134
88 3300035172 Ga0373955_0064542 Ga0373955_0064542_65_475 134
89 3300035691 Ga0373931_0071700 Ga0373931_0071700_428_835 134
90 3300035692 Ga0373935_0769913 Ga0373935_0769913_149_568 134
91 3300035695 Ga0373927_0177637 Ga0373927_0177637_387_806 134
92 3300035725 Ga0373947_0290725 Ga0373947_0290725_433_852 134
93 3300036401 Ga0373937_1616910 Ga0373937_1616910_112_522 134
94 3300041496 Ga0451839_1328708 Ga0451839_1328708_159_569 134
95 3300044684 Ga0466966_0213154 Ga0466966_0213154_490_897 134
96 3300047319 Ga0495674_0225847 Ga0495674_0225847_1025_1435 134
97 3300048912 Ga0496109_0342696 Ga0496109_0342696_60_479 134
98 3300048912 Ga0496109_0410860 Ga0496109_0410860_498_908 134
99 3300048913 Ga0496110_0080123 Ga0496110_0080123_1247_1657 134
100 3300048914 Ga0496111_0851054 Ga0496111_0851054_116_523 134
101 3300048915 Ga0496112_0011876 Ga0496112_0011876_7546_7956 134
102 3300048915 Ga0496112_1507336 Ga0496112_1507336_18_425 134
103 3300048918 Ga0496115_0072359 Ga0496115_0072359_1905_2312 134
104 3300048918 Ga0496115_0209302 Ga0496115_0209302_244_654 134
105 3300049569 Ga0501032_0817353 Ga0501032_0817353_29_436 134
106 3300049576 Ga0501040_0079557 Ga0501040_0079557_1305_1712 134
107 3300049583 Ga0501067_0001495 Ga0501067_0001495_1326_1733 134
108 3300049584 Ga0501068_0151979 Ga0501068_0151979_1000_1407 134
109 3300049585 Ga0501069_0014678 Ga0501069_0014678_3732_4139 134
110 3300049586 Ga0501070_0072501 Ga0501070_0072501_2152_2559 134
111 3300049586 Ga0501070_0110047 Ga0501070_0110047_475_885 134
112 3300049587 Ga0501071_0028506 Ga0501071_0028506_1501_1908 134
113 3300049587 Ga0501071_0369603 Ga0501071_0369603_533_940 134
114 3300049588 Ga0501072_0073900 Ga0501072_0073900_1566_1973 134
115 3300049591 Ga0501075_0149397 Ga0501075_0149397_29_436 134
116 3300049592 Ga0501076_0135700 Ga0501076_0135700_884_1291 134
117 3300049741 Ga0501079_0173858 Ga0501079_0173858_115_522 134
118 3300049822 Ga0501035_0142670 Ga0501035_0142670_1285_1692 134
119 3300049824 Ga0501045_0254066 Ga0501045_0254066_611_1018 134
120 3300049824 Ga0501045_0400265 Ga0501045_0400265_336_749 134
121 3300050507 nmdc:mga05p37_1070541_c1 nmdc:mga05p37_1070541_c1_177_590 134
122 3300050507 nmdc:mga05p37_452536_c1 nmdc:mga05p37_452536_c1_797_1204 134
123 3300050511 nmdc:mga08y16_828933_c1 nmdc:mga08y16_828933_c1_104_511 134
124 3300050513 nmdc:mga0rr50_23893_c1 nmdc:mga0rr50_23893_c1_828_1247 134
125 3300050514 nmdc:mga08x19_24964_c1 nmdc:mga08x19_24964_c1_1089_1508 134
126 3300054114 Ga0501084_1041254 Ga0501084_1041254_135_542 134
127 3300060353 Ga0501082_0351601 Ga0501082_0351601_723_1130 134
128 3300060353 Ga0501082_0865154 Ga0501082_0865154_218_628 134
129 3300005333 Ga0070677_10455320 Ga0070677_104553202 135
130 3300005353 Ga0070669_100039045 Ga0070669_1000390453 135
131 3300005364 Ga0070673_100027314 Ga0070673_1000273142 135
132 3300005406 Ga0070703_10001944 Ga0070703_100019445 135
133 3300005440 Ga0070705_100010996 Ga0070705_1000109962 135
134 3300005440 Ga0070705_100620152 Ga0070705_1006201521 135
135 3300005444 Ga0070694_100281082 Ga0070694_1002810822 135
136 3300005444 Ga0070694_100980321 Ga0070694_1009803211 135
137 3300005445 Ga0070708_100002804 Ga0070708_1000028049 135
138 3300005445 Ga0070708_100013053 Ga0070708_1000130533 135
139 3300005445 Ga0070708_100733277 Ga0070708_1007332771 135
140 3300005467 Ga0070706_100005221 Ga0070706_10000522110 135
141 3300005467 Ga0070706_100016058 Ga0070706_1000160582 135
142 3300005467 Ga0070706_100143831 Ga0070706_1001438312 135
143 3300005468 Ga0070707_100015809 Ga0070707_1000158096 135
144 3300005468 Ga0070707_100156572 Ga0070707_1001565722 135
145 3300005468 Ga0070707_100696153 Ga0070707_1006961531 135
146 3300005471 Ga0070698_100001689 Ga0070698_1000016899 135
147 3300005471 Ga0070698_100066915 Ga0070698_1000669152 135
148 3300005471 Ga0070698_100099359 Ga0070698_1000993592 135
149 3300005518 Ga0070699_100001430 Ga0070699_1000014307 135
150 3300005518 Ga0070699_100009254 Ga0070699_1000092549 135
151 3300005518 Ga0070699_100049616 Ga0070699_1000496162 135
152 3300005518 Ga0070699_100178956 Ga0070699_1001789562 135
153 3300005518 Ga0070699_100496192 Ga0070699_1004961922 135
154 3300005536 Ga0070697_100000579 Ga0070697_1000005794 135
155 3300005536 Ga0070697_100012474 Ga0070697_1000124744 135
156 3300005536 Ga0070697_100014356 Ga0070697_1000143564 135
157 3300005536 Ga0070697_100090386 Ga0070697_1000903862 135
158 3300005536 Ga0070697_100237069 Ga0070697_1002370692 135
159 3300005545 Ga0070695_100000192 Ga0070695_10000019237 135
160 3300005545 Ga0070695_100314009 Ga0070695_1003140092 135
161 3300005545 Ga0070695_101453332 Ga0070695_1014533321 135
162 3300005546 Ga0070696_100099763 Ga0070696_1000997632 135
163 3300005546 Ga0070696_100206696 Ga0070696_1002066962 135
164 3300005546 Ga0070696_100225059 Ga0070696_1002250592 135
165 3300005578 Ga0068854_100198117 Ga0068854_1001981173 135
166 3300005615 Ga0070702_100038006 Ga0070702_1000380061 135
167 3300006028 Ga0070717_10011531 Ga0070717_100115312 135
168 3300006028 Ga0070717_10574274 Ga0070717_105742742 135
169 3300006163 Ga0070715_10055704 Ga0070715_100557042 135
170 3300006173 Ga0070716_100018989 Ga0070716_1000189896 135
171 3300006175 Ga0070712_100681585 Ga0070712_1006815852 135
172 3300006237 Ga0097621_100152185 Ga0097621_1001521852 135
173 3300006852 Ga0075433_10020684 Ga0075433_100206846 135
174 3300006852 Ga0075433_10026432 Ga0075433_100264321 135
175 3300006852 Ga0075433_10044720 Ga0075433_100447202 135
176 3300006852 Ga0075433_10165317 Ga0075433_101653172 135
177 3300006871 Ga0075434_100056859 Ga0075434_1000568596 135
178 3300006871 Ga0075434_100114131 Ga0075434_1001141313 135
179 3300006871 Ga0075434_101051893 Ga0075434_1010518931 135
180 3300006914 Ga0075436_100020611 Ga0075436_1000206112 135
181 3300006914 Ga0075436_100039187 Ga0075436_1000391873 135
182 3300006914 Ga0075436_100079795 Ga0075436_1000797952 135
183 3300006914 Ga0075436_100146213 Ga0075436_1001462132 135
184 3300006914 Ga0075436_100377282 Ga0075436_1003772822 135
185 3300007076 Ga0075435_100053369 Ga0075435_1000533694 135
186 3300007076 Ga0075435_100148552 Ga0075435_1001485522 135
187 3300007076 Ga0075435_100259785 Ga0075435_1002597852 135
188 3300007076 Ga0075435_100613831 Ga0075435_1006138312 135
189 3300009147 Ga0114129_10166399 Ga0114129_101663994 135
190 3300009147 Ga0114129_10332883 Ga0114129_103328832 135
191 3300009147 Ga0114129_10703641 Ga0114129_107036412 135
192 3300010159 Ga0099796_10051647 Ga0099796_100516472 135
193 3300011119 Ga0105246_10110617 Ga0105246_101106172 135
194 3300013307 Ga0157372_10032114 Ga0157372_100321142 135
195 3300025885 Ga0207653_10001098 Ga0207653_100010984 135
196 3300025906 Ga0207699_10176956 Ga0207699_101769562 135
197 3300025910 Ga0207684_10000035 Ga0207684_10000035120 135
198 3300025910 Ga0207684_10006721 Ga0207684_100067214 135
199 3300025910 Ga0207684_10242639 Ga0207684_102426392 135
200 3300025915 Ga0207693_11147283 Ga0207693_111472832 135
201 3300025916 Ga0207663_10037521 Ga0207663_100375213 135
202 3300025922 Ga0207646_10000127 Ga0207646_1000012780 135
203 3300025922 Ga0207646_10054273 Ga0207646_100542732 135
204 3300025922 Ga0207646_10078842 Ga0207646_100788422 135
205 3300025922 Ga0207646_10123585 Ga0207646_101235852 135
206 3300025922 Ga0207646_10442863 Ga0207646_104428631 135
207 3300025929 Ga0207664_10066742 Ga0207664_100667423 135
208 3300025929 Ga0207664_10158478 Ga0207664_101584782 135
209 3300025939 Ga0207665_10000261 Ga0207665_1000026133 135
210 3300025949 Ga0207667_10874410 Ga0207667_108744102 135
211 3300027395 Ga0209996_1004023 Ga0209996_10040232 135
212 3300027526 Ga0209968_1001059 Ga0209968_10010594 135
213 3300027614 Ga0209970_1005879 Ga0209970_10058792 135
214 3300027682 Ga0209971_1000030 Ga0209971_100003025 135
215 3300027695 Ga0209966_1000518 Ga0209966_10005189 135
216 3300027717 Ga0209998_10000007 Ga0209998_1000000795 135
217 3300027876 Ga0209974_10005666 Ga0209974_100056661 135
218 3300035088 Ga0373940_0168555 Ga0373940_0168555_280_690 135
219 3300035088 Ga0373940_0181411 Ga0373940_0181411_48_458 135
220 3300035090 Ga0373949_0102571 Ga0373949_0102571_269_679 135
221 3300035091 Ga0373951_0005575 Ga0373951_0005575_2057_2467 135
222 3300035115 Ga0373941_0069242 Ga0373941_0069242_655_1065 135
223 3300035241 Ga0373961_0196905 Ga0373961_0196905_42_452 135
224 3300035691 Ga0373931_0030828 Ga0373931_0030828_1257_1667 135
225 3300035725 Ga0373947_0018173 Ga0373947_0018173_865_1278 135
226 3300038996 Ga0242420_128848 Ga0242420_128848_73_486 135
227 3300042008 Ga0439450_005787 Ga0439450_005787_593_1018 135
228 3300042012 Ga0439455_0029996 Ga0439455_0029996_869_1294 135
229 3300042461 Ga0439460_0000543 Ga0439460_0000543_3893_4318 135
230 3300042876 Ga0451577_0099946 Ga0451577_0099946_1740_2165 135
231 3300042876 Ga0451577_0284121 Ga0451577_0284121_11_421 135
232 3300044656 Ga0466969_0385503 Ga0466969_0385503_95_505 135
233 3300045051 Ga0451576_0006733 Ga0451576_0006733_6257_6667 135
234 3300045051 Ga0451576_0181980 Ga0451576_0181980_447_872 135
235 3300048918 Ga0496115_0005310 Ga0496115_0005310_3219_3629 135
236 3300049572 Ga0501036_0050972 Ga0501036_0050972_1201_1626 135
237 3300049575 Ga0501039_0045196 Ga0501039_0045196_535_960 135
238 3300049576 Ga0501040_0037643 Ga0501040_0037643_1824_2249 135
239 3300049577 Ga0501041_0003130 Ga0501041_0003130_1908_2333 135
240 3300049578 Ga0501042_0162834 Ga0501042_0162834_982_1407 135
241 3300049579 Ga0501043_0024003 Ga0501043_0024003_982_1407 135
242 3300049580 Ga0501046_0001249 Ga0501046_0001249_20341_20766 135
243 3300049581 Ga0501047_0161380 Ga0501047_0161380_1230_1655 135
244 3300049582 Ga0501048_0001345 Ga0501048_0001345_2582_3007 135
245 3300049583 Ga0501067_0013578 Ga0501067_0013578_1603_2013 135
246 3300049583 Ga0501067_0252487 Ga0501067_0252487_527_940 135
247 3300049586 Ga0501070_1183212 Ga0501070_1183212_19_429 135
248 3300049591 Ga0501075_0059316 Ga0501075_0059316_649_1074 135
249 3300049592 Ga0501076_0008426 Ga0501076_0008426_6452_6877 135
250 3300049593 Ga0501077_0195330 Ga0501077_0195330_704_1129 135
251 3300049741 Ga0501079_0000310 Ga0501079_0000310_20645_21070 135
252 3300049742 Ga0501080_1053134 Ga0501080_1053134_17_442 135
253 3300049744 Ga0501083_0053862 Ga0501083_0053862_768_1193 135
254 3300049824 Ga0501045_0014624 Ga0501045_0014624_4630_5055 135
255 3300050507 nmdc:mga05p37_2019013_c1 nmdc:mga05p37_2019013_c1_44_460 135
256 3300050507 nmdc:mga05p37_310687_c1 nmdc:mga05p37_310687_c1_927_1340 135
257 3300050507 nmdc:mga05p37_578129_c1 nmdc:mga05p37_578129_c1_285_695 135
258 3300050507 nmdc:mga05p37_85663_c1 nmdc:mga05p37_85663_c1_1399_1815 135
259 3300050510 nmdc:mga06r32_602979_c1 nmdc:mga06r32_602979_c1_448_858 135
260 3300050512 nmdc:mga0n895_1664_c1 nmdc:mga0n895_1664_c1_7084_7500 135
261 3300050512 nmdc:mga0n895_252472_c1 nmdc:mga0n895_252472_c1_896_1309 135
262 3300050513 nmdc:mga0rr50_122419_c1 nmdc:mga0rr50_122419_c1_138_554 135
263 3300050513 nmdc:mga0rr50_1406211_c1 nmdc:mga0rr50_1406211_c1_74_487 135
264 3300050513 nmdc:mga0rr50_15743_c1 nmdc:mga0rr50_15743_c1_2517_2933 135
265 3300050513 nmdc:mga0rr50_429964_c1 nmdc:mga0rr50_429964_c1_272_685 135
266 3300050513 nmdc:mga0rr50_51456_c1 nmdc:mga0rr50_51456_c1_311_724 135
267 3300050513 nmdc:mga0rr50_67274_c1 nmdc:mga0rr50_67274_c1_1241_1651 135
268 3300050514 nmdc:mga08x19_1079941_c1 nmdc:mga08x19_1079941_c1_31_441 135
269 3300050514 nmdc:mga08x19_130868_c1 nmdc:mga08x19_130868_c1_975_1388 135
270 3300050514 nmdc:mga08x19_199904_c1 nmdc:mga08x19_199904_c1_366_779 135
271 3300050514 nmdc:mga08x19_233064_c1 nmdc:mga08x19_233064_c1_257_673 135
272 3300050514 nmdc:mga08x19_24742_c1 nmdc:mga08x19_24742_c1_145_558 135
273 3300050514 nmdc:mga08x19_50929_c1 nmdc:mga08x19_50929_c1_1269_1685 135
274 3300050514 nmdc:mga08x19_571175_c1 nmdc:mga08x19_571175_c1_122_538 135
275 3300050515 nmdc:mga0a205_127397_c1 nmdc:mga0a205_127397_c1_704_1117 135
276 3300050515 nmdc:mga0a205_2400_c1 nmdc:mga0a205_2400_c1_8420_8836 135
277 3300050515 nmdc:mga0a205_73463_c1 nmdc:mga0a205_73463_c1_1207_1617 135
278 3300054114 Ga0501084_0001384 Ga0501084_0001384_3790_4215 135
279 3300060353 Ga0501082_0001189 Ga0501082_0001189_19692_20117 135
280 3300061734 Ga0530510_0054996 Ga0530510_0054996_1295_1720 135
281 3300005295 Ga0065707_10574066 Ga0065707_105740662 136
282 3300005328 Ga0070676_10000556 Ga0070676_100005569 136
283 3300005329 Ga0070683_100002327 Ga0070683_1000023273 136
284 3300005330 Ga0070690_100115282 Ga0070690_1001152822 136
285 3300005330 Ga0070690_100123765 Ga0070690_1001237652 136
286 3300005331 Ga0070670_100000596 Ga0070670_10000059624 136
287 3300005334 Ga0068869_100000184 Ga0068869_10000018424 136
288 3300005336 Ga0070680_100001624 Ga0070680_1000016248 136
289 3300005336 Ga0070680_100801680 Ga0070680_1008016801 136
290 3300005337 Ga0070682_100000464 Ga0070682_10000046415 136
291 3300005339 Ga0070660_100001374 Ga0070660_10000137414 136
292 3300005340 Ga0070689_100034790 Ga0070689_1000347902 136
293 3300005340 Ga0070689_100922031 Ga0070689_1009220311 136
294 3300005341 Ga0070691_10002084 Ga0070691_100020845 136
295 3300005341 Ga0070691_10004600 Ga0070691_100046003 136
296 3300005343 Ga0070687_100018422 Ga0070687_1000184223 136
297 3300005344 Ga0070661_100001302 Ga0070661_10000130211 136
298 3300005345 Ga0070692_10000199 Ga0070692_1000019915 136
299 3300005345 Ga0070692_10904004 Ga0070692_109040042 136
300 3300005353 Ga0070669_100436615 Ga0070669_1004366153 136
301 3300005355 Ga0070671_100060257 Ga0070671_1000602571 136
302 3300005356 Ga0070674_101872252 Ga0070674_1018722521 136
303 3300005364 Ga0070673_100631331 Ga0070673_1006313312 136
304 3300005366 Ga0070659_100001042 Ga0070659_10000104214 136
305 3300005366 Ga0070659_100592164 Ga0070659_1005921642 136
306 3300005367 Ga0070667_100030788 Ga0070667_1000307882 136
307 3300005406 Ga0070703_10000802 Ga0070703_1000080210 136
308 3300005435 Ga0070714_100003311 Ga0070714_1000033117 136
309 3300005436 Ga0070713_100004314 Ga0070713_1000043142 136
310 3300005439 Ga0070711_100042880 Ga0070711_1000428801 136
311 3300005440 Ga0070705_100000716 Ga0070705_10000071622 136
312 3300005440 Ga0070705_100120293 Ga0070705_1001202933 136
313 3300005441 Ga0070700_100027826 Ga0070700_1000278263 136
314 3300005444 Ga0070694_100001937 Ga0070694_10000193713 136
315 3300005444 Ga0070694_100024552 Ga0070694_1000245524 136
316 3300005444 Ga0070694_100120095 Ga0070694_1001200952 136
317 3300005445 Ga0070708_100000368 Ga0070708_1000003683 136
318 3300005445 Ga0070708_100051653 Ga0070708_1000516532 136
319 3300005445 Ga0070708_100097046 Ga0070708_1000970463 136
320 3300005445 Ga0070708_100221248 Ga0070708_1002212484 136
321 3300005445 Ga0070708_100340495 Ga0070708_1003404952 136
322 3300005445 Ga0070708_100710370 Ga0070708_1007103702 136
323 3300005445 Ga0070708_101282398 Ga0070708_1012823982 136
324 3300005455 Ga0070663_100010115 Ga0070663_1000101154 136
325 3300005455 Ga0070663_100475233 Ga0070663_1004752332 136
326 3300005455 Ga0070663_101056515 Ga0070663_1010565152 136
327 3300005457 Ga0070662_100002733 Ga0070662_1000027332 136
328 3300005457 Ga0070662_101722853 Ga0070662_1017228531 136
329 3300005458 Ga0070681_10047084 Ga0070681_100470843 136
330 3300005458 Ga0070681_10060061 Ga0070681_100600612 136
331 3300005458 Ga0070681_10077633 Ga0070681_100776332 136
332 3300005458 Ga0070681_10166333 Ga0070681_101663332 136
333 3300005458 Ga0070681_10627132 Ga0070681_106271321 136
334 3300005459 Ga0068867_100002240 Ga0068867_1000022408 136
335 3300005459 Ga0068867_100862199 Ga0068867_1008621992 136
336 3300005467 Ga0070706_100003203 Ga0070706_1000032037 136
337 3300005467 Ga0070706_100005074 Ga0070706_10000507410 136
338 3300005467 Ga0070706_100055418 Ga0070706_1000554184 136
339 3300005467 Ga0070706_100089033 Ga0070706_1000890332 136
340 3300005467 Ga0070706_101099382 Ga0070706_1010993822 136
341 3300005467 Ga0070706_101633440 Ga0070706_1016334401 136
342 3300005468 Ga0070707_100000912 Ga0070707_1000009124 136
343 3300005468 Ga0070707_100193001 Ga0070707_1001930012 136
344 3300005468 Ga0070707_100219835 Ga0070707_1002198352 136
345 3300005468 Ga0070707_100430473 Ga0070707_1004304731 136
346 3300005468 Ga0070707_100518972 Ga0070707_1005189722 136
347 3300005468 Ga0070707_101672486 Ga0070707_1016724861 136
348 3300005471 Ga0070698_100000003 Ga0070698_10000000363 136
349 3300005471 Ga0070698_100033653 Ga0070698_1000336534 136
350 3300005471 Ga0070698_100047579 Ga0070698_1000475792 136
351 3300005471 Ga0070698_100081139 Ga0070698_1000811392 136
352 3300005471 Ga0070698_100428821 Ga0070698_1004288212 136
353 3300005471 Ga0070698_100744529 Ga0070698_1007445292 136
354 3300005518 Ga0070699_100017005 Ga0070699_1000170054 136
355 3300005518 Ga0070699_100017391 Ga0070699_1000173912 136
356 3300005518 Ga0070699_100042912 Ga0070699_1000429124 136
357 3300005518 Ga0070699_100138833 Ga0070699_1001388333 136
358 3300005518 Ga0070699_100302615 Ga0070699_1003026152 136
359 3300005518 Ga0070699_100694096 Ga0070699_1006940961 136
360 3300005530 Ga0070679_100000337 Ga0070679_1000003375 136
361 3300005530 Ga0070679_100026242 Ga0070679_1000262424 136
362 3300005530 Ga0070679_100057425 Ga0070679_1000574253 136
363 3300005535 Ga0070684_100100994 Ga0070684_1001009942 136
364 3300005535 Ga0070684_100119059 Ga0070684_1001190593 136
365 3300005536 Ga0070697_100018374 Ga0070697_1000183745 136
366 3300005539 Ga0068853_100000111 Ga0068853_10000011155 136
367 3300005539 Ga0068853_100264821 Ga0068853_1002648211 136
368 3300005544 Ga0070686_100505165 Ga0070686_1005051652 136
369 3300005545 Ga0070695_100000344 Ga0070695_10000034421 136
370 3300005545 Ga0070695_100023894 Ga0070695_1000238944 136
371 3300005546 Ga0070696_100004178 Ga0070696_1000041783 136
372 3300005546 Ga0070696_100525269 Ga0070696_1005252692 136
373 3300005547 Ga0070693_100000173 Ga0070693_10000017327 136
374 3300005549 Ga0070704_100001677 Ga0070704_1000016777 136
375 3300005549 Ga0070704_100138287 Ga0070704_1001382874 136
376 3300005563 Ga0068855_100000219 Ga0068855_10000021974 136
377 3300005563 Ga0068855_100029103 Ga0068855_1000291035 136
378 3300005564 Ga0070664_100001899 Ga0070664_1000018998 136
379 3300005564 Ga0070664_100260426 Ga0070664_1002604262 136
380 3300005577 Ga0068857_100001268 Ga0068857_1000012688 136
381 3300005577 Ga0068857_100015971 Ga0068857_1000159712 136
382 3300005577 Ga0068857_100254421 Ga0068857_1002544213 136
383 3300005577 Ga0068857_100295862 Ga0068857_1002958622 136
384 3300005578 Ga0068854_100000800 Ga0068854_10000080014 136
385 3300005578 Ga0068854_101075876 Ga0068854_1010758762 136
386 3300005614 Ga0068856_100003539 Ga0068856_1000035395 136
387 3300005614 Ga0068856_100006383 Ga0068856_1000063832 136
388 3300005614 Ga0068856_100683891 Ga0068856_1006838912 136
389 3300005616 Ga0068852_100009459 Ga0068852_1000094596 136
390 3300005617 Ga0068859_100004490 Ga0068859_10000449014 136
391 3300005617 Ga0068859_100129394 Ga0068859_1001293942 136
392 3300005617 Ga0068859_100379301 Ga0068859_1003793012 136
393 3300005617 Ga0068859_100937593 Ga0068859_1009375932 136
394 3300005618 Ga0068864_100142633 Ga0068864_1001426332 136
395 3300005618 Ga0068864_100247577 Ga0068864_1002475772 136
396 3300005618 Ga0068864_100305042 Ga0068864_1003050422 136
397 3300005719 Ga0068861_100001718 Ga0068861_10000171813 136
398 3300005834 Ga0068851_10404805 Ga0068851_104048051 136
399 3300005840 Ga0068870_10000173 Ga0068870_1000017314 136
400 3300005842 Ga0068858_100018563 Ga0068858_1000185633 136
401 3300005843 Ga0068860_100010782 Ga0068860_1000107822 136
402 3300005843 Ga0068860_100137747 Ga0068860_1001377473 136
403 3300005844 Ga0068862_100000611 Ga0068862_10000061121 136
404 3300006028 Ga0070717_10000681 Ga0070717_1000068117 136
405 3300006028 Ga0070717_10001530 Ga0070717_100015307 136
406 3300006028 Ga0070717_10669980 Ga0070717_106699802 136
407 3300006163 Ga0070715_10155727 Ga0070715_101557272 136
408 3300006173 Ga0070716_100281302 Ga0070716_1002813022 136
409 3300006175 Ga0070712_100367042 Ga0070712_1003670421 136
410 3300006358 Ga0068871_100034860 Ga0068871_1000348604 136
411 3300006844 Ga0075428_100414122 Ga0075428_1004141222 136
412 3300006846 Ga0075430_101099253 Ga0075430_1010992532 136
413 3300006847 Ga0075431_100024903 Ga0075431_1000249034 136
414 3300006847 Ga0075431_101198146 Ga0075431_1011981462 136
415 3300006847 Ga0075431_101659824 Ga0075431_1016598242 136
416 3300006852 Ga0075433_10013373 Ga0075433_100133733 136
417 3300006852 Ga0075433_10037423 Ga0075433_100374237 136
418 3300006871 Ga0075434_100126322 Ga0075434_1001263222 136
419 3300006871 Ga0075434_100328435 Ga0075434_1003284352 136
420 3300006880 Ga0075429_100001122 Ga0075429_10000112211 136
421 3300006914 Ga0075436_100010351 Ga0075436_10001035111 136
422 3300006914 Ga0075436_100051093 Ga0075436_1000510934 136
423 3300006914 Ga0075436_100224672 Ga0075436_1002246722 136
424 3300006931 Ga0097620_100004490 Ga0097620_10000449014 136
425 3300006931 Ga0097620_100129395 Ga0097620_1001293952 136
426 3300006931 Ga0097620_100379307 Ga0097620_1003793072 136
427 3300006931 Ga0097620_100937562 Ga0097620_1009375622 136
428 3300007076 Ga0075435_100011096 Ga0075435_1000110962 136
429 3300007076 Ga0075435_100027776 Ga0075435_1000277762 136
430 3300007076 Ga0075435_100063261 Ga0075435_1000632613 136
431 3300009098 Ga0105245_10449198 Ga0105245_104491982 136
432 3300009101 Ga0105247_10365609 Ga0105247_103656092 136
433 3300009147 Ga0114129_10009751 Ga0114129_100097519 136
434 3300009147 Ga0114129_10566308 Ga0114129_105663082 136
435 3300009147 Ga0114129_11079641 Ga0114129_110796412 136
436 3300009148 Ga0105243_10371785 Ga0105243_103717853 136
437 3300009148 Ga0105243_11014962 Ga0105243_110149622 136
438 3300009174 Ga0105241_10000394 Ga0105241_100003942 136
439 3300009174 Ga0105241_10621389 Ga0105241_106213892 136
440 3300009174 Ga0105241_10986923 Ga0105241_109869232 136
441 3300009176 Ga0105242_10189718 Ga0105242_101897182 136
442 3300009177 Ga0105248_10177030 Ga0105248_101770304 136
443 3300009545 Ga0105237_10004386 Ga0105237_1000438611 136
444 3300009545 Ga0105237_10101218 Ga0105237_101012184 136
445 3300009551 Ga0105238_10230934 Ga0105238_102309343 136
446 3300009551 Ga0105238_11376319 Ga0105238_113763192 136
447 3300009553 Ga0105249_10396233 Ga0105249_103962331 136
448 3300010375 Ga0105239_10816112 Ga0105239_108161122 136
449 3300013100 Ga0157373_10000051 Ga0157373_1000005180 136
450 3300013100 Ga0157373_10185371 Ga0157373_101853712 136
451 3300013102 Ga0157371_10307315 Ga0157371_103073152 136
452 3300013104 Ga0157370_10371724 Ga0157370_103717242 136
453 3300013105 Ga0157369_10025725 Ga0157369_100257252 136
454 3300013306 Ga0163162_10389334 Ga0163162_103893342 136
455 3300013306 Ga0163162_11098915 Ga0163162_110989152 136
456 3300013307 Ga0157372_10001083 Ga0157372_1000108324 136
457 3300013307 Ga0157372_12343289 Ga0157372_123432891 136
458 3300014325 Ga0163163_10062290 Ga0163163_100622904 136
459 3300014745 Ga0157377_10041102 Ga0157377_100411022 136
460 3300014968 Ga0157379_10244762 Ga0157379_102447622 136
461 3300015262 Ga0182007_10029010 Ga0182007_100290102 136
462 3300017792 Ga0163161_10439200 Ga0163161_104392001 136
463 3300020080 Ga0206350_10295288 Ga0206350_102952881 136
464 3300020080 Ga0206350_10646724 Ga0206350_106467241 136
465 3300020610 Ga0154015_1169539 Ga0154015_11695392 136
466 3300020610 Ga0154015_1662471 Ga0154015_16624711 136
467 3300022467 Ga0224712_10010958 Ga0224712_100109583 136
468 3300025885 Ga0207653_10000824 Ga0207653_1000082410 136
469 3300025900 Ga0207710_10075550 Ga0207710_100755502 136
470 3300025903 Ga0207680_10149862 Ga0207680_101498622 136
471 3300025904 Ga0207647_10136191 Ga0207647_101361912 136
472 3300025907 Ga0207645_10000062 Ga0207645_1000006243 136
473 3300025907 Ga0207645_10229836 Ga0207645_102298362 136
474 3300025908 Ga0207643_10000219 Ga0207643_100002198 136
475 3300025909 Ga0207705_10792929 Ga0207705_107929291 136
476 3300025910 Ga0207684_10005095 Ga0207684_1000509512 136
477 3300025910 Ga0207684_10005357 Ga0207684_100053577 136
478 3300025910 Ga0207684_10013567 Ga0207684_100135673 136
479 3300025910 Ga0207684_10051786 Ga0207684_100517863 136
480 3300025910 Ga0207684_10080139 Ga0207684_100801392 136
481 3300025911 Ga0207654_10016553 Ga0207654_100165532 136
482 3300025911 Ga0207654_10987586 Ga0207654_109875862 136
483 3300025912 Ga0207707_10000047 Ga0207707_1000004741 136
484 3300025912 Ga0207707_10080058 Ga0207707_100800584 136
485 3300025912 Ga0207707_10154217 Ga0207707_101542172 136
486 3300025912 Ga0207707_10200898 Ga0207707_102008982 136
487 3300025914 Ga0207671_10016883 Ga0207671_100168834 136
488 3300025914 Ga0207671_10365736 Ga0207671_103657362 136
489 3300025916 Ga0207663_10074795 Ga0207663_100747953 136
490 3300025917 Ga0207660_10001817 Ga0207660_100018173 136
491 3300025917 Ga0207660_11411135 Ga0207660_114111351 136
492 3300025918 Ga0207662_11067552 Ga0207662_110675522 136
493 3300025919 Ga0207657_10000021 Ga0207657_1000002192 136
494 3300025920 Ga0207649_10008334 Ga0207649_100083344 136
495 3300025920 Ga0207649_10373260 Ga0207649_103732602 136
496 3300025921 Ga0207652_10000922 Ga0207652_1000092216 136
497 3300025921 Ga0207652_10016152 Ga0207652_100161525 136
498 3300025921 Ga0207652_10170693 Ga0207652_101706932 136
499 3300025922 Ga0207646_10001275 Ga0207646_1000127523 136
500 3300025922 Ga0207646_10006816 Ga0207646_100068167 136
501 3300025922 Ga0207646_10009589 Ga0207646_100095894 136
502 3300025922 Ga0207646_10011893 Ga0207646_100118933 136
503 3300025922 Ga0207646_10061957 Ga0207646_100619572 136
504 3300025922 Ga0207646_10064236 Ga0207646_100642364 136
505 3300025922 Ga0207646_10106352 Ga0207646_101063521 136
506 3300025922 Ga0207646_10167098 Ga0207646_101670982 136
507 3300025922 Ga0207646_10260137 Ga0207646_102601372 136
508 3300025923 Ga0207681_10031576 Ga0207681_100315762 136
509 3300025924 Ga0207694_10069964 Ga0207694_100699641 136
510 3300025924 Ga0207694_10884110 Ga0207694_108841102 136
511 3300025925 Ga0207650_10015740 Ga0207650_100157402 136
512 3300025927 Ga0207687_10299589 Ga0207687_102995892 136
513 3300025928 Ga0207700_10065566 Ga0207700_100655663 136
514 3300025928 Ga0207700_10114039 Ga0207700_101140392 136
515 3300025932 Ga0207690_10004322 Ga0207690_100043227 136
516 3300025932 Ga0207690_10763568 Ga0207690_107635682 136
517 3300025933 Ga0207706_10005155 Ga0207706_100051552 136
518 3300025934 Ga0207686_10615159 Ga0207686_106151592 136
519 3300025935 Ga0207709_10193929 Ga0207709_101939292 136
520 3300025935 Ga0207709_11608687 Ga0207709_116086871 136
521 3300025936 Ga0207670_10024124 Ga0207670_100241242 136
522 3300025937 Ga0207669_10873078 Ga0207669_108730781 136
523 3300025939 Ga0207665_10134477 Ga0207665_101344772 136
524 3300025941 Ga0207711_10131410 Ga0207711_101314104 136
525 3300025941 Ga0207711_10281233 Ga0207711_102812332 136
526 3300025942 Ga0207689_10000516 Ga0207689_1000051612 136
527 3300025942 Ga0207689_10130414 Ga0207689_101304142 136
528 3300025944 Ga0207661_10001421 Ga0207661_100014211 136
529 3300025944 Ga0207661_10193629 Ga0207661_101936293 136
530 3300025945 Ga0207679_10000705 Ga0207679_1000070510 136
531 3300025945 Ga0207679_10804514 Ga0207679_108045142 136
532 3300025945 Ga0207679_10928523 Ga0207679_109285232 136
533 3300025949 Ga0207667_10005241 Ga0207667_100052414 136
534 3300025961 Ga0207712_10436679 Ga0207712_104366793 136
535 3300025981 Ga0207640_10005506 Ga0207640_100055065 136
536 3300025981 Ga0207640_10795682 Ga0207640_107956822 136
537 3300025981 Ga0207640_11092251 Ga0207640_110922512 136
538 3300025986 Ga0207658_10068623 Ga0207658_100686234 136
539 3300026035 Ga0207703_10247677 Ga0207703_102476773 136
540 3300026035 Ga0207703_10889950 Ga0207703_108899502 136
541 3300026041 Ga0207639_10010246 Ga0207639_100102462 136
542 3300026041 Ga0207639_10076362 Ga0207639_100763623 136
543 3300026041 Ga0207639_10932104 Ga0207639_109321042 136
544 3300026067 Ga0207678_10001391 Ga0207678_100013918 136
545 3300026067 Ga0207678_10839978 Ga0207678_108399782 136
546 3300026075 Ga0207708_10040893 Ga0207708_100408933 136
547 3300026078 Ga0207702_10001148 Ga0207702_1000114815 136
548 3300026078 Ga0207702_10016684 Ga0207702_100166846 136
549 3300026088 Ga0207641_10035878 Ga0207641_100358782 136
550 3300026089 Ga0207648_10009287 Ga0207648_100092874 136
551 3300026089 Ga0207648_10466842 Ga0207648_104668422 136
552 3300026089 Ga0207648_10887512 Ga0207648_108875122 136
553 3300026095 Ga0207676_10148550 Ga0207676_101485503 136
554 3300026095 Ga0207676_10208545 Ga0207676_102085452 136
555 3300026116 Ga0207674_10000137 Ga0207674_1000013716 136
556 3300026116 Ga0207674_10080429 Ga0207674_100804292 136
557 3300026116 Ga0207674_10874622 Ga0207674_108746222 136
558 3300026118 Ga0207675_100005591 Ga0207675_1000055915 136
559 3300026118 Ga0207675_100108774 Ga0207675_1001087743 136
560 3300026142 Ga0207698_10013879 Ga0207698_100138793 136
561 3300028380 Ga0268265_10008195 Ga0268265_100081953 136
562 3300028380 Ga0268265_10124103 Ga0268265_101241034 136
563 3300028381 Ga0268264_10255667 Ga0268264_102556672 136
564 3300028381 Ga0268264_11679737 Ga0268264_116797372 136
565 3300028381 Ga0268264_12226500 Ga0268264_122265001 136
566 3300028800 Ga0265338_10021958 Ga0265338_100219582 136
567 3300031901 Ga0307406_11111089 Ga0307406_111110892 136
568 3300031903 Ga0307407_10179460 Ga0307407_101794602 136
569 3300031903 Ga0307407_10991351 Ga0307407_109913512 136
570 3300031911 Ga0307412_10594322 Ga0307412_105943222 136
571 3300031995 Ga0307409_100388941 Ga0307409_1003889411 136
572 3300031995 Ga0307409_100390543 Ga0307409_1003905432 136
573 3300032002 Ga0307416_100036888 Ga0307416_1000368882 136
574 3300032002 Ga0307416_101002724 Ga0307416_1010027241 136
575 3300032002 Ga0307416_101335460 Ga0307416_1013354601 136
576 3300032004 Ga0307414_10053595 Ga0307414_100535954 136
577 3300032126 Ga0307415_100145941 Ga0307415_1001459411 136
578 3300034817 Ga0373948_0007310 Ga0373948_0007310_337_792 136
579 3300034818 Ga0373950_0005212 Ga0373950_0005212_210_665 136
580 3300035085 Ga0373929_0030774 Ga0373929_0030774_415_870 136
581 3300035117 Ga0373953_0030319 Ga0373953_0030319_950_1366 136
582 3300035121 Ga0373960_0021009 Ga0373960_0021009_916_1371 136
583 3300035242 Ga0373962_0086344 Ga0373962_0086344_270_725 136
584 3300036401 Ga0373937_0464517 Ga0373937_0464517_343_756 136
585 3300036401 Ga0373937_0658199 Ga0373937_0658199_36_452 136
586 3300037068 Ga0373925_1683592 Ga0373925_1683592_24_440 136
587 3300042005 Ga0439448_0012354 Ga0439448_0012354_154_609 136
588 3300042438 Ga0439459_0007577 Ga0439459_0007577_548_1003 136
589 3300042876 Ga0451577_0007768 Ga0451577_0007768_9974_10429 136
590 3300044712 Ga0453684_0097361 Ga0453684_0097361_209_664 136
591 3300044712 Ga0453684_0654914 Ga0453684_0654914_470_883 136
592 3300045051 Ga0451576_0421452 Ga0451576_0421452_285_701 136
593 3300045051 Ga0451576_0435155 Ga0451576_0435155_394_849 136
594 3300046514 Ga0495618_0020262 Ga0495618_0020262_798_1220 136
595 3300046516 Ga0495628_0037485 Ga0495628_0037485_382_804 136
596 3300046517 Ga0495630_0057279 Ga0495630_0057279_225_647 136
597 3300046533 Ga0495640_0086872 Ga0495640_0086872_1636_2058 136
598 3300046535 Ga0495586_0155989 Ga0495586_0155989_726_1148 136
599 3300046642 Ga0495634_0116211 Ga0495634_0116211_1252_1674 136
600 3300047319 Ga0495674_0434742 Ga0495674_0434742_600_1022 136
601 3300047472 Ga0495686_0463077 Ga0495686_0463077_59_475 136
602 3300048904 Ga0496101_1295154 Ga0496101_1295154_50_526 136
603 3300048905 Ga0496102_0571845 Ga0496102_0571845_229_642 136
604 3300048907 Ga0496104_0003857 Ga0496104_0003857_5847_6323 136
605 3300048908 Ga0496105_0001646 Ga0496105_0001646_11639_12115 136
606 3300048909 Ga0496106_0047042 Ga0496106_0047042_272_727 136
607 3300048909 Ga0496106_0569942 Ga0496106_0569942_105_581 136
608 3300048910 Ga0496107_0094047 Ga0496107_0094047_475_951 136
609 3300048912 Ga0496109_0376060 Ga0496109_0376060_569_1024 136
610 3300048915 Ga0496112_0169415 Ga0496112_0169415_1609_2103 136
611 3300048915 Ga0496112_0472587 Ga0496112_0472587_752_1168 136
612 3300048915 Ga0496112_0750895 Ga0496112_0750895_45_461 136
613 3300048916 Ga0496113_0921183 Ga0496113_0921183_215_631 136
614 3300048917 Ga0496114_0004681 Ga0496114_0004681_4468_4944 136
615 3300048918 Ga0496115_0007377 Ga0496115_0007377_6656_7132 136
616 3300049573 Ga0501037_0104159 Ga0501037_0104159_1374_1790 136
617 3300049576 Ga0501040_0116812 Ga0501040_0116812_1141_1638 136
618 3300049580 Ga0501046_0115465 Ga0501046_0115465_1012_1509 136
619 3300049584 Ga0501068_0289680 Ga0501068_0289680_171_584 136
620 3300049592 Ga0501076_1031146 Ga0501076_1031146_125_622 136
621 3300049650 Ga0501199_031090 Ga0501199_031090_36_452 136
622 3300049652 Ga0501202_166165 Ga0501202_166165_15_431 136
623 3300049669 Ga0501235_161569 Ga0501235_161569_17_442 136
624 3300049686 Ga0501257_117665 Ga0501257_117665_94_510 136
625 3300049823 Ga0501044_0063758 Ga0501044_0063758_1351_1767 136
626 3300049823 Ga0501044_0501574 Ga0501044_0501574_40_456 136
627 3300049824 Ga0501045_0164502 Ga0501045_0164502_273_770 136
628 3300050507 nmdc:mga05p37_123539_c1 nmdc:mga05p37_123539_c1_2745_3161 136
629 3300050507 nmdc:mga05p37_515006_c1 nmdc:mga05p37_515006_c1_247_687 136
630 3300050507 nmdc:mga05p37_74471_c1 nmdc:mga05p37_74471_c1_864_1277 136
631 3300050507 nmdc:mga05p37_830811_c1 nmdc:mga05p37_830811_c1_433_849 136
632 3300050508 nmdc:mga09592_16057_c1 nmdc:mga09592_16057_c1_2390_2806 136
633 3300050508 nmdc:mga09592_224516_c1 nmdc:mga09592_224516_c1_911_1324 136
634 3300050510 nmdc:mga06r32_1080124_c1 nmdc:mga06r32_1080124_c1_131_544 136
635 3300050510 nmdc:mga06r32_429174_c1 nmdc:mga06r32_429174_c1_628_1041 136
636 3300050510 nmdc:mga06r32_69950_c1 nmdc:mga06r32_69950_c1_2809_3225 136
637 3300050512 nmdc:mga0n895_1247225_c1 nmdc:mga0n895_1247225_c1_244_660 136
638 3300050512 nmdc:mga0n895_236865_c1 nmdc:mga0n895_236865_c1_1374_1814 136
639 3300050512 nmdc:mga0n895_262738_c1 nmdc:mga0n895_262738_c1_855_1310 136
640 3300050513 nmdc:mga0rr50_1259854_c1 nmdc:mga0rr50_1259854_c1_15_476 136
641 3300050513 nmdc:mga0rr50_1435232_c1 nmdc:mga0rr50_1435232_c1_116_529 136
642 3300050513 nmdc:mga0rr50_448015_c1 nmdc:mga0rr50_448015_c1_571_1026 136
643 3300050513 nmdc:mga0rr50_62886_c1 nmdc:mga0rr50_62886_c1_985_1401 136
644 3300050514 nmdc:mga08x19_38580_c1 nmdc:mga08x19_38580_c1_2055_2480 136
645 3300050514 nmdc:mga08x19_85527_c1 nmdc:mga08x19_85527_c1_548_961 136
646 3300050515 nmdc:mga0a205_10622_c1 nmdc:mga0a205_10622_c1_3782_4198 136
647 3300050515 nmdc:mga0a205_16621_c1 nmdc:mga0a205_16621_c1_2254_2694 136
648 3300053077 Ga0495601_1053237 Ga0495601_1053237_82_498 136
649 3300049588 Ga0501072_0679305 Ga0501072_0679305_87_509 139
650 3300049591 Ga0501075_0691354 Ga0501075_0691354_129_551 139
651 3300049592 Ga0501076_0430081 Ga0501076_0430081_16_438 139
652 3300049741 Ga0501079_0410973 Ga0501079_0410973_471_893 139
653 3300049742 Ga0501080_0882551 Ga0501080_0882551_239_661 139
654 3300054114 Ga0501084_0512701 Ga0501084_0512701_455_877 139
655 3300060353 Ga0501082_0740056 Ga0501082_0740056_239_661 139
656 3300003322 rootL2_10046681 rootL2_100466813 148
657 3300049583 Ga0501067_0046842 Ga0501067_0046842_195_647 148
658 3300049585 Ga0501069_0168077 Ga0501069_0168077_171_623 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12903

DUF3830

Protein of unknown function (DUF3830)

27

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7874 6 148
3x27-assembly2.cif.gz_C structure of mcbb in complex with tryptophan 0.7704 8 146
3kop-assembly1.cif.gz_F crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7652 6 148
3kop-assembly1.cif.gz_B crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.7579 6 148
3kop-assembly1.cif.gz_D crystal structure of protein with a cyclophilin-like fold (yp_831253.1) from arthrobacter sp. fb24 at 1.90 a resolution 0.752 6 148
ID Description Score Start End Superfamily
3x27B01 Mainly Beta;Beta Barrel;Cyclophilin; 0.7724 8 146 2.40.100.20
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.7573 5 148 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.75 8 148 2.40.100.20
3kopF01 Mainly Beta;Beta Barrel;Cyclophilin; 0.734 5 148 2.40.100.20
2ka0A00 Mainly Beta;Beta Barrel;Cyclophilin; 0.7239 8 148 2.40.100.20
ID Description Score Start End GO Terms
AF-A0A522AQS3-F1-model_v4 DUF3830 family protein 0.9746 7 101
AF-A0A537UNQ7-F1-model_v4 DUF3830 family protein 0.9608 5 114
AF-T1XAE7-F1-model_v4 Cyclophilin-like superfamily protein 0.9598 15 146
AF-A0A538HA05-F1-model_v4 DUF3830 family protein 0.9588 8 148
AF-A0A2M6VRG0-F1-model_v4 Cyclophilin-like superfamily protein 0.9562 5 148

Feature Viewer

pLDDT pTM Quality
93.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map