F473208
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 658 | 344 | 568 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0035577|Ga0501031_0035577_244_1455 |
| Length | 403 |
| Sequence | MSEPDFTCRRLQFRVGRGAFSPAMRKLGVHRALSRNRHRTYPALSRGGGAMRGETGKPVDSALQEFSVSKSFKFRLAALALATSFAANAFASDVTGAGASFVYPAMSKWSSDYKAATGKEVNYQSIGSGGGIAQIKAGTVDFGSSDKPLPPDELARSGLAQFPSVIGGVVPAFNLPGVAAGAMKLDPDVLADIFLGKITMWDDARIAATNRGISLPSQKITVVHRSDGSGTSFNFTNYLSKVSPEWKSKVGEGTAVKWPVGIGGKGNEGVSAYIKQIKGSIGYVELAYAIQNKVPYSRLKNAAGNYVNPSDDSFAEAAASADWKSAKDFFLVVTNAPGQNAWPITATNFMLVHKDGKPGTKAAIEFFRWVYANGDDAATSLGYVPLPDSLVQQIQGYWTQNVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 3 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 4 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 5 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 6 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 7 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 8 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 9 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 10 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 11 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 12 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 13 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 14 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 15 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 16 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 17 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 18 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 19 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 20 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 21 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 22 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 23 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 24 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 25 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 26 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 27 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 28 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 29 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 30 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 31 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 32 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 33 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 34 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 35 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 36 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 37 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 38 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 39 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 40 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 41 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 42 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 43 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 44 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 45 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 46 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 47 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 48 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 49 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 50 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 51 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 52 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 53 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 54 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 55 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 56 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 57 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 58 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 59 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 60 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 61 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 62 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 63 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 64 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 66 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 71 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 73 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 131 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 216 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 217 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 218 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 232 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 234 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 235 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 245 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 246 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 249 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 294 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 321 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 342 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 343 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 344 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.06 |
| Metatranscriptomes | 0.61 |
| Isolates | 10.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 16.57 |
| Nodule | 0.15 |
| Rhizoplane | 2.89 |
| Rhizosphere | 69.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_42121 | 2162886007 | Bacteria | 2391 |
| 2 | JGI24741J21665_1002078 | 3300001915 | Bacteria | 5357 |
| 3 | JGI25152J39213_1000252 | 3300002773 | Bacteria | 35837 |
| 4 | JGI25150J39212_1000322 | 3300002774 | Bacteria | 23553 |
| 5 | JGI25151J46595_10000183 | 3300003187 | Bacteria | 78518 |
| 6 | JGI25151J46595_10000522 | 3300003187 | Bacteria | 35846 |
| 7 | JGI25153J46596_10000311 | 3300003215 | Bacteria | 35846 |
| 8 | Ga0055526_1000036 | 3300003771 | Bacteria | 135235 |
| 9 | Ga0055526_1001709 | 3300003771 | Bacteria | 15305 |
| 10 | Ga0055526_1009464 | 3300003771 | Bacteria | 4679 |
| 11 | Ga0055537_1000083 | 3300003773 | Bacteria | 68713 |
| 12 | Ga0055537_1000392 | 3300003773 | Bacteria | 29390 |
| 13 | Ga0055524_1000359 | 3300003775 | Bacteria | 41002 |
| 14 | Ga0055536_1001515 | 3300003781 | Bacteria | 13941 |
| 15 | Ga0055536_1003198 | 3300003781 | Bacteria | 8877 |
| 16 | Ga0055536_1004862 | 3300003781 | Bacteria | 6710 |
| 17 | Ga0055536_1009027 | 3300003781 | Bacteria | 4194 |
| 18 | Ga0055534_1000103 | 3300003784 | Bacteria | 65838 |
| 19 | Ga0055534_1000328 | 3300003784 | Bacteria | 31317 |
| 20 | Ga0055528_1000004 | 3300003790 | Bacteria | 285772 |
| 21 | Ga0055528_1000115 | 3300003790 | Bacteria | 64238 |
| 22 | Ga0055530_10003828 | 3300003791 | Bacteria | 8267 |
| 23 | Ga0055531_10011297 | 3300003794 | Bacteria | 4326 |
| 24 | Ga0055531_10011726 | 3300003794 | Bacteria | 4194 |
| 25 | Ga0055531_10017094 | 3300003794 | Bacteria | 3082 |
| 26 | Ga0058692_1000002 | 3300003856 | Bacteria | 508401 |
| 27 | Ga0058692_1000020 | 3300003856 | Bacteria | 250589 |
| 28 | Ga0065704_10006659 | 3300005289 | Bacteria | 2517 |
| 29 | Ga0065704_10073140 | 3300005289 | Bacteria | 7543 |
| 30 | Ga0065704_10080768 | 3300005289 | Bacteria | 3883 |
| 31 | Ga0065715_10194591 | 3300005293 | Bacteria | 1395 |
| 32 | Ga0070670_100000064 | 3300005331 | Bacteria | 110044 |
| 33 | Ga0070670_100001108 | 3300005331 | Bacteria | 21408 |
| 34 | Ga0070670_100062560 | 3300005331 | Bacteria | 3195 |
| 35 | Ga0070666_10037596 | 3300005335 | Bacteria | 3219 |
| 36 | Ga0070666_10112566 | 3300005335 | Bacteria | 1883 |
| 37 | Ga0070680_100000405 | 3300005336 | Bacteria | 29476 |
| 38 | Ga0070680_100008797 | 3300005336 | Bacteria | 7746 |
| 39 | Ga0070660_100026051 | 3300005339 | Bacteria | 4352 |
| 40 | Ga0070660_100037696 | 3300005339 | Bacteria | 3664 |
| 41 | Ga0070661_100004480 | 3300005344 | Bacteria | 9633 |
| 42 | Ga0070661_100254797 | 3300005344 | Bacteria | 1355 |
| 43 | Ga0070661_100383441 | 3300005344 | Bacteria | 1108 |
| 44 | Ga0070692_10011935 | 3300005345 | Bacteria | 4005 |
| 45 | Ga0070668_100005796 | 3300005347 | Bacteria | 9162 |
| 46 | Ga0070668_100050653 | 3300005347 | Bacteria | 3198 |
| 47 | Ga0070668_100075087 | 3300005347 | Bacteria | 2638 |
| 48 | Ga0070668_100278924 | 3300005347 | Bacteria | 1395 |
| 49 | Ga0070669_100012001 | 3300005353 | Bacteria | 6149 |
| 50 | Ga0070669_100088864 | 3300005353 | Bacteria | 2313 |
| 51 | Ga0070669_100301564 | 3300005353 | Bacteria | 1289 |
| 52 | Ga0070671_100000025 | 3300005355 | Bacteria | 121912 |
| 53 | Ga0070671_100004291 | 3300005355 | Bacteria | 11282 |
| 54 | Ga0070671_100102580 | 3300005355 | Bacteria | 2400 |
| 55 | Ga0070671_100135430 | 3300005355 | Bacteria | 2077 |
| 56 | Ga0070674_100051839 | 3300005356 | Bacteria | 2829 |
| 57 | Ga0070674_100281229 | 3300005356 | Bacteria | 1319 |
| 58 | Ga0070688_100002099 | 3300005365 | Bacteria | 10058 |
| 59 | Ga0070659_100003974 | 3300005366 | Bacteria | 10527 |
| 60 | Ga0070667_100000012 | 3300005367 | Bacteria | 258575 |
| 61 | Ga0070667_100000095 | 3300005367 | Bacteria | 109595 |
| 62 | Ga0070663_100000126 | 3300005455 | Bacteria | 36101 |
| 63 | Ga0070663_100011268 | 3300005455 | Bacteria | 5605 |
| 64 | Ga0070663_100027309 | 3300005455 | Bacteria | 3875 |
| 65 | Ga0070678_100120271 | 3300005456 | Bacteria | 2070 |
| 66 | Ga0070678_100134573 | 3300005456 | Bacteria | 1969 |
| 67 | Ga0070681_10003393 | 3300005458 | Bacteria | 14907 |
| 68 | Ga0070685_10000005 | 3300005466 | Bacteria | 190119 |
| 69 | Ga0070679_100000681 | 3300005530 | Bacteria | 29079 |
| 70 | Ga0070679_100002883 | 3300005530 | Bacteria | 15619 |
| 71 | Ga0068853_100000768 | 3300005539 | Bacteria | 22263 |
| 72 | Ga0068853_100008635 | 3300005539 | Bacteria | 8193 |
| 73 | Ga0068853_100042082 | 3300005539 | Bacteria | 3905 |
| 74 | Ga0070696_100007449 | 3300005546 | Bacteria | 7320 |
| 75 | Ga0070693_100000911 | 3300005547 | Bacteria | 13154 |
| 76 | Ga0070693_100022123 | 3300005547 | Bacteria | 3375 |
| 77 | Ga0070665_100000077 | 3300005548 | Bacteria | 188308 |
| 78 | Ga0070665_100007283 | 3300005548 | Bacteria | 11249 |
| 79 | Ga0070665_100015383 | 3300005548 | Bacteria | 7683 |
| 80 | Ga0070665_100036667 | 3300005548 | Bacteria | 4930 |
| 81 | Ga0070665_100061222 | 3300005548 | Bacteria | 3772 |
| 82 | Ga0070665_100092750 | 3300005548 | Bacteria | 3025 |
| 83 | Ga0070665_100094082 | 3300005548 | Bacteria | 3002 |
| 84 | Ga0070665_100127021 | 3300005548 | Bacteria | 2552 |
| 85 | Ga0070665_100314230 | 3300005548 | Bacteria | 1571 |
| 86 | Ga0068855_100001280 | 3300005563 | Bacteria | 31168 |
| 87 | Ga0068855_100030800 | 3300005563 | Bacteria | 6414 |
| 88 | Ga0068855_100046292 | 3300005563 | Bacteria | 5143 |
| 89 | Ga0068855_100046906 | 3300005563 | Bacteria | 5106 |
| 90 | Ga0070664_100120811 | 3300005564 | Bacteria | 2294 |
| 91 | Ga0070664_100264376 | 3300005564 | Bacteria | 1548 |
| 92 | Ga0068857_100057901 | 3300005577 | Bacteria | 3440 |
| 93 | Ga0068854_100005144 | 3300005578 | Bacteria | 8248 |
| 94 | Ga0068854_100011728 | 3300005578 | Bacteria | 5718 |
| 95 | Ga0068854_100160550 | 3300005578 | Bacteria | 1740 |
| 96 | Ga0068856_100000234 | 3300005614 | Bacteria | 60217 |
| 97 | Ga0068852_100014711 | 3300005616 | Bacteria | 6036 |
| 98 | Ga0068852_100058737 | 3300005616 | Bacteria | 3333 |
| 99 | Ga0068852_100142938 | 3300005616 | Bacteria | 2216 |
| 100 | Ga0068859_100003094 | 3300005617 | Bacteria | 16887 |
| 101 | Ga0068859_100007853 | 3300005617 | Bacteria | 10828 |
| 102 | Ga0068864_100000073 | 3300005618 | Bacteria | 109681 |
| 103 | Ga0068863_100013677 | 3300005841 | Bacteria | 7824 |
| 104 | Ga0068863_100438673 | 3300005841 | Bacteria | 1280 |
| 105 | Ga0068858_100106608 | 3300005842 | Bacteria | 2615 |
| 106 | Ga0068860_100002476 | 3300005843 | Bacteria | 19371 |
| 107 | Ga0068860_100018691 | 3300005843 | Bacteria | 6739 |
| 108 | Ga0068860_100163794 | 3300005843 | Bacteria | 2145 |
| 109 | Ga0068862_100000164 | 3300005844 | Bacteria | 73885 |
| 110 | Ga0068862_100001217 | 3300005844 | Bacteria | 24281 |
| 111 | Ga0068862_100009079 | 3300005844 | Bacteria | 8228 |
| 112 | Ga0081539_10015349 | 3300005985 | Bacteria | 5573 |
| 113 | Ga0075364_10000438 | 3300006051 | Bacteria | 20844 |
| 114 | Ga0075364_10001495 | 3300006051 | Bacteria | 12727 |
| 115 | Ga0075364_10006217 | 3300006051 | Bacteria | 7003 |
| 116 | Ga0075364_10042688 | 3300006051 | Bacteria | 2947 |
| 117 | Ga0075364_10053176 | 3300006051 | Bacteria | 2647 |
| 118 | Ga0075364_10185020 | 3300006051 | Bacteria | 1410 |
| 119 | Ga0075362_10002219 | 3300006177 | Bacteria | 6450 |
| 120 | Ga0075367_10003075 | 3300006178 | Bacteria | 7830 |
| 121 | Ga0075367_10008976 | 3300006178 | Bacteria | 5205 |
| 122 | Ga0075366_10003119 | 3300006195 | Bacteria | 8670 |
| 123 | Ga0097621_100089419 | 3300006237 | Bacteria | 2575 |
| 124 | Ga0075434_100149224 | 3300006871 | Bacteria | 2358 |
| 125 | Ga0068865_100115328 | 3300006881 | Bacteria | 1988 |
| 126 | Ga0068865_100192517 | 3300006881 | Bacteria | 1578 |
| 127 | Ga0097620_100003094 | 3300006931 | Bacteria | 16887 |
| 128 | Ga0097620_100007853 | 3300006931 | Bacteria | 10828 |
| 129 | Ga0105251_10000010 | 3300009011 | Bacteria | 186242 |
| 130 | Ga0105251_10007369 | 3300009011 | Bacteria | 6795 |
| 131 | Ga0105244_10007676 | 3300009036 | Bacteria | 6835 |
| 132 | Ga0105240_10020333 | 3300009093 | Bacteria | 8859 |
| 133 | Ga0111539_10052153 | 3300009094 | Bacteria | 4869 |
| 134 | Ga0105243_10010816 | 3300009148 | Bacteria | 6905 |
| 135 | Ga0105243_10117107 | 3300009148 | Bacteria | 2239 |
| 136 | Ga0105241_10516019 | 3300009174 | Bacteria | 1068 |
| 137 | Ga0105248_10000179 | 3300009177 | Bacteria | 73845 |
| 138 | Ga0105237_10000348 | 3300009545 | Bacteria | 65042 |
| 139 | Ga0105237_10002762 | 3300009545 | Bacteria | 21342 |
| 140 | Ga0105237_10126843 | 3300009545 | Bacteria | 2546 |
| 141 | Ga0105238_10238095 | 3300009551 | Bacteria | 1797 |
| 142 | Ga0105238_10433190 | 3300009551 | Bacteria | 1311 |
| 143 | Ga0105249_10000262 | 3300009553 | Bacteria | 56551 |
| 144 | Ga0105249_10414300 | 3300009553 | Bacteria | 1380 |
| 145 | Ga0105032_102285 | 3300009979 | Bacteria | 1721 |
| 146 | Ga0105239_10000401 | 3300010375 | Bacteria | 63434 |
| 147 | Ga0105239_10095895 | 3300010375 | Bacteria | 3277 |
| 148 | Ga0105239_10162004 | 3300010375 | Bacteria | 2499 |
| 149 | Ga0157318_1000466 | 3300012482 | Bacteria | 1725 |
| 150 | Ga0157327_1001669 | 3300012512 | Bacteria | 1432 |
| 151 | Ga0157373_10019579 | 3300013100 | Bacteria | 4923 |
| 152 | Ga0157373_10063523 | 3300013100 | Bacteria | 2614 |
| 153 | Ga0157373_10086535 | 3300013100 | Bacteria | 2208 |
| 154 | Ga0157371_10037059 | 3300013102 | Bacteria | 3492 |
| 155 | Ga0157371_10066765 | 3300013102 | Bacteria | 2547 |
| 156 | Ga0157370_10011223 | 3300013104 | Bacteria | 9394 |
| 157 | Ga0157370_10017572 | 3300013104 | Bacteria | 7216 |
| 158 | Ga0157370_10017945 | 3300013104 | Bacteria | 7126 |
| 159 | Ga0157370_10083337 | 3300013104 | Bacteria | 3006 |
| 160 | Ga0157370_10156688 | 3300013104 | Bacteria | 2119 |
| 161 | Ga0157369_10001849 | 3300013105 | Bacteria | 25579 |
| 162 | Ga0157369_10042343 | 3300013105 | Bacteria | 4968 |
| 163 | Ga0157369_10162220 | 3300013105 | Bacteria | 2359 |
| 164 | Ga0157369_10294003 | 3300013105 | Bacteria | 1691 |
| 165 | Ga0157374_10014089 | 3300013296 | Bacteria | 6990 |
| 166 | Ga0157372_10000421 | 3300013307 | Bacteria | 46585 |
| 167 | Ga0157372_10214716 | 3300013307 | Bacteria | 2229 |
| 168 | Ga0157372_10263919 | 3300013307 | Bacteria | 2000 |
| 169 | Ga0163163_10001573 | 3300014325 | Bacteria | 19239 |
| 170 | Ga0182008_10002138 | 3300014497 | Bacteria | 12596 |
| 171 | Ga0157377_10038115 | 3300014745 | Unclassified | 2652 |
| 172 | Ga0157379_10110387 | 3300014968 | Bacteria | 2470 |
| 173 | Ga0182005_1004408 | 3300015265 | Bacteria | 4557 |
| 174 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 175 | Ga0197907_11154955 | 3300020069 | Bacteria | 1653 |
| 176 | Ga0206352_10574363 | 3300020078 | Bacteria | 1465 |
| 177 | Ga0206354_11590007 | 3300020081 | Bacteria | 2432 |
| 178 | Ga0154015_1567256 | 3300020610 | Bacteria | 6123 |
| 179 | Ga0207425_1000283 | 3300025245 | Bacteria | 37349 |
| 180 | Ga0209646_1003226 | 3300025246 | Bacteria | 3271 |
| 181 | Ga0209026_1000162 | 3300025250 | Bacteria | 102867 |
| 182 | Ga0209759_1000906 | 3300025256 | Bacteria | 22092 |
| 183 | Ga0209129_1000365 | 3300025258 | Bacteria | 37356 |
| 184 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 185 | Ga0209565_1000014 | 3300025263 | Bacteria | 530302 |
| 186 | Ga0209455_1000261 | 3300025272 | Bacteria | 60720 |
| 187 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 188 | Ga0209673_1000623 | 3300025273 | Bacteria | 54075 |
| 189 | Ga0209130_1026971 | 3300025284 | Bacteria | 1225 |
| 190 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 191 | Ga0209675_1000021 | 3300025291 | Bacteria | 334833 |
| 192 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 193 | Ga0209676_1000047 | 3300025292 | Bacteria | 408645 |
| 194 | Ga0209676_1000079 | 3300025292 | Bacteria | 290447 |
| 195 | Ga0209676_1001198 | 3300025292 | Bacteria | 27768 |
| 196 | Ga0209676_1005540 | 3300025292 | Bacteria | 6545 |
| 197 | Ga0209676_1019683 | 3300025292 | Bacteria | 2315 |
| 198 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 199 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 200 | Ga0209025_1007720 | 3300025294 | Bacteria | 7936 |
| 201 | Ga0209025_1022654 | 3300025294 | Bacteria | 3320 |
| 202 | Ga0209025_1027256 | 3300025294 | Bacteria | 2838 |
| 203 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 204 | Ga0209564_1000263 | 3300025295 | Bacteria | 112148 |
| 205 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 206 | Ga0209758_1011751 | 3300025297 | Bacteria | 5019 |
| 207 | Ga0209758_1017780 | 3300025297 | Bacteria | 3517 |
| 208 | Ga0209050_1000153 | 3300025298 | Bacteria | 160851 |
| 209 | Ga0209050_1001146 | 3300025298 | Bacteria | 31752 |
| 210 | Ga0209050_1011617 | 3300025298 | Bacteria | 4148 |
| 211 | Ga0209050_1031241 | 3300025298 | Bacteria | 1663 |
| 212 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 213 | Ga0209256_1005467 | 3300025299 | Bacteria | 7296 |
| 214 | Ga0209051_1001823 | 3300025303 | Bacteria | 16847 |
| 215 | Ga0209051_1006438 | 3300025303 | Bacteria | 6612 |
| 216 | Ga0209051_1010564 | 3300025303 | Bacteria | 4643 |
| 217 | Ga0209257_1000081 | 3300025304 | Bacteria | 306577 |
| 218 | Ga0209257_1000148 | 3300025304 | Bacteria | 193131 |
| 219 | Ga0209257_1000988 | 3300025304 | Bacteria | 38563 |
| 220 | Ga0209257_1001062 | 3300025304 | Bacteria | 36333 |
| 221 | Ga0209257_1001483 | 3300025304 | Bacteria | 27558 |
| 222 | Ga0209257_1004325 | 3300025304 | Bacteria | 11138 |
| 223 | Ga0209257_1015480 | 3300025304 | Bacteria | 3170 |
| 224 | Ga0207656_10045037 | 3300025321 | Bacteria | 1886 |
| 225 | Ga0207713_1000292 | 3300025735 | Bacteria | 57738 |
| 226 | Ga0207647_10000467 | 3300025904 | Bacteria | 32759 |
| 227 | Ga0207647_10108731 | 3300025904 | Bacteria | 1640 |
| 228 | Ga0207705_10000532 | 3300025909 | Bacteria | 32283 |
| 229 | Ga0207707_10000229 | 3300025912 | Bacteria | 60350 |
| 230 | Ga0207707_10000241 | 3300025912 | Bacteria | 59575 |
| 231 | Ga0207707_10000607 | 3300025912 | Bacteria | 36033 |
| 232 | Ga0207707_10003687 | 3300025912 | Bacteria | 13581 |
| 233 | Ga0207707_10173209 | 3300025912 | Bacteria | 1886 |
| 234 | Ga0207695_10021839 | 3300025913 | Bacteria | 7289 |
| 235 | Ga0207695_10107679 | 3300025913 | Bacteria | 2772 |
| 236 | Ga0207695_10120705 | 3300025913 | Bacteria | 2590 |
| 237 | Ga0207695_10173677 | 3300025913 | Bacteria | 2079 |
| 238 | Ga0207671_10000167 | 3300025914 | Bacteria | 100428 |
| 239 | Ga0207671_10020004 | 3300025914 | Bacteria | 5106 |
| 240 | Ga0207671_10079929 | 3300025914 | Bacteria | 2450 |
| 241 | Ga0207660_10001209 | 3300025917 | Bacteria | 17282 |
| 242 | Ga0207660_10138384 | 3300025917 | Bacteria | 1859 |
| 243 | Ga0207660_10274081 | 3300025917 | Bacteria | 1337 |
| 244 | Ga0207657_10008767 | 3300025919 | Bacteria | 10237 |
| 245 | Ga0207657_10053425 | 3300025919 | Bacteria | 3500 |
| 246 | Ga0207649_10005986 | 3300025920 | Bacteria | 6600 |
| 247 | Ga0207649_10225719 | 3300025920 | Bacteria | 1337 |
| 248 | Ga0207652_10000531 | 3300025921 | Bacteria | 38731 |
| 249 | Ga0207652_10001033 | 3300025921 | Bacteria | 25488 |
| 250 | Ga0207652_10004906 | 3300025921 | Bacteria | 10827 |
| 251 | Ga0207652_10005786 | 3300025921 | Bacteria | 10032 |
| 252 | Ga0207652_10161664 | 3300025921 | Bacteria | 2008 |
| 253 | Ga0207652_10215981 | 3300025921 | Bacteria | 1727 |
| 254 | Ga0207681_10005843 | 3300025923 | Bacteria | 7543 |
| 255 | Ga0207681_10010548 | 3300025923 | Bacteria | 5661 |
| 256 | Ga0207681_10035698 | 3300025923 | Unclassified | 3277 |
| 257 | Ga0207681_10256283 | 3300025923 | Bacteria | 1368 |
| 258 | Ga0207694_10003240 | 3300025924 | Bacteria | 12967 |
| 259 | Ga0207694_10015555 | 3300025924 | Bacteria | 5737 |
| 260 | Ga0207694_10124076 | 3300025924 | Bacteria | 2064 |
| 261 | Ga0207694_10279842 | 3300025924 | Bacteria | 1370 |
| 262 | Ga0207650_10000106 | 3300025925 | Bacteria | 110058 |
| 263 | Ga0207650_10047545 | 3300025925 | Bacteria | 3162 |
| 264 | Ga0207650_10070639 | 3300025925 | Bacteria | 2625 |
| 265 | Ga0207644_10000049 | 3300025931 | Bacteria | 95260 |
| 266 | Ga0207644_10001185 | 3300025931 | Bacteria | 16763 |
| 267 | Ga0207644_10123618 | 3300025931 | Bacteria | 1973 |
| 268 | Ga0207709_10000805 | 3300025935 | Bacteria | 24411 |
| 269 | Ga0207709_10134122 | 3300025935 | Bacteria | 1692 |
| 270 | Ga0207669_10122239 | 3300025937 | Bacteria | 1770 |
| 271 | Ga0207704_10143233 | 3300025938 | Bacteria | 1675 |
| 272 | Ga0207691_10041622 | 3300025940 | Bacteria | 4240 |
| 273 | Ga0207711_10000393 | 3300025941 | Bacteria | 46458 |
| 274 | Ga0207711_10000406 | 3300025941 | Bacteria | 45644 |
| 275 | Ga0207689_10222188 | 3300025942 | Bacteria | 1561 |
| 276 | Ga0207667_10000481 | 3300025949 | Bacteria | 52931 |
| 277 | Ga0207667_10002512 | 3300025949 | Bacteria | 22872 |
| 278 | Ga0207667_10024035 | 3300025949 | Bacteria | 6701 |
| 279 | Ga0207667_10038881 | 3300025949 | Bacteria | 5074 |
| 280 | Ga0207667_10039795 | 3300025949 | Bacteria | 5006 |
| 281 | Ga0207667_10088441 | 3300025949 | Bacteria | 3204 |
| 282 | Ga0207651_10150809 | 3300025960 | Bacteria | 1809 |
| 283 | Ga0207651_10282001 | 3300025960 | Bacteria | 1374 |
| 284 | Ga0207712_10018395 | 3300025961 | Bacteria | 4550 |
| 285 | Ga0207712_10343718 | 3300025961 | Bacteria | 1238 |
| 286 | Ga0207668_10009979 | 3300025972 | Bacteria | 5714 |
| 287 | Ga0207668_10089222 | 3300025972 | Bacteria | 2260 |
| 288 | Ga0207668_10090062 | 3300025972 | Bacteria | 2251 |
| 289 | Ga0207640_10000423 | 3300025981 | Bacteria | 26221 |
| 290 | Ga0207640_10002472 | 3300025981 | Bacteria | 9896 |
| 291 | Ga0207640_10005569 | 3300025981 | Bacteria | 6864 |
| 292 | Ga0207640_10020099 | 3300025981 | Bacteria | 3960 |
| 293 | Ga0207640_10032912 | 3300025981 | Bacteria | 3219 |
| 294 | Ga0207658_10000027 | 3300025986 | Bacteria | 174626 |
| 295 | Ga0207658_10000073 | 3300025986 | Bacteria | 111738 |
| 296 | Ga0207639_10000800 | 3300026041 | Bacteria | 21366 |
| 297 | Ga0207639_10001128 | 3300026041 | Bacteria | 18159 |
| 298 | Ga0207639_10026103 | 3300026041 | Bacteria | 4243 |
| 299 | Ga0207639_10062770 | 3300026041 | Bacteria | 2874 |
| 300 | Ga0207639_10076983 | 3300026041 | Bacteria | 2628 |
| 301 | Ga0207639_10105299 | 3300026041 | Bacteria | 2288 |
| 302 | Ga0207639_10226367 | 3300026041 | Bacteria | 1618 |
| 303 | Ga0207678_10000258 | 3300026067 | Bacteria | 48084 |
| 304 | Ga0207678_10014004 | 3300026067 | Bacteria | 7050 |
| 305 | Ga0207678_10022995 | 3300026067 | Bacteria | 5455 |
| 306 | Ga0207678_10072065 | 3300026067 | Bacteria | 2961 |
| 307 | Ga0207678_10119925 | 3300026067 | Bacteria | 2245 |
| 308 | Ga0207678_10121690 | 3300026067 | Bacteria | 2227 |
| 309 | Ga0207678_10199245 | 3300026067 | Bacteria | 1712 |
| 310 | Ga0207702_10000113 | 3300026078 | Bacteria | 94003 |
| 311 | Ga0207702_10008183 | 3300026078 | Bacteria | 8840 |
| 312 | Ga0207641_10006988 | 3300026088 | Bacteria | 9443 |
| 313 | Ga0207641_10012294 | 3300026088 | Bacteria | 7022 |
| 314 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 315 | Ga0207674_10006108 | 3300026116 | Bacteria | 14240 |
| 316 | Ga0207674_10014543 | 3300026116 | Bacteria | 8689 |
| 317 | Ga0207683_10133266 | 3300026121 | Bacteria | 2236 |
| 318 | Ga0207683_10148720 | 3300026121 | Bacteria | 2113 |
| 319 | Ga0207698_10005479 | 3300026142 | Bacteria | 7851 |
| 320 | Ga0207698_10009887 | 3300026142 | Bacteria | 6100 |
| 321 | Ga0209973_1006852 | 3300027252 | Bacteria | 1256 |
| 322 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 323 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 324 | Ga0210000_1007276 | 3300027462 | Bacteria | 1619 |
| 325 | Ga0209999_1016445 | 3300027543 | Bacteria | 1346 |
| 326 | Ga0209982_1009959 | 3300027552 | Bacteria | 1407 |
| 327 | Ga0209970_1013972 | 3300027614 | Bacteria | 1333 |
| 328 | Ga0209983_1003327 | 3300027665 | Bacteria | 3442 |
| 329 | Ga0209971_1013948 | 3300027682 | Bacteria | 1905 |
| 330 | Ga0209974_10016414 | 3300027876 | Bacteria | 2459 |
| 331 | Ga0209974_10026909 | 3300027876 | Bacteria | 1902 |
| 332 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 333 | Ga0268266_10028958 | 3300028379 | Bacteria | 4706 |
| 334 | Ga0268266_10051213 | 3300028379 | Bacteria | 3544 |
| 335 | Ga0268266_10053633 | 3300028379 | Bacteria | 3464 |
| 336 | Ga0268266_10173357 | 3300028379 | Bacteria | 1959 |
| 337 | Ga0268266_10181353 | 3300028379 | Bacteria | 1917 |
| 338 | Ga0268265_10000186 | 3300028380 | Bacteria | 73892 |
| 339 | Ga0268265_10001086 | 3300028380 | Bacteria | 24228 |
| 340 | Ga0268265_10010427 | 3300028380 | Bacteria | 6275 |
| 341 | Ga0268265_10022795 | 3300028380 | Bacteria | 4405 |
| 342 | Ga0268264_10000123 | 3300028381 | Bacteria | 189361 |
| 343 | Ga0268264_10013370 | 3300028381 | Bacteria | 6755 |
| 344 | Ga0268264_10309693 | 3300028381 | Bacteria | 1489 |
| 345 | Ga0307515_10116400 | 3300028794 | Bacteria | 3069 |
| 346 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 347 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 348 | Ga0316177_1136997 | 3300030731 | Bacteria | 1474 |
| 349 | Ga0316176_1142398 | 3300030732 | Bacteria | 3332 |
| 350 | Ga0314311_1231852 | 3300030733 | Bacteria | 2320 |
| 351 | Ga0316183_1166111 | 3300030742 | Bacteria | 3110 |
| 352 | Ga0265330_10000317 | 3300031235 | Bacteria | 34538 |
| 353 | Ga0265332_10000327 | 3300031238 | Bacteria | 36661 |
| 354 | Ga0265332_10097128 | 3300031238 | Bacteria | 1244 |
| 355 | Ga0265329_10005943 | 3300031242 | Unclassified | 4891 |
| 356 | Ga0265339_10016163 | 3300031249 | Unclassified | 4456 |
| 357 | Ga0265331_10050053 | 3300031250 | Bacteria | 2005 |
| 358 | Ga0265327_10052702 | 3300031251 | Bacteria | 2117 |
| 359 | Ga0265316_10000399 | 3300031344 | Bacteria | 49576 |
| 360 | Ga0265316_10020002 | 3300031344 | Bacteria | 5710 |
| 361 | Ga0307513_10038394 | 3300031456 | Bacteria | 5317 |
| 362 | Ga0307408_100180265 | 3300031548 | Bacteria | 1694 |
| 363 | Ga0316575_10025114 | 3300031665 | Bacteria | 2309 |
| 364 | Ga0265314_10000532 | 3300031711 | Bacteria | 49131 |
| 365 | Ga0265342_10000369 | 3300031712 | Bacteria | 49518 |
| 366 | Ga0307516_10102543 | 3300031730 | Unclassified | 2676 |
| 367 | Ga0307405_10008187 | 3300031731 | Bacteria | 5286 |
| 368 | Ga0307413_10024028 | 3300031824 | Bacteria | 3314 |
| 369 | Ga0307413_10042644 | 3300031824 | Bacteria | 2668 |
| 370 | Ga0307410_10035339 | 3300031852 | Bacteria | 3244 |
| 371 | Ga0307410_10151279 | 3300031852 | Bacteria | 1728 |
| 372 | Ga0307406_10026385 | 3300031901 | Bacteria | 3488 |
| 373 | Ga0307407_10028001 | 3300031903 | Bacteria | 3006 |
| 374 | Ga0307409_100215943 | 3300031995 | Bacteria | 1727 |
| 375 | Ga0307416_100029159 | 3300032002 | Bacteria | 4118 |
| 376 | Ga0307416_100042911 | 3300032002 | Bacteria | 3536 |
| 377 | Ga0307416_100249072 | 3300032002 | Bacteria | 1727 |
| 378 | Ga0307414_10001756 | 3300032004 | Bacteria | 11248 |
| 379 | Ga0307414_10008346 | 3300032004 | Bacteria | 5866 |
| 380 | Ga0307414_10017527 | 3300032004 | Bacteria | 4384 |
| 381 | Ga0307414_10040583 | 3300032004 | Bacteria | 3145 |
| 382 | Ga0307414_10170712 | 3300032004 | Bacteria | 1738 |
| 383 | Ga0307414_10206376 | 3300032004 | Bacteria | 1602 |
| 384 | Ga0307414_10227258 | 3300032004 | Bacteria | 1536 |
| 385 | Ga0307411_10044316 | 3300032005 | Bacteria | 2852 |
| 386 | Ga0307415_100035163 | 3300032126 | Bacteria | 3270 |
| 387 | Ga0316574_0144620 | 3300035398 | Bacteria | 1532 |
| 388 | Ga0395899_0009887 | 3300037312 | Bacteria | 7314 |
| 389 | Ga0395899_0011332 | 3300037312 | Bacteria | 6829 |
| 390 | Ga0395900_0098299 | 3300037418 | Bacteria | 3007 |
| 391 | Ga0395900_0099121 | 3300037418 | Bacteria | 2994 |
| 392 | Ga0395900_0157562 | 3300037418 | Bacteria | 2319 |
| 393 | Ga0395900_0175637 | 3300037418 | Bacteria | 2179 |
| 394 | Ga0395898_0030081 | 3300037466 | Bacteria | 5437 |
| 395 | Ga0395898_0061392 | 3300037466 | Bacteria | 3651 |
| 396 | Ga0395898_0116809 | 3300037466 | Bacteria | 2556 |
| 397 | Ga0395905_0002660 | 3300037471 | Bacteria | 19606 |
| 398 | Ga0395905_0004830 | 3300037471 | Bacteria | 13896 |
| 399 | Ga0395905_0036766 | 3300037471 | Bacteria | 4600 |
| 400 | Ga0395905_0080660 | 3300037471 | Bacteria | 3049 |
| 401 | Ga0395901_0018705 | 3300038443 | Bacteria | 7076 |
| 402 | Ga0395901_0086061 | 3300038443 | Bacteria | 3286 |
| 403 | Ga0237819_00047 | 3300038705 | Bacteria | 41634 |
| 404 | Ga0237819_04917 | 3300038705 | Bacteria | 2144 |
| 405 | Ga0439436_0025090 | 3300041404 | Bacteria | 1754 |
| 406 | Ga0439465_0002378 | 3300041413 | Bacteria | 6166 |
| 407 | Ga0439465_0008709 | 3300041413 | Bacteria | 3199 |
| 408 | Ga0439465_0068937 | 3300041413 | Bacteria | 1183 |
| 409 | Ga0451797_0878899 | 3300041453 | Bacteria | 1895 |
| 410 | Ga0451797_1574149 | 3300041453 | Bacteria | 1748 |
| 411 | Ga0451800_0984490 | 3300041459 | Bacteria | 11360 |
| 412 | Ga0451802_0202710 | 3300041460 | Bacteria | 6206 |
| 413 | Ga0451806_345240 | 3300041462 | Bacteria | 5689 |
| 414 | Ga0451804_0018860 | 3300041463 | Bacteria | 6284 |
| 415 | Ga0451807_0350558 | 3300041486 | Bacteria | 5205 |
| 416 | Ga0451837_1126891 | 3300041494 | Bacteria | 2814 |
| 417 | Ga0451843_1236032 | 3300041509 | Bacteria | 1646 |
| 418 | Ga0439432_035924 | 3300042006 | Bacteria | 1587 |
| 419 | Ga0439449_0000272 | 3300042007 | Bacteria | 18664 |
| 420 | Ga0439449_0004443 | 3300042007 | Bacteria | 5410 |
| 421 | Ga0439449_0004460 | 3300042007 | Bacteria | 5400 |
| 422 | Ga0439449_0020398 | 3300042007 | Bacteria | 2484 |
| 423 | Ga0439449_0032212 | 3300042007 | Bacteria | 1954 |
| 424 | Ga0451577_0002087 | 3300042876 | Bacteria | 24590 |
| 425 | Ga0466972_0000629 | 3300044658 | Bacteria | 17099 |
| 426 | Ga0466963_0178071 | 3300044694 | Bacteria | 1484 |
| 427 | Ga0466970_0000172 | 3300044765 | Bacteria | 30789 |
| 428 | Ga0466957_0067438 | 3300044842 | Bacteria | 2207 |
| 429 | Ga0466959_0038586 | 3300045049 | Bacteria | 3529 |
| 430 | Ga0495638_0183320 | 3300046460 | Bacteria | 1193 |
| 431 | Ga0495663_0002717 | 3300046525 | Bacteria | 5244 |
| 432 | Ga0495621_0011311 | 3300046539 | Bacteria | 2757 |
| 433 | Ga0495633_0009843 | 3300046558 | Bacteria | 5255 |
| 434 | Ga0495633_0028189 | 3300046558 | Bacteria | 2739 |
| 435 | Ga0495668_0013505 | 3300046616 | Bacteria | 4814 |
| 436 | Ga0495636_0020099 | 3300047318 | Bacteria | 2689 |
| 437 | Ga0495686_0001563 | 3300047472 | Bacteria | 24398 |
| 438 | Ga0496100_0142789 | 3300048903 | Bacteria | 1699 |
| 439 | Ga0496101_0060606 | 3300048904 | Bacteria | 2746 |
| 440 | Ga0496107_0239664 | 3300048910 | Bacteria | 1350 |
| 441 | Ga0496108_0023131 | 3300048911 | Bacteria | 5111 |
| 442 | Ga0496109_0010311 | 3300048912 | Bacteria | 7980 |
| 443 | Ga0496111_0053415 | 3300048914 | Bacteria | 2919 |
| 444 | Ga0496113_0010772 | 3300048916 | Bacteria | 6063 |
| 445 | Ga0496114_0000915 | 3300048917 | Bacteria | 22110 |
| 446 | Ga0496114_0086321 | 3300048917 | Bacteria | 2659 |
| 447 | Ga0496115_0139494 | 3300048918 | Bacteria | 2000 |
| 448 | Ga0496115_0285411 | 3300048918 | Bacteria | 1355 |
| 449 | Ga0496116_0022348 | 3300048919 | Bacteria | 4740 |
| 450 | Ga0496117_0001168 | 3300048920 | Bacteria | 39488 |
| 451 | Ga0496117_0008641 | 3300048920 | Bacteria | 9640 |
| 452 | Ga0496117_0010386 | 3300048920 | Bacteria | 8496 |
| 453 | Ga0496118_0000145 | 3300048921 | Bacteria | 123886 |
| 454 | Ga0496118_0000682 | 3300048921 | Bacteria | 55209 |
| 455 | Ga0496118_0003292 | 3300048921 | Bacteria | 20547 |
| 456 | Ga0496118_0024498 | 3300048921 | Bacteria | 5204 |
| 457 | Ga0496118_0129882 | 3300048921 | Bacteria | 1620 |
| 458 | Ga0496119_0001728 | 3300048922 | Bacteria | 25473 |
| 459 | Ga0496120_0000605 | 3300048923 | Bacteria | 54408 |
| 460 | Ga0496121_0000176 | 3300048924 | Bacteria | 142585 |
| 461 | Ga0496121_0004743 | 3300048924 | Bacteria | 17942 |
| 462 | Ga0496122_0000220 | 3300048925 | Bacteria | 127065 |
| 463 | Ga0496122_0001135 | 3300048925 | Bacteria | 45756 |
| 464 | Ga0496122_0001331 | 3300048925 | Bacteria | 40422 |
| 465 | Ga0496123_0000107 | 3300048926 | Bacteria | 166923 |
| 466 | Ga0496123_0000151 | 3300048926 | Bacteria | 141062 |
| 467 | Ga0496123_0000226 | 3300048926 | Bacteria | 113889 |
| 468 | Ga0496123_0074405 | 3300048926 | Bacteria | 2103 |
| 469 | Ga0496124_0000785 | 3300048927 | Bacteria | 51854 |
| 470 | Ga0496124_0076260 | 3300048927 | Bacteria | 2768 |
| 471 | Ga0496126_0017194 | 3300048929 | Bacteria | 7211 |
| 472 | Ga0496126_0095881 | 3300048929 | Bacteria | 2601 |
| 473 | Ga0501290_000542 | 3300049513 | Bacteria | 5779 |
| 474 | Ga0501300_010952 | 3300049523 | Bacteria | 1322 |
| 475 | Ga0501031_0035577 | 3300049568 | Bacteria | 3249 |
| 476 | Ga0501032_0001950 | 3300049569 | Bacteria | 16241 |
| 477 | Ga0501032_0053533 | 3300049569 | Bacteria | 2717 |
| 478 | Ga0501033_0009648 | 3300049570 | Bacteria | 7425 |
| 479 | Ga0501033_0016560 | 3300049570 | Bacteria | 5578 |
| 480 | Ga0501033_0044899 | 3300049570 | Bacteria | 3289 |
| 481 | Ga0501033_0122922 | 3300049570 | Bacteria | 1882 |
| 482 | Ga0501034_0000822 | 3300049571 | Bacteria | 46209 |
| 483 | Ga0501034_0002484 | 3300049571 | Bacteria | 22159 |
| 484 | Ga0501034_0010768 | 3300049571 | Bacteria | 9499 |
| 485 | Ga0501034_0023790 | 3300049571 | Bacteria | 6238 |
| 486 | Ga0501034_0089351 | 3300049571 | Bacteria | 3078 |
| 487 | Ga0501034_0132782 | 3300049571 | Bacteria | 2472 |
| 488 | Ga0501034_0195122 | 3300049571 | Bacteria | 1985 |
| 489 | Ga0501034_0391287 | 3300049571 | Bacteria | 1314 |
| 490 | Ga0501036_0022651 | 3300049572 | Bacteria | 5286 |
| 491 | Ga0501037_0001245 | 3300049573 | Bacteria | 18769 |
| 492 | Ga0501037_0037684 | 3300049573 | Bacteria | 3564 |
| 493 | Ga0501037_0056576 | 3300049573 | Bacteria | 2864 |
| 494 | Ga0501038_0006070 | 3300049574 | Bacteria | 11177 |
| 495 | Ga0501039_0010599 | 3300049575 | Bacteria | 7022 |
| 496 | Ga0501039_0019791 | 3300049575 | Bacteria | 5160 |
| 497 | Ga0501039_0021732 | 3300049575 | Bacteria | 4923 |
| 498 | Ga0501040_0063313 | 3300049576 | Bacteria | 2545 |
| 499 | Ga0501042_0029270 | 3300049578 | Bacteria | 3884 |
| 500 | Ga0501043_0002712 | 3300049579 | Bacteria | 14825 |
| 501 | Ga0501043_0010830 | 3300049579 | Bacteria | 7140 |
| 502 | Ga0501043_0020494 | 3300049579 | Bacteria | 5187 |
| 503 | Ga0501043_0065770 | 3300049579 | Bacteria | 2847 |
| 504 | Ga0501046_0014070 | 3300049580 | Bacteria | 6757 |
| 505 | Ga0501046_0028250 | 3300049580 | Bacteria | 4570 |
| 506 | Ga0501046_0030906 | 3300049580 | Bacteria | 4345 |
| 507 | Ga0501046_0286939 | 3300049580 | Bacteria | 1204 |
| 508 | Ga0501047_0008649 | 3300049581 | Bacteria | 9617 |
| 509 | Ga0501047_0018572 | 3300049581 | Bacteria | 6665 |
| 510 | Ga0501047_0090986 | 3300049581 | Bacteria | 2928 |
| 511 | Ga0501068_0008363 | 3300049584 | Bacteria | 5754 |
| 512 | Ga0501069_0045573 | 3300049585 | Bacteria | 2430 |
| 513 | Ga0501070_0023731 | 3300049586 | Bacteria | 5140 |
| 514 | Ga0501070_0042467 | 3300049586 | Bacteria | 3787 |
| 515 | Ga0501070_0080698 | 3300049586 | Bacteria | 2691 |
| 516 | Ga0501070_0166995 | 3300049586 | Bacteria | 1813 |
| 517 | Ga0501070_0351963 | 3300049586 | Bacteria | 1195 |
| 518 | Ga0501072_0200304 | 3300049588 | Bacteria | 1592 |
| 519 | Ga0501073_0031310 | 3300049589 | Bacteria | 3795 |
| 520 | Ga0501073_0073939 | 3300049589 | Bacteria | 2373 |
| 521 | Ga0501073_0080063 | 3300049589 | Bacteria | 2273 |
| 522 | Ga0501074_0137626 | 3300049590 | Bacteria | 1747 |
| 523 | Ga0501206_014084 | 3300049653 | Bacteria | 1096 |
| 524 | Ga0501257_010657 | 3300049686 | Bacteria | 2090 |
| 525 | Ga0501258_005025 | 3300049687 | Bacteria | 1270 |
| 526 | Ga0501225_0023020 | 3300049705 | Bacteria | 1718 |
| 527 | Ga0501225_0051860 | 3300049705 | Bacteria | 1143 |
| 528 | Ga0501079_0054416 | 3300049741 | Bacteria | 3086 |
| 529 | Ga0501080_0006579 | 3300049742 | Bacteria | 10440 |
| 530 | Ga0501080_0081368 | 3300049742 | Bacteria | 3009 |
| 531 | Ga0501080_0118455 | 3300049742 | Bacteria | 2455 |
| 532 | Ga0501080_0178029 | 3300049742 | Bacteria | 1958 |
| 533 | Ga0501080_0188210 | 3300049742 | Bacteria | 1897 |
| 534 | Ga0501080_0255198 | 3300049742 | Bacteria | 1598 |
| 535 | Ga0501265_000289 | 3300049762 | Bacteria | 5157 |
| 536 | Ga0501272_008396 | 3300049769 | Bacteria | 1133 |
| 537 | Ga0501275_000710 | 3300049772 | Bacteria | 3640 |
| 538 | Ga0501035_0013181 | 3300049822 | Bacteria | 7630 |
| 539 | Ga0501035_0034410 | 3300049822 | Bacteria | 4603 |
| 540 | Ga0501035_0132748 | 3300049822 | Bacteria | 2169 |
| 541 | Ga0501035_0175390 | 3300049822 | Bacteria | 1849 |
| 542 | Ga0501035_0189279 | 3300049822 | Bacteria | 1769 |
| 543 | Ga0501044_0005580 | 3300049823 | Bacteria | 13962 |
| 544 | Ga0501044_0013448 | 3300049823 | Bacteria | 8851 |
| 545 | Ga0501044_0015688 | 3300049823 | Bacteria | 8157 |
| 546 | Ga0501044_0019454 | 3300049823 | Bacteria | 7264 |
| 547 | Ga0501044_0068934 | 3300049823 | Bacteria | 3602 |
| 548 | nmdc:mga03683_15792_c1 | 3300050489 | Bacteria | 2825 |
| 549 | nmdc:mga00v17_102185_c1 | 3300050491 | Bacteria | 1811 |
| 550 | nmdc:mga00v17_15952_c1 | 3300050491 | Bacteria | 4227 |
| 551 | nmdc:mga00v17_1758_c1 | 3300050491 | Bacteria | 11252 |
| 552 | nmdc:mga00v17_4333_c1 | 3300050491 | Bacteria | 7371 |
| 553 | nmdc:mga00v17_83611_c1 | 3300050491 | Bacteria | 1997 |
| 554 | nmdc:mga0k408_1865_c1 | 3300050493 | Bacteria | 11320 |
| 555 | nmdc:mga06z11_47478_c1 | 3300050494 | Bacteria | 2181 |
| 556 | nmdc:mga06z11_7830_c1 | 3300050494 | Bacteria | 4419 |
| 557 | nmdc:mga07m45_4599_c2 | 3300050496 | Bacteria | 6089 |
| 558 | nmdc:mga08y16_169766_c1 | 3300050511 | Bacteria | 2266 |
| 559 | nmdc:mga0n895_149757_c1 | 3300050512 | Bacteria | 2363 |
| 560 | Ga0500610_0000158 | 3300053079 | Bacteria | 20255 |
| 561 | Ga0500643_001164 | 3300053087 | Bacteria | 15686 |
| 562 | Ga0500651_0001249 | 3300053093 | Bacteria | 12654 |
| 563 | Ga0500650_0000007 | 3300053098 | Bacteria | 108097 |
| 564 | Ga0500568_0003690 | 3300053139 | Bacteria | 8405 |
| 565 | Ga0500577_0137301 | 3300053142 | Bacteria | 1029 |
| 566 | Ga0500616_0107946 | 3300053153 | Bacteria | 1349 |
| 567 | Ga0500634_0094406 | 3300053161 | Bacteria | 1510 |
| 568 | Ga0501082_0021662 | 3300060353 | Bacteria | 5540 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10024028 | Ga0307413_100240282 | 306 |
| 2 | 3300027462 | Ga0210000_1007276 | Ga0210000_10072761 | 309 |
| 3 | 3300005344 | Ga0070661_100383441 | Ga0070661_1003834411 | 310 |
| 4 | 3300014325 | Ga0163163_10001573 | Ga0163163_1000157319 | 314 |
| 5 | 3300037466 | Ga0395898_0116809 | Ga0395898_0116809_1519_2538 | 314 |
| 6 | 3300001915 | JGI24741J21665_1002078 | JGI24741J21665_10020783 | 315 |
| 7 | 3300006051 | Ga0075364_10006217 | Ga0075364_100062176 | 316 |
| 8 | 3300006051 | Ga0075364_10042688 | Ga0075364_100426883 | 316 |
| 9 | 3300006178 | Ga0075367_10008976 | Ga0075367_100089762 | 316 |
| 10 | 3300050491 | nmdc:mga00v17_4333_c1 | nmdc:mga00v17_4333_c1_1834_2883 | 316 |
| 11 | 3300050494 | nmdc:mga06z11_47478_c1 | nmdc:mga06z11_47478_c1_1035_2084 | 316 |
| 12 | 3300050496 | nmdc:mga07m45_4599_c2 | nmdc:mga07m45_4599_c2_3245_4294 | 316 |
| 13 | 3300025913 | Ga0207695_10173677 | Ga0207695_101736772 | 317 |
| 14 | 3300032004 | Ga0307414_10017527 | Ga0307414_100175272 | 317 |
| 15 | 3300049571 | Ga0501034_0132782 | Ga0501034_0132782_1369_2406 | 317 |
| 16 | 3300049585 | Ga0501069_0045573 | Ga0501069_0045573_1319_2356 | 317 |
| 17 | 3300028794 | Ga0307515_10116400 | Ga0307515_101164002 | 318 |
| 18 | 3300049571 | Ga0501034_0391287 | Ga0501034_0391287_212_1285 | 318 |
| 19 | 3300053142 | Ga0500577_0137301 | Ga0500577_0137301_54_1016 | 318 |
| 20 | 3300053153 | Ga0500616_0107946 | Ga0500616_0107946_235_1197 | 318 |
| 21 | 3300005548 | Ga0070665_100036667 | Ga0070665_1000366671 | 319 |
| 22 | 3300006051 | Ga0075364_10001495 | Ga0075364_100014959 | 319 |
| 23 | 3300006177 | Ga0075362_10002219 | Ga0075362_100022195 | 319 |
| 24 | 3300006178 | Ga0075367_10003075 | Ga0075367_100030756 | 319 |
| 25 | 3300006195 | Ga0075366_10003119 | Ga0075366_100031194 | 319 |
| 26 | 3300025912 | Ga0207707_10000607 | Ga0207707_100006071 | 319 |
| 27 | 3300025949 | Ga0207667_10038881 | Ga0207667_100388815 | 319 |
| 28 | 3300026041 | Ga0207639_10226367 | Ga0207639_102263672 | 319 |
| 29 | 3300026116 | Ga0207674_10014543 | Ga0207674_100145438 | 319 |
| 30 | 3300028379 | Ga0268266_10051213 | Ga0268266_100512133 | 319 |
| 31 | 3300050489 | nmdc:mga03683_15792_c1 | nmdc:mga03683_15792_c1_866_1915 | 319 |
| 32 | 3300050491 | nmdc:mga00v17_1758_c1 | nmdc:mga00v17_1758_c1_6928_7977 | 319 |
| 33 | 3300050493 | nmdc:mga0k408_1865_c1 | nmdc:mga0k408_1865_c1_4635_5684 | 319 |
| 34 | 3300050494 | nmdc:mga06z11_7830_c1 | nmdc:mga06z11_7830_c1_460_1509 | 319 |
| 35 | 3300003781 | Ga0055536_1009027 | Ga0055536_10090274 | 321 |
| 36 | 3300003794 | Ga0055531_10011726 | Ga0055531_100117264 | 321 |
| 37 | 3300005546 | Ga0070696_100007449 | Ga0070696_1000074492 | 321 |
| 38 | 3300005547 | Ga0070693_100000911 | Ga0070693_1000009112 | 321 |
| 39 | 3300005564 | Ga0070664_100264376 | Ga0070664_1002643761 | 321 |
| 40 | 3300005616 | Ga0068852_100142938 | Ga0068852_1001429382 | 321 |
| 41 | 3300013102 | Ga0157371_10037059 | Ga0157371_100370592 | 321 |
| 42 | 3300020069 | Ga0197907_11154955 | Ga0197907_111549552 | 321 |
| 43 | 3300020081 | Ga0206354_11590007 | Ga0206354_115900072 | 321 |
| 44 | 3300020610 | Ga0154015_1567256 | Ga0154015_15672562 | 321 |
| 45 | 3300025292 | Ga0209676_1001198 | Ga0209676_10011983 | 321 |
| 46 | 3300025304 | Ga0209257_1001483 | Ga0209257_10014833 | 321 |
| 47 | 3300025321 | Ga0207656_10045037 | Ga0207656_100450372 | 321 |
| 48 | 3300025904 | Ga0207647_10000467 | Ga0207647_100004677 | 321 |
| 49 | 3300025909 | Ga0207705_10000532 | Ga0207705_1000053210 | 321 |
| 50 | 3300025912 | Ga0207707_10003687 | Ga0207707_100036874 | 321 |
| 51 | 3300025913 | Ga0207695_10120705 | Ga0207695_101207051 | 321 |
| 52 | 3300025919 | Ga0207657_10008767 | Ga0207657_100087674 | 321 |
| 53 | 3300025920 | Ga0207649_10005986 | Ga0207649_100059866 | 321 |
| 54 | 3300025921 | Ga0207652_10001033 | Ga0207652_100010337 | 321 |
| 55 | 3300025921 | Ga0207652_10005786 | Ga0207652_100057866 | 321 |
| 56 | 3300025924 | Ga0207694_10003240 | Ga0207694_100032406 | 321 |
| 57 | 3300025949 | Ga0207667_10000481 | Ga0207667_1000048132 | 321 |
| 58 | 3300025981 | Ga0207640_10002472 | Ga0207640_100024726 | 321 |
| 59 | 3300025981 | Ga0207640_10005569 | Ga0207640_100055691 | 321 |
| 60 | 3300026041 | Ga0207639_10105299 | Ga0207639_101052991 | 321 |
| 61 | 3300026078 | Ga0207702_10008183 | Ga0207702_100081839 | 321 |
| 62 | 3300026142 | Ga0207698_10005479 | Ga0207698_100054794 | 321 |
| 63 | 3300030742 | Ga0316183_1166111 | Ga0316183_11661111 | 321 |
| 64 | 3300037418 | Ga0395900_0157562 | Ga0395900_0157562_1051_2070 | 321 |
| 65 | 3300037471 | Ga0395905_0002660 | Ga0395905_0002660_15906_16925 | 321 |
| 66 | 3300038443 | Ga0395901_0086061 | Ga0395901_0086061_1878_2897 | 321 |
| 67 | 3300048924 | Ga0496121_0000176 | Ga0496121_0000176_98717_99763 | 321 |
| 68 | 3300003781 | Ga0055536_1004862 | Ga0055536_10048624 | 322 |
| 69 | 3300003856 | Ga0058692_1000020 | Ga0058692_100002046 | 322 |
| 70 | 3300005289 | Ga0065704_10073140 | Ga0065704_100731405 | 322 |
| 71 | 3300005331 | Ga0070670_100001108 | Ga0070670_10000110821 | 322 |
| 72 | 3300005336 | Ga0070680_100000405 | Ga0070680_1000004053 | 322 |
| 73 | 3300005339 | Ga0070660_100037696 | Ga0070660_1000376963 | 322 |
| 74 | 3300005455 | Ga0070663_100027309 | Ga0070663_1000273093 | 322 |
| 75 | 3300005530 | Ga0070679_100000681 | Ga0070679_10000068121 | 322 |
| 76 | 3300005563 | Ga0068855_100030800 | Ga0068855_1000308003 | 322 |
| 77 | 3300005578 | Ga0068854_100011728 | Ga0068854_1000117284 | 322 |
| 78 | 3300009011 | Ga0105251_10000010 | Ga0105251_10000010159 | 322 |
| 79 | 3300009148 | Ga0105243_10117107 | Ga0105243_101171071 | 322 |
| 80 | 3300013100 | Ga0157373_10019579 | Ga0157373_100195791 | 322 |
| 81 | 3300013104 | Ga0157370_10083337 | Ga0157370_100833371 | 322 |
| 82 | 3300013105 | Ga0157369_10162220 | Ga0157369_101622202 | 322 |
| 83 | 3300013307 | Ga0157372_10000421 | Ga0157372_100004214 | 322 |
| 84 | 3300015265 | Ga0182005_1004408 | Ga0182005_10044084 | 322 |
| 85 | 3300025292 | Ga0209676_1000079 | Ga0209676_100007926 | 322 |
| 86 | 3300025298 | Ga0209050_1000153 | Ga0209050_1000153141 | 322 |
| 87 | 3300025303 | Ga0209051_1001823 | Ga0209051_100182316 | 322 |
| 88 | 3300025304 | Ga0209257_1000081 | Ga0209257_100008136 | 322 |
| 89 | 3300025735 | Ga0207713_1000292 | Ga0207713_100029210 | 322 |
| 90 | 3300025912 | Ga0207707_10000229 | Ga0207707_1000022943 | 322 |
| 91 | 3300025917 | Ga0207660_10138384 | Ga0207660_101383841 | 322 |
| 92 | 3300025919 | Ga0207657_10053425 | Ga0207657_100534252 | 322 |
| 93 | 3300025921 | Ga0207652_10004906 | Ga0207652_100049069 | 322 |
| 94 | 3300025925 | Ga0207650_10047545 | Ga0207650_100475452 | 322 |
| 95 | 3300025935 | Ga0207709_10134122 | Ga0207709_101341222 | 322 |
| 96 | 3300025949 | Ga0207667_10024035 | Ga0207667_100240355 | 322 |
| 97 | 3300025981 | Ga0207640_10020099 | Ga0207640_100200994 | 322 |
| 98 | 3300026067 | Ga0207678_10121690 | Ga0207678_101216902 | 322 |
| 99 | 3300027312 | Ga0209371_1000011 | Ga0209371_1000011313 | 322 |
| 100 | 3300030500 | Ga0268256_1000011 | Ga0268256_1000011313 | 322 |
| 101 | 3300041459 | Ga0451800_0984490 | Ga0451800_0984490_6037_7137 | 322 |
| 102 | 3300041462 | Ga0451806_345240 | Ga0451806_345240_1619_2719 | 322 |
| 103 | 3300041463 | Ga0451804_0018860 | Ga0451804_0018860_1897_2997 | 322 |
| 104 | 3300041486 | Ga0451807_0350558 | Ga0451807_0350558_799_1899 | 322 |
| 105 | 3300048920 | Ga0496117_0008641 | Ga0496117_0008641_8209_9309 | 322 |
| 106 | 3300048921 | Ga0496118_0129882 | Ga0496118_0129882_429_1529 | 322 |
| 107 | 3300048925 | Ga0496122_0001135 | Ga0496122_0001135_42145_43245 | 322 |
| 108 | 3300048926 | Ga0496123_0000226 | Ga0496123_0000226_70645_71745 | 322 |
| 109 | 3300048927 | Ga0496124_0000785 | Ga0496124_0000785_48250_49350 | 322 |
| 110 | 3300049586 | Ga0501070_0023731 | Ga0501070_0023731_3174_4199 | 322 |
| 111 | 3300003771 | Ga0055526_1001709 | Ga0055526_100170913 | 323 |
| 112 | 3300003773 | Ga0055537_1000392 | Ga0055537_100039221 | 323 |
| 113 | 3300003784 | Ga0055534_1000328 | Ga0055534_100032827 | 323 |
| 114 | 3300003790 | Ga0055528_1000115 | Ga0055528_100011538 | 323 |
| 115 | 3300005353 | Ga0070669_100301564 | Ga0070669_1003015641 | 323 |
| 116 | 3300005548 | Ga0070665_100127021 | Ga0070665_1001270211 | 323 |
| 117 | 3300009011 | Ga0105251_10007369 | Ga0105251_100073694 | 323 |
| 118 | 3300025263 | Ga0209565_1000014 | Ga0209565_1000014332 | 323 |
| 119 | 3300025273 | Ga0209673_1000623 | Ga0209673_100062328 | 323 |
| 120 | 3300025291 | Ga0209675_1000021 | Ga0209675_1000021156 | 323 |
| 121 | 3300025294 | Ga0209025_1027256 | Ga0209025_10272561 | 323 |
| 122 | 3300025295 | Ga0209564_1000263 | Ga0209564_100026365 | 323 |
| 123 | 3300025298 | Ga0209050_1011617 | Ga0209050_10116174 | 323 |
| 124 | 3300025299 | Ga0209256_1005467 | Ga0209256_10054672 | 323 |
| 125 | 3300025304 | Ga0209257_1000988 | Ga0209257_100098818 | 323 |
| 126 | 3300025304 | Ga0209257_1004325 | Ga0209257_10043256 | 323 |
| 127 | 3300025923 | Ga0207681_10256283 | Ga0207681_102562831 | 323 |
| 128 | 3300032004 | Ga0307414_10040583 | Ga0307414_100405832 | 323 |
| 129 | 3300038705 | Ga0237819_04917 | Ga0237819_04917_190_1281 | 323 |
| 130 | 3300046558 | Ga0495633_0028189 | Ga0495633_0028189_937_2028 | 323 |
| 131 | 3300050511 | nmdc:mga08y16_169766_c1 | nmdc:mga08y16_169766_c1_491_1531 | 323 |
| 132 | 3300003781 | Ga0055536_1003198 | Ga0055536_10031986 | 324 |
| 133 | 3300005289 | Ga0065704_10006659 | Ga0065704_100066593 | 324 |
| 134 | 3300009551 | Ga0105238_10238095 | Ga0105238_102380952 | 324 |
| 135 | 3300014497 | Ga0182008_10002138 | Ga0182008_1000213810 | 324 |
| 136 | 3300025292 | Ga0209676_1000024 | Ga0209676_1000024480 | 324 |
| 137 | 3300030732 | Ga0316176_1142398 | Ga0316176_11423981 | 324 |
| 138 | 3300032004 | Ga0307414_10170712 | Ga0307414_101707121 | 324 |
| 139 | 3300048920 | Ga0496117_0001168 | Ga0496117_0001168_37615_38706 | 324 |
| 140 | 3300048921 | Ga0496118_0000145 | Ga0496118_0000145_100882_101973 | 324 |
| 141 | 3300048921 | Ga0496118_0024498 | Ga0496118_0024498_3332_4423 | 324 |
| 142 | 3300002773 | JGI25152J39213_1000252 | JGI25152J39213_10002524 | 325 |
| 143 | 3300002774 | JGI25150J39212_1000322 | JGI25150J39212_10003225 | 325 |
| 144 | 3300003187 | JGI25151J46595_10000522 | JGI25151J46595_100005224 | 325 |
| 145 | 3300003215 | JGI25153J46596_10000311 | JGI25153J46596_100003114 | 325 |
| 146 | 3300005548 | Ga0070665_100314230 | Ga0070665_1003142302 | 325 |
| 147 | 3300005985 | Ga0081539_10015349 | Ga0081539_100153497 | 325 |
| 148 | 3300006881 | Ga0068865_100192517 | Ga0068865_1001925172 | 325 |
| 149 | 3300009148 | Ga0105243_10010816 | Ga0105243_100108164 | 325 |
| 150 | 3300025245 | Ga0207425_1000283 | Ga0207425_10002834 | 325 |
| 151 | 3300025258 | Ga0209129_1000365 | Ga0209129_100036532 | 325 |
| 152 | 3300025294 | Ga0209025_1000012 | Ga0209025_100001232 | 325 |
| 153 | 3300025297 | Ga0209758_1000018 | Ga0209758_1000018626 | 325 |
| 154 | 3300025935 | Ga0207709_10000805 | Ga0207709_100008053 | 325 |
| 155 | 3300025938 | Ga0207704_10143233 | Ga0207704_101432331 | 325 |
| 156 | 3300025942 | Ga0207689_10222188 | Ga0207689_102221882 | 325 |
| 157 | 3300031235 | Ga0265330_10000317 | Ga0265330_1000031730 | 325 |
| 158 | 3300031238 | Ga0265332_10000327 | Ga0265332_1000032726 | 325 |
| 159 | 3300031242 | Ga0265329_10005943 | Ga0265329_100059434 | 325 |
| 160 | 3300031249 | Ga0265339_10016163 | Ga0265339_100161634 | 325 |
| 161 | 3300031250 | Ga0265331_10050053 | Ga0265331_100500532 | 325 |
| 162 | 3300031344 | Ga0265316_10000399 | Ga0265316_1000039926 | 325 |
| 163 | 3300031344 | Ga0265316_10020002 | Ga0265316_100200024 | 325 |
| 164 | 3300031711 | Ga0265314_10000532 | Ga0265314_1000053218 | 325 |
| 165 | 3300031712 | Ga0265342_10000369 | Ga0265342_1000036918 | 325 |
| 166 | 3300005347 | Ga0070668_100278924 | Ga0070668_1002789242 | 326 |
| 167 | 3300005353 | Ga0070669_100088864 | Ga0070669_1000888642 | 326 |
| 168 | 3300005456 | Ga0070678_100134573 | Ga0070678_1001345732 | 326 |
| 169 | 3300005843 | Ga0068860_100018691 | Ga0068860_1000186914 | 326 |
| 170 | 3300005844 | Ga0068862_100009079 | Ga0068862_1000090795 | 326 |
| 171 | 3300009094 | Ga0111539_10052153 | Ga0111539_100521532 | 326 |
| 172 | 3300009553 | Ga0105249_10414300 | Ga0105249_104143002 | 326 |
| 173 | 3300013104 | Ga0157370_10011223 | Ga0157370_100112232 | 326 |
| 174 | 3300014745 | Ga0157377_10038115 | Ga0157377_100381151 | 326 |
| 175 | 3300025923 | Ga0207681_10035698 | Ga0207681_100356982 | 326 |
| 176 | 3300025960 | Ga0207651_10150809 | Ga0207651_101508091 | 326 |
| 177 | 3300025961 | Ga0207712_10343718 | Ga0207712_103437181 | 326 |
| 178 | 3300025972 | Ga0207668_10090062 | Ga0207668_100900622 | 326 |
| 179 | 3300026121 | Ga0207683_10133266 | Ga0207683_101332662 | 326 |
| 180 | 3300028380 | Ga0268265_10010427 | Ga0268265_100104275 | 326 |
| 181 | 3300028381 | Ga0268264_10013370 | Ga0268264_100133704 | 326 |
| 182 | 3300031456 | Ga0307513_10038394 | Ga0307513_100383944 | 326 |
| 183 | 3300042007 | Ga0439449_0032212 | Ga0439449_0032212_454_1548 | 326 |
| 184 | 3300003781 | Ga0055536_1001515 | Ga0055536_100151513 | 327 |
| 185 | 3300003794 | Ga0055531_10011297 | Ga0055531_100112974 | 327 |
| 186 | 3300005331 | Ga0070670_100000064 | Ga0070670_10000006491 | 327 |
| 187 | 3300005335 | Ga0070666_10037596 | Ga0070666_100375962 | 327 |
| 188 | 3300005336 | Ga0070680_100008797 | Ga0070680_1000087973 | 327 |
| 189 | 3300005353 | Ga0070669_100012001 | Ga0070669_1000120013 | 327 |
| 190 | 3300005355 | Ga0070671_100000025 | Ga0070671_10000002597 | 327 |
| 191 | 3300005365 | Ga0070688_100002099 | Ga0070688_1000020992 | 327 |
| 192 | 3300005367 | Ga0070667_100000095 | Ga0070667_10000009511 | 327 |
| 193 | 3300005458 | Ga0070681_10003393 | Ga0070681_1000339311 | 327 |
| 194 | 3300005466 | Ga0070685_10000005 | Ga0070685_1000000513 | 327 |
| 195 | 3300005530 | Ga0070679_100002883 | Ga0070679_1000028835 | 327 |
| 196 | 3300005548 | Ga0070665_100007283 | Ga0070665_1000072839 | 327 |
| 197 | 3300005617 | Ga0068859_100003094 | Ga0068859_1000030943 | 327 |
| 198 | 3300005618 | Ga0068864_100000073 | Ga0068864_10000007311 | 327 |
| 199 | 3300005841 | Ga0068863_100013677 | Ga0068863_1000136777 | 327 |
| 200 | 3300005841 | Ga0068863_100438673 | Ga0068863_1004386731 | 327 |
| 201 | 3300005842 | Ga0068858_100106608 | Ga0068858_1001066082 | 327 |
| 202 | 3300005843 | Ga0068860_100002476 | Ga0068860_10000247611 | 327 |
| 203 | 3300005844 | Ga0068862_100001217 | Ga0068862_10000121718 | 327 |
| 204 | 3300006051 | Ga0075364_10185020 | Ga0075364_101850201 | 327 |
| 205 | 3300006931 | Ga0097620_100003094 | Ga0097620_1000030943 | 327 |
| 206 | 3300013104 | Ga0157370_10017572 | Ga0157370_100175722 | 327 |
| 207 | 3300014968 | Ga0157379_10110387 | Ga0157379_101103872 | 327 |
| 208 | 3300025292 | Ga0209676_1000047 | Ga0209676_1000047287 | 327 |
| 209 | 3300025294 | Ga0209025_1007720 | Ga0209025_10077203 | 327 |
| 210 | 3300025297 | Ga0209758_1017780 | Ga0209758_10177803 | 327 |
| 211 | 3300025298 | Ga0209050_1031241 | Ga0209050_10312411 | 327 |
| 212 | 3300025304 | Ga0209257_1015480 | Ga0209257_10154802 | 327 |
| 213 | 3300025912 | Ga0207707_10000241 | Ga0207707_1000024140 | 327 |
| 214 | 3300025917 | Ga0207660_10001209 | Ga0207660_100012095 | 327 |
| 215 | 3300025917 | Ga0207660_10274081 | Ga0207660_102740811 | 327 |
| 216 | 3300025921 | Ga0207652_10000531 | Ga0207652_100005319 | 327 |
| 217 | 3300025923 | Ga0207681_10005843 | Ga0207681_100058433 | 327 |
| 218 | 3300025923 | Ga0207681_10010548 | Ga0207681_100105483 | 327 |
| 219 | 3300025924 | Ga0207694_10124076 | Ga0207694_101240762 | 327 |
| 220 | 3300025925 | Ga0207650_10000106 | Ga0207650_1000010689 | 327 |
| 221 | 3300025931 | Ga0207644_10000049 | Ga0207644_1000004971 | 327 |
| 222 | 3300025941 | Ga0207711_10000393 | Ga0207711_1000039318 | 327 |
| 223 | 3300025986 | Ga0207658_10000073 | Ga0207658_1000007389 | 327 |
| 224 | 3300026088 | Ga0207641_10006988 | Ga0207641_100069885 | 327 |
| 225 | 3300026088 | Ga0207641_10012294 | Ga0207641_100122947 | 327 |
| 226 | 3300026095 | Ga0207676_10000010 | Ga0207676_1000001089 | 327 |
| 227 | 3300028379 | Ga0268266_10053633 | Ga0268266_100536332 | 327 |
| 228 | 3300028380 | Ga0268265_10001086 | Ga0268265_100010865 | 327 |
| 229 | 3300028381 | Ga0268264_10000123 | Ga0268264_10000123170 | 327 |
| 230 | 3300041453 | Ga0451797_0878899 | Ga0451797_0878899_525_1622 | 327 |
| 231 | 3300046558 | Ga0495633_0009843 | Ga0495633_0009843_822_1919 | 327 |
| 232 | 3300048922 | Ga0496119_0001728 | Ga0496119_0001728_2988_4079 | 327 |
| 233 | 3300048923 | Ga0496120_0000605 | Ga0496120_0000605_2976_4067 | 327 |
| 234 | 3300048927 | Ga0496124_0076260 | Ga0496124_0076260_1376_2398 | 327 |
| 235 | 3300049580 | Ga0501046_0030906 | Ga0501046_0030906_1406_2410 | 327 |
| 236 | 3300049584 | Ga0501068_0008363 | Ga0501068_0008363_646_1650 | 327 |
| 237 | 3300049590 | Ga0501074_0137626 | Ga0501074_0137626_49_1089 | 327 |
| 238 | 3300049741 | Ga0501079_0054416 | Ga0501079_0054416_1393_2397 | 327 |
| 239 | 3300049822 | Ga0501035_0189279 | Ga0501035_0189279_80_1084 | 327 |
| 240 | 3300053161 | Ga0500634_0094406 | Ga0500634_0094406_277_1374 | 327 |
| 241 | 3300003771 | Ga0055526_1009464 | Ga0055526_10094641 | 328 |
| 242 | 3300003791 | Ga0055530_10003828 | Ga0055530_100038282 | 328 |
| 243 | 3300005344 | Ga0070661_100004480 | Ga0070661_1000044805 | 328 |
| 244 | 3300005345 | Ga0070692_10011935 | Ga0070692_100119352 | 328 |
| 245 | 3300005616 | Ga0068852_100058737 | Ga0068852_1000587372 | 328 |
| 246 | 3300009979 | Ga0105032_102285 | Ga0105032_1022852 | 328 |
| 247 | 3300025284 | Ga0209130_1026971 | Ga0209130_10269711 | 328 |
| 248 | 3300025292 | Ga0209676_1005540 | Ga0209676_10055402 | 328 |
| 249 | 3300025298 | Ga0209050_1001146 | Ga0209050_100114613 | 328 |
| 250 | 3300025303 | Ga0209051_1010564 | Ga0209051_10105644 | 328 |
| 251 | 3300025304 | Ga0209257_1001062 | Ga0209257_100106216 | 328 |
| 252 | 3300025921 | Ga0207652_10161664 | Ga0207652_101616642 | 328 |
| 253 | 3300026067 | Ga0207678_10014004 | Ga0207678_100140045 | 328 |
| 254 | 3300031731 | Ga0307405_10008187 | Ga0307405_100081875 | 328 |
| 255 | 3300031852 | Ga0307410_10035339 | Ga0307410_100353393 | 328 |
| 256 | 3300031903 | Ga0307407_10028001 | Ga0307407_100280012 | 328 |
| 257 | 3300031995 | Ga0307409_100215943 | Ga0307409_1002159432 | 328 |
| 258 | 3300032002 | Ga0307416_100249072 | Ga0307416_1002490722 | 328 |
| 259 | 3300032004 | Ga0307414_10206376 | Ga0307414_102063762 | 328 |
| 260 | 3300032005 | Ga0307411_10044316 | Ga0307411_100443163 | 328 |
| 261 | 3300032126 | Ga0307415_100035163 | Ga0307415_1000351633 | 328 |
| 262 | 3300041413 | Ga0439465_0068937 | Ga0439465_0068937_32_1072 | 328 |
| 263 | 3300042006 | Ga0439432_035924 | Ga0439432_035924_433_1473 | 328 |
| 264 | 3300042007 | Ga0439449_0020398 | Ga0439449_0020398_1169_2209 | 328 |
| 265 | 3300049579 | Ga0501043_0065770 | Ga0501043_0065770_1165_2310 | 328 |
| 266 | 3300049586 | Ga0501070_0166995 | Ga0501070_0166995_502_1629 | 328 |
| 267 | 3300049653 | Ga0501206_014084 | Ga0501206_014084_10_1050 | 328 |
| 268 | 3300049686 | Ga0501257_010657 | Ga0501257_010657_391_1431 | 328 |
| 269 | 3300049687 | Ga0501258_005025 | Ga0501258_005025_190_1230 | 328 |
| 270 | 3300049705 | Ga0501225_0023020 | Ga0501225_0023020_233_1273 | 328 |
| 271 | 3300049769 | Ga0501272_008396 | Ga0501272_008396_10_1050 | 328 |
| 272 | iso_pu_bacteria | 2510065053 | 2510284134 | 328 |
| 273 | iso_pu_bacteria | 2510065055 | 2510293190 | 328 |
| 274 | iso_pu_bacteria | 2510065058 | 2510312684 | 328 |
| 275 | iso_pu_bacteria | 2773857672 | 2774130520 | 328 |
| 276 | iso_pu_bacteria | 2974298342 | 2974301543 | 328 |
| 277 | iso_pu_bacteria | 2984499530 | 2984503986 | 328 |
| 278 | iso_pu_bacteria | 8002869464 | 8002871674 | 328 |
| 279 | 3300031251 | Ga0265327_10052702 | Ga0265327_100527024 | 329 |
| 280 | 3300031548 | Ga0307408_100180265 | Ga0307408_1001802651 | 329 |
| 281 | 3300049705 | Ga0501225_0051860 | Ga0501225_0051860_76_1071 | 329 |
| 282 | 3300003187 | JGI25151J46595_10000183 | JGI25151J46595_1000018339 | 330 |
| 283 | 3300005344 | Ga0070661_100254797 | Ga0070661_1002547971 | 330 |
| 284 | 3300005578 | Ga0068854_100005144 | Ga0068854_1000051443 | 330 |
| 285 | 3300006871 | Ga0075434_100149224 | Ga0075434_1001492241 | 330 |
| 286 | 3300009093 | Ga0105240_10020333 | Ga0105240_100203333 | 330 |
| 287 | 3300009545 | Ga0105237_10000348 | Ga0105237_1000034812 | 330 |
| 288 | 3300009551 | Ga0105238_10433190 | Ga0105238_104331902 | 330 |
| 289 | 3300013100 | Ga0157373_10063523 | Ga0157373_100635232 | 330 |
| 290 | 3300013102 | Ga0157371_10066765 | Ga0157371_100667651 | 330 |
| 291 | 3300013104 | Ga0157370_10017945 | Ga0157370_100179456 | 330 |
| 292 | 3300013104 | Ga0157370_10156688 | Ga0157370_101566881 | 330 |
| 293 | 3300013105 | Ga0157369_10042343 | Ga0157369_100423433 | 330 |
| 294 | 3300013296 | Ga0157374_10014089 | Ga0157374_100140894 | 330 |
| 295 | 3300013307 | Ga0157372_10263919 | Ga0157372_102639192 | 330 |
| 296 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015191 | 330 |
| 297 | 3300025297 | Ga0209758_1011751 | Ga0209758_10117514 | 330 |
| 298 | 3300025904 | Ga0207647_10108731 | Ga0207647_101087311 | 330 |
| 299 | 3300025913 | Ga0207695_10107679 | Ga0207695_101076794 | 330 |
| 300 | 3300025920 | Ga0207649_10225719 | Ga0207649_102257192 | 330 |
| 301 | 3300025981 | Ga0207640_10000423 | Ga0207640_100004233 | 330 |
| 302 | 3300027876 | Ga0209974_10016414 | Ga0209974_100164142 | 330 |
| 303 | 3300031901 | Ga0307406_10026385 | Ga0307406_100263852 | 330 |
| 304 | 3300037312 | Ga0395899_0011332 | Ga0395899_0011332_4743_5759 | 330 |
| 305 | 3300037418 | Ga0395900_0099121 | Ga0395900_0099121_1652_2668 | 330 |
| 306 | 3300037418 | Ga0395900_0175637 | Ga0395900_0175637_547_1563 | 330 |
| 307 | 3300037466 | Ga0395898_0030081 | Ga0395898_0030081_4353_5369 | 330 |
| 308 | 3300037466 | Ga0395898_0061392 | Ga0395898_0061392_101_1117 | 330 |
| 309 | 3300044694 | Ga0466963_0178071 | Ga0466963_0178071_106_1122 | 330 |
| 310 | 3300044842 | Ga0466957_0067438 | Ga0466957_0067438_776_1792 | 330 |
| 311 | 3300045049 | Ga0466959_0038586 | Ga0466959_0038586_1301_2317 | 330 |
| 312 | 3300049823 | Ga0501044_0005580 | Ga0501044_0005580_11927_12940 | 330 |
| 313 | 3300050512 | nmdc:mga0n895_149757_c1 | nmdc:mga0n895_149757_c1_1251_2306 | 330 |
| 314 | iso_pu_bacteria | 2941489479 | 2941489595 | 330 |
| 315 | 3300003187 | JGI25151J46595_10000183 | JGI25151J46595_1000018337 | 331 |
| 316 | 3300005455 | Ga0070663_100011268 | Ga0070663_1000112685 | 331 |
| 317 | 3300005547 | Ga0070693_100022123 | Ga0070693_1000221231 | 331 |
| 318 | 3300005563 | Ga0068855_100046292 | Ga0068855_1000462925 | 331 |
| 319 | 3300005578 | Ga0068854_100160550 | Ga0068854_1001605502 | 331 |
| 320 | 3300005614 | Ga0068856_100000234 | Ga0068856_1000002342 | 331 |
| 321 | 3300009036 | Ga0105244_10007676 | Ga0105244_100076764 | 331 |
| 322 | 3300013100 | Ga0157373_10086535 | Ga0157373_100865351 | 331 |
| 323 | 3300013105 | Ga0157369_10001849 | Ga0157369_1000184910 | 331 |
| 324 | 3300020078 | Ga0206352_10574363 | Ga0206352_105743632 | 331 |
| 325 | 3300025246 | Ga0209646_1003226 | Ga0209646_10032263 | 331 |
| 326 | 3300025250 | Ga0209026_1000162 | Ga0209026_100016269 | 331 |
| 327 | 3300025256 | Ga0209759_1000906 | Ga0209759_100090612 | 331 |
| 328 | 3300025272 | Ga0209455_1000261 | Ga0209455_100026134 | 331 |
| 329 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015190 | 331 |
| 330 | 3300025297 | Ga0209758_1011751 | Ga0209758_10117513 | 331 |
| 331 | 3300025913 | Ga0207695_10021839 | Ga0207695_100218396 | 331 |
| 332 | 3300025914 | Ga0207671_10000167 | Ga0207671_1000016753 | 331 |
| 333 | 3300025924 | Ga0207694_10279842 | Ga0207694_102798422 | 331 |
| 334 | 3300025949 | Ga0207667_10039795 | Ga0207667_100397953 | 331 |
| 335 | 3300025981 | Ga0207640_10032912 | Ga0207640_100329121 | 331 |
| 336 | 3300026067 | Ga0207678_10022995 | Ga0207678_100229952 | 331 |
| 337 | 3300026078 | Ga0207702_10000113 | Ga0207702_1000011339 | 331 |
| 338 | 3300038705 | Ga0237819_00047 | Ga0237819_00047_36532_37635 | 331 |
| 339 | 3300046616 | Ga0495668_0013505 | Ga0495668_0013505_936_2024 | 331 |
| 340 | 3300048917 | Ga0496114_0000915 | Ga0496114_0000915_2891_3985 | 331 |
| 341 | 3300049571 | Ga0501034_0195122 | Ga0501034_0195122_916_1947 | 331 |
| 342 | 3300049572 | Ga0501036_0022651 | Ga0501036_0022651_2607_3638 | 331 |
| 343 | 3300049573 | Ga0501037_0056576 | Ga0501037_0056576_1448_2464 | 331 |
| 344 | 3300049578 | Ga0501042_0029270 | Ga0501042_0029270_1860_2879 | 331 |
| 345 | 3300049579 | Ga0501043_0020494 | Ga0501043_0020494_1006_2037 | 331 |
| 346 | 3300049586 | Ga0501070_0351963 | Ga0501070_0351963_140_1171 | 331 |
| 347 | 3300049822 | Ga0501035_0013181 | Ga0501035_0013181_2548_3564 | 331 |
| 348 | 3300049822 | Ga0501035_0132748 | Ga0501035_0132748_1019_2050 | 331 |
| 349 | 3300049823 | Ga0501044_0015688 | Ga0501044_0015688_3676_4692 | 331 |
| 350 | iso_pu_bacteria | 2547132130 | 2547501601 | 331 |
| 351 | iso_pu_bacteria | 2576861471 | 2578458986 | 331 |
| 352 | iso_pu_bacteria | 2643221559 | 2643818984 | 331 |
| 353 | iso_pu_bacteria | 2643221586 | 2643941345 | 331 |
| 354 | iso_pu_bacteria | 2643221593 | 2643974385 | 331 |
| 355 | iso_pu_bacteria | 2643221612 | 2644080410 | 331 |
| 356 | iso_pu_bacteria | 2643221720 | 2644662884 | 331 |
| 357 | iso_pu_bacteria | 2643221727 | 2644697023 | 331 |
| 358 | iso_pu_bacteria | 2643221728 | 2644698161 | 331 |
| 359 | iso_pu_bacteria | 2747842428 | 2747948697 | 331 |
| 360 | iso_pu_bacteria | 2765235840 | 2765578389 | 331 |
| 361 | iso_pu_bacteria | 2816332141 | 2816516416 | 331 |
| 362 | iso_pu_bacteria | 2818991457 | 2819663582 | 331 |
| 363 | iso_pu_bacteria | 2842391507 | 2842392873 | 331 |
| 364 | iso_pu_bacteria | 2842757796 | 2842758662 | 331 |
| 365 | iso_pu_bacteria | 2852649853 | 2852651317 | 331 |
| 366 | iso_pu_bacteria | 2852684882 | 2852686285 | 331 |
| 367 | iso_pu_bacteria | 2857442823 | 2857446847 | 331 |
| 368 | iso_pu_bacteria | 2874220319 | 2874221017 | 331 |
| 369 | iso_pu_bacteria | 2919089067 | 2919091228 | 331 |
| 370 | iso_pu_bacteria | 2919130084 | 2919132411 | 331 |
| 371 | iso_pu_bacteria | 2919134579 | 2919136738 | 331 |
| 372 | iso_pu_bacteria | 2919513703 | 2919516544 | 331 |
| 373 | iso_pu_bacteria | 2919675420 | 2919678572 | 331 |
| 374 | iso_pu_bacteria | 2928496128 | 2928497859 | 331 |
| 375 | iso_pu_bacteria | 2929195423 | 2929197122 | 331 |
| 376 | iso_pu_bacteria | 2931380184 | 2931381339 | 331 |
| 377 | iso_pu_bacteria | 2937610967 | 2937611838 | 331 |
| 378 | iso_pu_bacteria | 2939589442 | 2939590524 | 331 |
| 379 | iso_pu_bacteria | 2939622612 | 2939622683 | 331 |
| 380 | iso_pu_bacteria | 2939626828 | 2939627779 | 331 |
| 381 | iso_pu_bacteria | 2941475908 | 2941477741 | 331 |
| 382 | iso_pu_bacteria | 2961047084 | 2961047782 | 331 |
| 383 | iso_pu_bacteria | 2961064222 | 2961067124 | 331 |
| 384 | iso_pu_bacteria | 2974307012 | 2974309432 | 331 |
| 385 | iso_pu_bacteria | 2977247770 | 2977250151 | 331 |
| 386 | iso_pu_bacteria | 2984514374 | 2984515357 | 331 |
| 387 | iso_pu_bacteria | 2987605356 | 2987605820 | 331 |
| 388 | iso_pu_bacteria | 2995948881 | 2995950869 | 331 |
| 389 | iso_pu_bacteria | 8002869464 | 8002871675 | 331 |
| 390 | iso_pu_bacteria | 8021622325 | 8021626518 | 331 |
| 391 | iso_pu_bacteria | 8021626552 | 8021628139 | 331 |
| 392 | iso_pu_bacteria | 8021648035 | 8021648631 | 331 |
| 393 | 3300005456 | Ga0070678_100120271 | Ga0070678_1001202711 | 332 |
| 394 | 3300005548 | Ga0070665_100094082 | Ga0070665_1000940823 | 332 |
| 395 | 3300025294 | Ga0209025_1022654 | Ga0209025_10226542 | 332 |
| 396 | 3300025972 | Ga0207668_10009979 | Ga0207668_100099792 | 332 |
| 397 | 3300026067 | Ga0207678_10072065 | Ga0207678_100720652 | 332 |
| 398 | 3300026121 | Ga0207683_10148720 | Ga0207683_101487202 | 332 |
| 399 | 3300028379 | Ga0268266_10173357 | Ga0268266_101733571 | 332 |
| 400 | 3300030731 | Ga0316177_1136997 | Ga0316177_11369972 | 332 |
| 401 | 3300031238 | Ga0265332_10097128 | Ga0265332_100971281 | 332 |
| 402 | 3300032004 | Ga0307414_10008346 | Ga0307414_100083464 | 332 |
| 403 | 3300046460 | Ga0495638_0183320 | Ga0495638_0183320_73_1164 | 332 |
| 404 | 3300048919 | Ga0496116_0022348 | Ga0496116_0022348_3184_4272 | 332 |
| 405 | 3300049569 | Ga0501032_0053533 | Ga0501032_0053533_573_1592 | 332 |
| 406 | 3300049570 | Ga0501033_0122922 | Ga0501033_0122922_790_1809 | 332 |
| 407 | 3300049571 | Ga0501034_0089351 | Ga0501034_0089351_1849_2868 | 332 |
| 408 | 3300049576 | Ga0501040_0063313 | Ga0501040_0063313_319_1338 | 332 |
| 409 | 3300049586 | Ga0501070_0080698 | Ga0501070_0080698_1594_2613 | 332 |
| 410 | 3300049588 | Ga0501072_0200304 | Ga0501072_0200304_140_1159 | 332 |
| 411 | 3300049742 | Ga0501080_0188210 | Ga0501080_0188210_339_1358 | 332 |
| 412 | iso_pu_bacteria | 2571042365 | 2572253449 | 332 |
| 413 | iso_pu_bacteria | 2643221579 | 2643905705 | 332 |
| 414 | iso_pu_bacteria | 2643221581 | 2643913165 | 332 |
| 415 | iso_pu_bacteria | 2895511927 | 2895512232 | 332 |
| 416 | iso_pu_bacteria | 2895522137 | 2895522243 | 332 |
| 417 | iso_pu_bacteria | 2895525241 | 2895527314 | 332 |
| 418 | iso_pu_bacteria | 2923516293 | 2923517807 | 332 |
| 419 | 3300005355 | Ga0070671_100004291 | Ga0070671_1000042913 | 333 |
| 420 | 3300005616 | Ga0068852_100014711 | Ga0068852_1000147112 | 333 |
| 421 | 3300025931 | Ga0207644_10001185 | Ga0207644_1000118511 | 333 |
| 422 | 3300026067 | Ga0207678_10199245 | Ga0207678_101992452 | 333 |
| 423 | 3300026142 | Ga0207698_10009887 | Ga0207698_100098878 | 333 |
| 424 | 3300031730 | Ga0307516_10102543 | Ga0307516_101025432 | 333 |
| 425 | 3300032002 | Ga0307416_100029159 | Ga0307416_1000291594 | 333 |
| 426 | 3300032002 | Ga0307416_100042911 | Ga0307416_1000429115 | 333 |
| 427 | 3300037312 | Ga0395899_0009887 | Ga0395899_0009887_3371_4444 | 333 |
| 428 | 3300037418 | Ga0395900_0098299 | Ga0395900_0098299_88_1161 | 333 |
| 429 | 3300037471 | Ga0395905_0004830 | Ga0395905_0004830_3663_4736 | 333 |
| 430 | 3300038443 | Ga0395901_0018705 | Ga0395901_0018705_2835_3908 | 333 |
| 431 | 3300048903 | Ga0496100_0142789 | Ga0496100_0142789_361_1443 | 333 |
| 432 | 3300048904 | Ga0496101_0060606 | Ga0496101_0060606_102_1184 | 333 |
| 433 | 3300048911 | Ga0496108_0023131 | Ga0496108_0023131_2516_3598 | 333 |
| 434 | 3300048912 | Ga0496109_0010311 | Ga0496109_0010311_3415_4497 | 333 |
| 435 | 3300048916 | Ga0496113_0010772 | Ga0496113_0010772_2697_3779 | 333 |
| 436 | iso_pu_bacteria | 2524614729 | 2525555999 | 333 |
| 437 | iso_pu_bacteria | 2627854209 | 2630651013 | 333 |
| 438 | iso_pu_bacteria | 2643221579 | 2643905706 | 333 |
| 439 | iso_pu_bacteria | 2643221581 | 2643913164 | 333 |
| 440 | iso_pu_bacteria | 2643221593 | 2643974384 | 333 |
| 441 | iso_pu_bacteria | 2923516293 | 2923517808 | 333 |
| 442 | iso_pu_bacteria | 2941489479 | 2941489594 | 333 |
| 443 | iso_pu_bacteria | 2995948881 | 2995950870 | 333 |
| 444 | 3300003771 | Ga0055526_1000036 | Ga0055526_1000036123 | 334 |
| 445 | 3300003773 | Ga0055537_1000083 | Ga0055537_10000833 | 334 |
| 446 | 3300003775 | Ga0055524_1000359 | Ga0055524_100035936 | 334 |
| 447 | 3300003784 | Ga0055534_1000103 | Ga0055534_100010359 | 334 |
| 448 | 3300003790 | Ga0055528_1000004 | Ga0055528_1000004268 | 334 |
| 449 | 3300003794 | Ga0055531_10017094 | Ga0055531_100170942 | 334 |
| 450 | 3300005339 | Ga0070660_100026051 | Ga0070660_1000260511 | 334 |
| 451 | 3300005366 | Ga0070659_100003974 | Ga0070659_1000039745 | 334 |
| 452 | 3300005548 | Ga0070665_100015383 | Ga0070665_1000153836 | 334 |
| 453 | 3300015689 | Ga0183360_10001 | Ga0183360_100012290 | 334 |
| 454 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011568 | 334 |
| 455 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011568 | 334 |
| 456 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001966 | 334 |
| 457 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011128 | 334 |
| 458 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002426 | 334 |
| 459 | 3300028379 | Ga0268266_10028958 | Ga0268266_100289582 | 334 |
| 460 | 3300049575 | Ga0501039_0021732 | Ga0501039_0021732_2566_3609 | 334 |
| 461 | 3300049580 | Ga0501046_0286939 | Ga0501046_0286939_128_1171 | 334 |
| 462 | 3300049581 | Ga0501047_0008649 | Ga0501047_0008649_2548_3591 | 334 |
| 463 | 3300049581 | Ga0501047_0090986 | Ga0501047_0090986_1019_2062 | 334 |
| 464 | 3300053098 | Ga0500650_0000007 | Ga0500650_0000007_95025_96053 | 334 |
| 465 | 3300003856 | Ga0058692_1000002 | Ga0058692_1000002310 | 335 |
| 466 | 3300005347 | Ga0070668_100050653 | Ga0070668_1000506533 | 335 |
| 467 | 3300025292 | Ga0209676_1019683 | Ga0209676_10196832 | 335 |
| 468 | 3300025304 | Ga0209257_1000148 | Ga0209257_100014893 | 335 |
| 469 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004518 | 335 |
| 470 | 3300027552 | Ga0209982_1009959 | Ga0209982_10099591 | 335 |
| 471 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005528 | 335 |
| 472 | 3300031665 | Ga0316575_10025114 | Ga0316575_100251142 | 335 |
| 473 | 3300031824 | Ga0307413_10042644 | Ga0307413_100426443 | 335 |
| 474 | 3300032004 | Ga0307414_10001756 | Ga0307414_1000175613 | 335 |
| 475 | 3300035398 | Ga0316574_0144620 | Ga0316574_0144620_136_1167 | 335 |
| 476 | 3300037471 | Ga0395905_0036766 | Ga0395905_0036766_1160_2239 | 335 |
| 477 | 3300048925 | Ga0496122_0000220 | Ga0496122_0000220_87502_88593 | 335 |
| 478 | 3300048926 | Ga0496123_0000151 | Ga0496123_0000151_38462_39553 | 335 |
| 479 | 3300048929 | Ga0496126_0095881 | Ga0496126_0095881_800_1891 | 335 |
| 480 | 3300049568 | Ga0501031_0035577 | Ga0501031_0035577_244_1455 | 335 |
| 481 | 3300049570 | Ga0501033_0044899 | Ga0501033_0044899_403_1614 | 335 |
| 482 | 3300049571 | Ga0501034_0000822 | Ga0501034_0000822_17401_18420 | 335 |
| 483 | 3300049571 | Ga0501034_0000822 | Ga0501034_0000822_18881_19975 | 335 |
| 484 | 3300050491 | nmdc:mga00v17_102185_c1 | nmdc:mga00v17_102185_c1_313_1404 | 335 |
| 485 | 3300005335 | Ga0070666_10112566 | Ga0070666_101125662 | 336 |
| 486 | 3300005347 | Ga0070668_100005796 | Ga0070668_1000057965 | 336 |
| 487 | 3300005356 | Ga0070674_100281229 | Ga0070674_1002812291 | 336 |
| 488 | 3300005367 | Ga0070667_100000012 | Ga0070667_100000012134 | 336 |
| 489 | 3300005455 | Ga0070663_100000126 | Ga0070663_1000001267 | 336 |
| 490 | 3300005539 | Ga0068853_100000768 | Ga0068853_1000007688 | 336 |
| 491 | 3300005539 | Ga0068853_100008635 | Ga0068853_1000086355 | 336 |
| 492 | 3300005539 | Ga0068853_100042082 | Ga0068853_1000420822 | 336 |
| 493 | 3300005548 | Ga0070665_100061222 | Ga0070665_1000612222 | 336 |
| 494 | 3300005548 | Ga0070665_100092750 | Ga0070665_1000927502 | 336 |
| 495 | 3300005563 | Ga0068855_100001280 | Ga0068855_10000128027 | 336 |
| 496 | 3300005563 | Ga0068855_100046906 | Ga0068855_1000469066 | 336 |
| 497 | 3300005577 | Ga0068857_100057901 | Ga0068857_1000579015 | 336 |
| 498 | 3300005617 | Ga0068859_100007853 | Ga0068859_1000078536 | 336 |
| 499 | 3300005843 | Ga0068860_100163794 | Ga0068860_1001637941 | 336 |
| 500 | 3300005844 | Ga0068862_100000164 | Ga0068862_10000016465 | 336 |
| 501 | 3300006051 | Ga0075364_10000438 | Ga0075364_100004385 | 336 |
| 502 | 3300006237 | Ga0097621_100089419 | Ga0097621_1000894193 | 336 |
| 503 | 3300006931 | Ga0097620_100007853 | Ga0097620_1000078536 | 336 |
| 504 | 3300009177 | Ga0105248_10000179 | Ga0105248_1000017951 | 336 |
| 505 | 3300009545 | Ga0105237_10002762 | Ga0105237_100027629 | 336 |
| 506 | 3300009545 | Ga0105237_10126843 | Ga0105237_101268432 | 336 |
| 507 | 3300009553 | Ga0105249_10000262 | Ga0105249_1000026252 | 336 |
| 508 | 3300010375 | Ga0105239_10000401 | Ga0105239_1000040150 | 336 |
| 509 | 3300010375 | Ga0105239_10095895 | Ga0105239_100958953 | 336 |
| 510 | 3300010375 | Ga0105239_10162004 | Ga0105239_101620042 | 336 |
| 511 | 3300012482 | Ga0157318_1000466 | Ga0157318_10004662 | 336 |
| 512 | 3300013307 | Ga0157372_10214716 | Ga0157372_102147161 | 336 |
| 513 | 3300025303 | Ga0209051_1006438 | Ga0209051_10064384 | 336 |
| 514 | 3300025914 | Ga0207671_10020004 | Ga0207671_100200042 | 336 |
| 515 | 3300025914 | Ga0207671_10079929 | Ga0207671_100799292 | 336 |
| 516 | 3300025937 | Ga0207669_10122239 | Ga0207669_101222391 | 336 |
| 517 | 3300025941 | Ga0207711_10000406 | Ga0207711_1000040615 | 336 |
| 518 | 3300025949 | Ga0207667_10002512 | Ga0207667_100025126 | 336 |
| 519 | 3300025949 | Ga0207667_10088441 | Ga0207667_100884413 | 336 |
| 520 | 3300025961 | Ga0207712_10018395 | Ga0207712_100183953 | 336 |
| 521 | 3300025986 | Ga0207658_10000027 | Ga0207658_10000027117 | 336 |
| 522 | 3300026041 | Ga0207639_10000800 | Ga0207639_1000080018 | 336 |
| 523 | 3300026041 | Ga0207639_10001128 | Ga0207639_1000112813 | 336 |
| 524 | 3300026041 | Ga0207639_10062770 | Ga0207639_100627702 | 336 |
| 525 | 3300026041 | Ga0207639_10076983 | Ga0207639_100769832 | 336 |
| 526 | 3300026067 | Ga0207678_10000258 | Ga0207678_1000025830 | 336 |
| 527 | 3300026067 | Ga0207678_10119925 | Ga0207678_101199251 | 336 |
| 528 | 3300026116 | Ga0207674_10006108 | Ga0207674_1000610813 | 336 |
| 529 | 3300028379 | Ga0268266_10181353 | Ga0268266_101813532 | 336 |
| 530 | 3300028380 | Ga0268265_10000186 | Ga0268265_1000018664 | 336 |
| 531 | 3300028380 | Ga0268265_10022795 | Ga0268265_100227952 | 336 |
| 532 | 3300028381 | Ga0268264_10309693 | Ga0268264_103096932 | 336 |
| 533 | 3300030733 | Ga0314311_1231852 | Ga0314311_12318522 | 336 |
| 534 | 3300031852 | Ga0307410_10151279 | Ga0307410_101512791 | 336 |
| 535 | 3300037471 | Ga0395905_0080660 | Ga0395905_0080660_29_1126 | 336 |
| 536 | 3300041404 | Ga0439436_0025090 | Ga0439436_0025090_599_1693 | 336 |
| 537 | 3300041453 | Ga0451797_1574149 | Ga0451797_1574149_454_1533 | 336 |
| 538 | 3300041460 | Ga0451802_0202710 | Ga0451802_0202710_2328_3350 | 336 |
| 539 | 3300041494 | Ga0451837_1126891 | Ga0451837_1126891_374_1504 | 336 |
| 540 | 3300041509 | Ga0451843_1236032 | Ga0451843_1236032_354_1484 | 336 |
| 541 | 3300042007 | Ga0439449_0000272 | Ga0439449_0000272_8132_9226 | 336 |
| 542 | 3300042007 | Ga0439449_0004443 | Ga0439449_0004443_3472_4566 | 336 |
| 543 | 3300042007 | Ga0439449_0004460 | Ga0439449_0004460_4273_5295 | 336 |
| 544 | 3300044658 | Ga0466972_0000629 | Ga0466972_0000629_10338_11360 | 336 |
| 545 | 3300044765 | Ga0466970_0000172 | Ga0466970_0000172_5697_6719 | 336 |
| 546 | 3300046525 | Ga0495663_0002717 | Ga0495663_0002717_677_1825 | 336 |
| 547 | 3300047472 | Ga0495686_0001563 | Ga0495686_0001563_13475_14497 | 336 |
| 548 | 3300048918 | Ga0496115_0285411 | Ga0496115_0285411_104_1126 | 336 |
| 549 | 3300048920 | Ga0496117_0010386 | Ga0496117_0010386_5419_6441 | 336 |
| 550 | 3300048921 | Ga0496118_0000682 | Ga0496118_0000682_13869_14891 | 336 |
| 551 | 3300048921 | Ga0496118_0003292 | Ga0496118_0003292_13417_14439 | 336 |
| 552 | 3300048925 | Ga0496122_0001331 | Ga0496122_0001331_36441_37463 | 336 |
| 553 | 3300048926 | Ga0496123_0000107 | Ga0496123_0000107_149273_150295 | 336 |
| 554 | 3300048929 | Ga0496126_0017194 | Ga0496126_0017194_6139_7161 | 336 |
| 555 | 3300049569 | Ga0501032_0001950 | Ga0501032_0001950_7259_8281 | 336 |
| 556 | 3300049570 | Ga0501033_0009648 | Ga0501033_0009648_4074_5105 | 336 |
| 557 | 3300049570 | Ga0501033_0016560 | Ga0501033_0016560_4431_5453 | 336 |
| 558 | 3300049571 | Ga0501034_0002484 | Ga0501034_0002484_20398_21420 | 336 |
| 559 | 3300049571 | Ga0501034_0010768 | Ga0501034_0010768_7840_8934 | 336 |
| 560 | 3300049571 | Ga0501034_0023790 | Ga0501034_0023790_368_1399 | 336 |
| 561 | 3300049573 | Ga0501037_0001245 | Ga0501037_0001245_15666_16688 | 336 |
| 562 | 3300049573 | Ga0501037_0037684 | Ga0501037_0037684_2255_3286 | 336 |
| 563 | 3300049574 | Ga0501038_0006070 | Ga0501038_0006070_9502_10533 | 336 |
| 564 | 3300049575 | Ga0501039_0010599 | Ga0501039_0010599_346_1368 | 336 |
| 565 | 3300049575 | Ga0501039_0019791 | Ga0501039_0019791_2425_3456 | 336 |
| 566 | 3300049579 | Ga0501043_0002712 | Ga0501043_0002712_11716_12738 | 336 |
| 567 | 3300049579 | Ga0501043_0010830 | Ga0501043_0010830_1258_2289 | 336 |
| 568 | 3300049580 | Ga0501046_0014070 | Ga0501046_0014070_1073_2104 | 336 |
| 569 | 3300049580 | Ga0501046_0028250 | Ga0501046_0028250_1970_2992 | 336 |
| 570 | 3300049581 | Ga0501047_0018572 | Ga0501047_0018572_2209_3231 | 336 |
| 571 | 3300049586 | Ga0501070_0042467 | Ga0501070_0042467_2258_3289 | 336 |
| 572 | 3300049589 | Ga0501073_0031310 | Ga0501073_0031310_73_1095 | 336 |
| 573 | 3300049589 | Ga0501073_0080063 | Ga0501073_0080063_499_1530 | 336 |
| 574 | 3300049742 | Ga0501080_0006579 | Ga0501080_0006579_6629_7660 | 336 |
| 575 | 3300049742 | Ga0501080_0118455 | Ga0501080_0118455_1355_2377 | 336 |
| 576 | 3300049742 | Ga0501080_0178029 | Ga0501080_0178029_185_1216 | 336 |
| 577 | 3300049822 | Ga0501035_0034410 | Ga0501035_0034410_410_1441 | 336 |
| 578 | 3300049822 | Ga0501035_0175390 | Ga0501035_0175390_211_1233 | 336 |
| 579 | 3300049823 | Ga0501044_0013448 | Ga0501044_0013448_4394_5416 | 336 |
| 580 | 3300053079 | Ga0500610_0000158 | Ga0500610_0000158_7836_8858 | 336 |
| 581 | 3300053087 | Ga0500643_001164 | Ga0500643_001164_2919_3941 | 336 |
| 582 | 3300053093 | Ga0500651_0001249 | Ga0500651_0001249_11455_12477 | 336 |
| 583 | 3300053139 | Ga0500568_0003690 | Ga0500568_0003690_2743_3774 | 336 |
| 584 | 3300060353 | Ga0501082_0021662 | Ga0501082_0021662_3065_4096 | 336 |
| 585 | iso_pu_bacteria | 2643221695 | 2644528795 | 336 |
| 586 | 2162886007 | SwRhRL2b_contig_42121 | SwRhRL2b_0430.00007420 | 337 |
| 587 | 3300003771 | Ga0055526_1000036 | Ga0055526_1000036124 | 337 |
| 588 | 3300003773 | Ga0055537_1000083 | Ga0055537_10000832 | 337 |
| 589 | 3300003775 | Ga0055524_1000359 | Ga0055524_100035937 | 337 |
| 590 | 3300003781 | Ga0055536_1003198 | Ga0055536_10031987 | 337 |
| 591 | 3300003784 | Ga0055534_1000103 | Ga0055534_100010360 | 337 |
| 592 | 3300003790 | Ga0055528_1000004 | Ga0055528_1000004269 | 337 |
| 593 | 3300005289 | Ga0065704_10080768 | Ga0065704_100807684 | 337 |
| 594 | 3300005293 | Ga0065715_10194591 | Ga0065715_101945911 | 337 |
| 595 | 3300005331 | Ga0070670_100062560 | Ga0070670_1000625602 | 337 |
| 596 | 3300005347 | Ga0070668_100075087 | Ga0070668_1000750871 | 337 |
| 597 | 3300005353 | Ga0070669_100012001 | Ga0070669_1000120014 | 337 |
| 598 | 3300005355 | Ga0070671_100102580 | Ga0070671_1001025802 | 337 |
| 599 | 3300005355 | Ga0070671_100135430 | Ga0070671_1001354302 | 337 |
| 600 | 3300005356 | Ga0070674_100051839 | Ga0070674_1000518392 | 337 |
| 601 | 3300005548 | Ga0070665_100000077 | Ga0070665_100000077143 | 337 |
| 602 | 3300005564 | Ga0070664_100120811 | Ga0070664_1001208112 | 337 |
| 603 | 3300006051 | Ga0075364_10053176 | Ga0075364_100531762 | 337 |
| 604 | 3300006881 | Ga0068865_100115328 | Ga0068865_1001153282 | 337 |
| 605 | 3300009174 | Ga0105241_10516019 | Ga0105241_105160191 | 337 |
| 606 | 3300012512 | Ga0157327_1001669 | Ga0157327_10016691 | 337 |
| 607 | 3300013105 | Ga0157369_10294003 | Ga0157369_102940032 | 337 |
| 608 | 3300015689 | Ga0183360_10001 | Ga0183360_100012289 | 337 |
| 609 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011569 | 337 |
| 610 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011569 | 337 |
| 611 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001965 | 337 |
| 612 | 3300025292 | Ga0209676_1000024 | Ga0209676_1000024479 | 337 |
| 613 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011127 | 337 |
| 614 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002427 | 337 |
| 615 | 3300025304 | Ga0209257_1000148 | Ga0209257_100014894 | 337 |
| 616 | 3300025912 | Ga0207707_10173209 | Ga0207707_101732092 | 337 |
| 617 | 3300025921 | Ga0207652_10215981 | Ga0207652_102159813 | 337 |
| 618 | 3300025923 | Ga0207681_10010548 | Ga0207681_100105484 | 337 |
| 619 | 3300025924 | Ga0207694_10015555 | Ga0207694_100155554 | 337 |
| 620 | 3300025925 | Ga0207650_10070639 | Ga0207650_100706392 | 337 |
| 621 | 3300025931 | Ga0207644_10123618 | Ga0207644_101236182 | 337 |
| 622 | 3300025940 | Ga0207691_10041622 | Ga0207691_100416224 | 337 |
| 623 | 3300025960 | Ga0207651_10282001 | Ga0207651_102820011 | 337 |
| 624 | 3300025972 | Ga0207668_10089222 | Ga0207668_100892221 | 337 |
| 625 | 3300026041 | Ga0207639_10026103 | Ga0207639_100261031 | 337 |
| 626 | 3300027252 | Ga0209973_1006852 | Ga0209973_10068521 | 337 |
| 627 | 3300027543 | Ga0209999_1016445 | Ga0209999_10164452 | 337 |
| 628 | 3300027614 | Ga0209970_1013972 | Ga0209970_10139721 | 337 |
| 629 | 3300027665 | Ga0209983_1003327 | Ga0209983_10033272 | 337 |
| 630 | 3300027682 | Ga0209971_1013948 | Ga0209971_10139482 | 337 |
| 631 | 3300027876 | Ga0209974_10026909 | Ga0209974_100269091 | 337 |
| 632 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011553 | 337 |
| 633 | 3300031456 | Ga0307513_10038394 | Ga0307513_100383945 | 337 |
| 634 | 3300032004 | Ga0307414_10227258 | Ga0307414_102272581 | 337 |
| 635 | 3300041413 | Ga0439465_0002378 | Ga0439465_0002378_1000_2067 | 337 |
| 636 | 3300041413 | Ga0439465_0008709 | Ga0439465_0008709_2066_3079 | 337 |
| 637 | 3300042876 | Ga0451577_0002087 | Ga0451577_0002087_20312_21331 | 337 |
| 638 | 3300046539 | Ga0495621_0011311 | Ga0495621_0011311_552_1619 | 337 |
| 639 | 3300047318 | Ga0495636_0020099 | Ga0495636_0020099_614_1645 | 337 |
| 640 | 3300048910 | Ga0496107_0239664 | Ga0496107_0239664_31_1062 | 337 |
| 641 | 3300048914 | Ga0496111_0053415 | Ga0496111_0053415_1005_2036 | 337 |
| 642 | 3300048917 | Ga0496114_0000915 | Ga0496114_0000915_4197_5210 | 337 |
| 643 | 3300048917 | Ga0496114_0086321 | Ga0496114_0086321_1414_2592 | 337 |
| 644 | 3300048918 | Ga0496115_0139494 | Ga0496115_0139494_272_1450 | 337 |
| 645 | 3300048924 | Ga0496121_0004743 | Ga0496121_0004743_14457_15476 | 337 |
| 646 | 3300048926 | Ga0496123_0074405 | Ga0496123_0074405_640_1659 | 337 |
| 647 | 3300049513 | Ga0501290_000542 | Ga0501290_000542_2568_3587 | 337 |
| 648 | 3300049523 | Ga0501300_010952 | Ga0501300_010952_78_1097 | 337 |
| 649 | 3300049589 | Ga0501073_0073939 | Ga0501073_0073939_611_1708 | 337 |
| 650 | 3300049742 | Ga0501080_0081368 | Ga0501080_0081368_1340_2365 | 337 |
| 651 | 3300049742 | Ga0501080_0255198 | Ga0501080_0255198_234_1259 | 337 |
| 652 | 3300049762 | Ga0501265_000289 | Ga0501265_000289_1767_2786 | 337 |
| 653 | 3300049772 | Ga0501275_000710 | Ga0501275_000710_241_1260 | 337 |
| 654 | 3300049823 | Ga0501044_0019454 | Ga0501044_0019454_376_1401 | 337 |
| 655 | 3300049823 | Ga0501044_0068934 | Ga0501044_0068934_12_1037 | 337 |
| 656 | 3300050491 | nmdc:mga00v17_15952_c1 | nmdc:mga00v17_15952_c1_2113_3147 | 337 |
| 657 | 3300050491 | nmdc:mga00v17_83611_c1 | nmdc:mga00v17_83611_c1_608_1642 | 337 |
| 658 | iso_pu_bacteria | 2895498888 | 2895499210 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ods-assembly1.cif.gz_A | phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate | 0.9916 | 26 | 334 |
| 5i84-assembly5.cif.gz_E | structure of the xanthomonas citri phosphate-binding protein phox | 0.9913 | 26 | 337 |
| 5i84-assembly3.cif.gz_C | structure of the xanthomonas citri phosphate-binding protein phox | 0.9878 | 26 | 335 |
| 1pbp-assembly1.cif.gz_A | fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies | 0.9839 | 25 | 336 |
| 1quj-assembly1.cif.gz_A | phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate | 0.9824 | 25 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG82_103_278_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9929 | 101 | 277 | 3.40.190.10 |
| af_P0AG82_103_278_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9818 | 101 | 277 | 3.40.190.10 |
| 1pc3B02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.946 | 102 | 277 | 3.40.190.10 |
| 5i84A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9441 | 26 | 337 | 3.40.190.10 |
| 5i84A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9379 | 26 | 337 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4S1FX25-F1-model_v4 | Phosphate ABC transporter substrate-binding protein PstS | 0.9943 | 114 | 217 |
|
| AF-A0A6D0EMP2-F1-model_v4 | deleted | 0.9938 | 50 | 210 |
|
| AF-A0A2G8T783-F1-model_v4 | Phosphate-binding protein PstS | 0.9934 | 78 | 256 |
GO:0035435
GO:0042301 GO:0043190 |
| AF-A0A3S4FMK8-F1-model_v4 | deleted | 0.9934 | 85 | 209 |
|
| AF-A0A1J9PHQ6-F1-model_v4 | deleted | 0.9925 | 107 | 277 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar