F473255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 339 | 659 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300031090|Ga0265760_10028160|Ga0265760_100281602 |
| Length | 323 |
| Sequence | MAQPVAVHRPLGLPRYFQIIAVLLSVGPQAPRKGALTSPATAGPRADMDQELIAVVITVGETLMKNVPISIALAAVFTILTQFWACNPGKRWWQKRDLVTDLCYWFFIPVITRFLRIGLLIAAAAMIFNITTAGGLIAFYENGHGPLAALPLFAQGVIFLIGEDFIMYWSHRWFHGEPVLWKYHAVHHSSEELEWISAARFHPINLFLGSVLADVVMLFAGISPNVFVVLGPLTIAHSAFVHANLDWSLGPFKYVLAGPVFHRWHHTAAERGGEKNFASTFPILDVMFGTFYMPAGQLPDRYGIDDRAFPESFGAQLMHPFTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 75 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 175 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 324 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 326 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 331 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 332 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 338 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.65 |
| Nodule | 1.21 |
| Rhizoplane | 3.79 |
| Rhizosphere | 79.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002895 | 3300001979 | Bacteria | 7667 |
| 2 | JGI25406J46586_10012002 | 3300003203 | Bacteria | 3776 |
| 3 | JGI25153J46596_10004990 | 3300003215 | Bacteria | 7044 |
| 4 | rootL2_10016153 | 3300003322 | Bacteria | 3836 |
| 5 | JGI25404J52841_10002162 | 3300003659 | Bacteria | 3673 |
| 6 | JGI25404J52841_10027263 | 3300003659 | Bacteria | 1229 |
| 7 | Ga0055526_1012658 | 3300003771 | Bacteria | 3655 |
| 8 | Ga0065165_1004236 | 3300005262 | Bacteria | 9108 |
| 9 | Ga0070676_10169827 | 3300005328 | Bacteria | 1410 |
| 10 | Ga0070676_10179911 | 3300005328 | Bacteria | 1374 |
| 11 | Ga0070670_100014336 | 3300005331 | Bacteria | 6801 |
| 12 | Ga0068869_100026808 | 3300005334 | Bacteria | 4013 |
| 13 | Ga0068869_100152985 | 3300005334 | Bacteria | 1790 |
| 14 | Ga0068869_100238669 | 3300005334 | Bacteria | 1447 |
| 15 | Ga0070666_10096046 | 3300005335 | Bacteria | 2040 |
| 16 | Ga0070680_100047174 | 3300005336 | Bacteria | 3507 |
| 17 | Ga0070680_100185238 | 3300005336 | Bacteria | 1754 |
| 18 | Ga0070680_100626156 | 3300005336 | Unclassified | 924 |
| 19 | Ga0070682_100141865 | 3300005337 | Bacteria | 1639 |
| 20 | Ga0068868_100051453 | 3300005338 | Bacteria | 3240 |
| 21 | Ga0068868_100569111 | 3300005338 | Bacteria | 1001 |
| 22 | Ga0068868_100570817 | 3300005338 | Bacteria | 999 |
| 23 | Ga0070691_10001579 | 3300005341 | Bacteria | 9843 |
| 24 | Ga0070661_100158263 | 3300005344 | Bacteria | 1714 |
| 25 | Ga0070661_100322414 | 3300005344 | Bacteria | 1207 |
| 26 | Ga0070668_100124800 | 3300005347 | Bacteria | 2061 |
| 27 | Ga0070668_100285864 | 3300005347 | Bacteria | 1379 |
| 28 | Ga0070675_100512754 | 3300005354 | Bacteria | 1081 |
| 29 | Ga0070671_100084238 | 3300005355 | Bacteria | 2659 |
| 30 | Ga0070671_100087471 | 3300005355 | Bacteria | 2608 |
| 31 | Ga0070671_100119344 | 3300005355 | Bacteria | 2219 |
| 32 | Ga0070688_100018386 | 3300005365 | Bacteria | 4032 |
| 33 | Ga0070667_100015594 | 3300005367 | Bacteria | 6283 |
| 34 | Ga0070667_100334955 | 3300005367 | Bacteria | 1368 |
| 35 | Ga0070709_10001198 | 3300005434 | Bacteria | 14238 |
| 36 | Ga0070709_10003245 | 3300005434 | Bacteria | 8726 |
| 37 | Ga0070709_10004329 | 3300005434 | Bacteria | 7652 |
| 38 | Ga0070714_100002945 | 3300005435 | Bacteria | 12607 |
| 39 | Ga0070714_100060020 | 3300005435 | Bacteria | 3263 |
| 40 | Ga0070714_100133409 | 3300005435 | Bacteria | 2221 |
| 41 | Ga0070714_100156305 | 3300005435 | Bacteria | 2059 |
| 42 | Ga0070713_100000006 | 3300005436 | Bacteria | 190565 |
| 43 | Ga0070713_100001195 | 3300005436 | Bacteria | 16593 |
| 44 | Ga0070713_100051182 | 3300005436 | Bacteria | 3415 |
| 45 | Ga0070713_100068829 | 3300005436 | Bacteria | 2983 |
| 46 | Ga0070713_100083086 | 3300005436 | Bacteria | 2737 |
| 47 | Ga0070713_100091681 | 3300005436 | Bacteria | 2615 |
| 48 | Ga0070710_10000251 | 3300005437 | Bacteria | 25319 |
| 49 | Ga0070710_10001221 | 3300005437 | Bacteria | 12167 |
| 50 | Ga0070710_10004644 | 3300005437 | Bacteria | 6495 |
| 51 | Ga0070710_10081676 | 3300005437 | Bacteria | 1888 |
| 52 | Ga0070711_100000261 | 3300005439 | Bacteria | 27019 |
| 53 | Ga0070711_100028842 | 3300005439 | Bacteria | 3655 |
| 54 | Ga0070711_100035906 | 3300005439 | Bacteria | 3318 |
| 55 | Ga0070711_100072398 | 3300005439 | Bacteria | 2431 |
| 56 | Ga0070711_100571960 | 3300005439 | Unclassified | 940 |
| 57 | Ga0070694_100418163 | 3300005444 | Bacteria | 1053 |
| 58 | Ga0070663_100066364 | 3300005455 | Bacteria | 2614 |
| 59 | Ga0070678_100025543 | 3300005456 | Bacteria | 3976 |
| 60 | Ga0070662_100165933 | 3300005457 | Bacteria | 1730 |
| 61 | Ga0070662_100373026 | 3300005457 | Bacteria | 1173 |
| 62 | Ga0070681_10009972 | 3300005458 | Bacteria | 9367 |
| 63 | Ga0070698_100045923 | 3300005471 | Bacteria | 4468 |
| 64 | Ga0070698_100075889 | 3300005471 | Bacteria | 3365 |
| 65 | Ga0070679_100292177 | 3300005530 | Bacteria | 1581 |
| 66 | Ga0070679_100418352 | 3300005530 | Bacteria | 1286 |
| 67 | Ga0068853_100001105 | 3300005539 | Bacteria | 19110 |
| 68 | Ga0068853_100017070 | 3300005539 | Bacteria | 5987 |
| 69 | Ga0068853_100074050 | 3300005539 | Bacteria | 2971 |
| 70 | Ga0070695_100016499 | 3300005545 | Bacteria | 4471 |
| 71 | Ga0070695_100230768 | 3300005545 | Bacteria | 1338 |
| 72 | Ga0070693_100009591 | 3300005547 | Bacteria | 4818 |
| 73 | Ga0070693_100277007 | 3300005547 | Bacteria | 1122 |
| 74 | Ga0070665_100005977 | 3300005548 | Bacteria | 12455 |
| 75 | Ga0070704_100038932 | 3300005549 | Bacteria | 3260 |
| 76 | Ga0070704_100103918 | 3300005549 | Bacteria | 2147 |
| 77 | Ga0068855_100041136 | 3300005563 | Bacteria | 5480 |
| 78 | Ga0068855_100091543 | 3300005563 | Bacteria | 3508 |
| 79 | Ga0068855_100496949 | 3300005563 | Bacteria | 1326 |
| 80 | Ga0070664_100082142 | 3300005564 | Bacteria | 2778 |
| 81 | Ga0070664_100343440 | 3300005564 | Bacteria | 1356 |
| 82 | Ga0068857_100000387 | 3300005577 | Bacteria | 30877 |
| 83 | Ga0068857_100005672 | 3300005577 | Bacteria | 10671 |
| 84 | Ga0068857_100063766 | 3300005577 | Bacteria | 3276 |
| 85 | Ga0068854_100046209 | 3300005578 | Bacteria | 3099 |
| 86 | Ga0068854_100317261 | 3300005578 | Bacteria | 1265 |
| 87 | Ga0068856_100000316 | 3300005614 | Bacteria | 52971 |
| 88 | Ga0068856_100001074 | 3300005614 | Bacteria | 28942 |
| 89 | Ga0068856_100005315 | 3300005614 | Bacteria | 12714 |
| 90 | Ga0068856_100013011 | 3300005614 | Bacteria | 8058 |
| 91 | Ga0068856_100077355 | 3300005614 | Bacteria | 3297 |
| 92 | Ga0068856_100586866 | 3300005614 | Bacteria | 1136 |
| 93 | Ga0070702_100146009 | 3300005615 | Bacteria | 1513 |
| 94 | Ga0068852_100006071 | 3300005616 | Bacteria | 8704 |
| 95 | Ga0068852_100048008 | 3300005616 | Bacteria | 3646 |
| 96 | Ga0068852_100293259 | 3300005616 | Bacteria | 1572 |
| 97 | Ga0068859_100142164 | 3300005617 | Bacteria | 2473 |
| 98 | Ga0068859_100350704 | 3300005617 | Bacteria | 1571 |
| 99 | Ga0068851_10000772 | 3300005834 | Bacteria | 13788 |
| 100 | Ga0068863_100134289 | 3300005841 | Bacteria | 2364 |
| 101 | Ga0068863_100277470 | 3300005841 | Bacteria | 1623 |
| 102 | Ga0068863_100753054 | 3300005841 | Bacteria | 970 |
| 103 | Ga0068858_100095939 | 3300005842 | Bacteria | 2763 |
| 104 | Ga0068858_100124907 | 3300005842 | Bacteria | 2408 |
| 105 | Ga0068858_100190624 | 3300005842 | Bacteria | 1937 |
| 106 | Ga0068860_100000610 | 3300005843 | Bacteria | 42430 |
| 107 | Ga0068860_100021819 | 3300005843 | Bacteria | 6195 |
| 108 | Ga0068860_100083762 | 3300005843 | Bacteria | 3033 |
| 109 | Ga0081455_10001271 | 3300005937 | Bacteria | 31492 |
| 110 | Ga0081455_10005762 | 3300005937 | Bacteria | 13507 |
| 111 | Ga0081455_10013694 | 3300005937 | Bacteria | 7986 |
| 112 | Ga0081455_10016360 | 3300005937 | Bacteria | 7164 |
| 113 | Ga0081455_10051042 | 3300005937 | Bacteria | 3550 |
| 114 | Ga0081540_1001726 | 3300005983 | Bacteria | 18454 |
| 115 | Ga0081540_1033074 | 3300005983 | Bacteria | 2813 |
| 116 | Ga0081540_1033429 | 3300005983 | Bacteria | 2793 |
| 117 | Ga0081540_1073041 | 3300005983 | Bacteria | 1578 |
| 118 | Ga0081540_1114638 | 3300005983 | Bacteria | 1131 |
| 119 | Ga0081539_10003011 | 3300005985 | Bacteria | 21952 |
| 120 | Ga0081539_10062422 | 3300005985 | Bacteria | 2037 |
| 121 | Ga0070717_10009877 | 3300006028 | Bacteria | 7187 |
| 122 | Ga0070717_10012461 | 3300006028 | Bacteria | 6485 |
| 123 | Ga0070717_10124778 | 3300006028 | Bacteria | 2209 |
| 124 | Ga0070717_10241947 | 3300006028 | Bacteria | 1591 |
| 125 | Ga0070717_10305060 | 3300006028 | Bacteria | 1416 |
| 126 | Ga0075365_10017347 | 3300006038 | Bacteria | 4403 |
| 127 | Ga0075365_10023744 | 3300006038 | Bacteria | 3860 |
| 128 | Ga0075365_10040996 | 3300006038 | Bacteria | 3022 |
| 129 | Ga0075365_10328728 | 3300006038 | Bacteria | 1077 |
| 130 | Ga0075368_10006574 | 3300006042 | Bacteria | 4069 |
| 131 | Ga0075368_10083912 | 3300006042 | Bacteria | 1298 |
| 132 | Ga0075363_100013182 | 3300006048 | Bacteria | 3999 |
| 133 | Ga0075364_10059124 | 3300006051 | Bacteria | 2512 |
| 134 | Ga0070715_10002749 | 3300006163 | Bacteria | 5460 |
| 135 | Ga0070716_100003853 | 3300006173 | Bacteria | 7117 |
| 136 | Ga0070716_100004368 | 3300006173 | Bacteria | 6750 |
| 137 | Ga0070716_100073098 | 3300006173 | Bacteria | 2022 |
| 138 | Ga0070712_100000184 | 3300006175 | Bacteria | 34651 |
| 139 | Ga0070712_100000907 | 3300006175 | Bacteria | 17736 |
| 140 | Ga0070712_100002943 | 3300006175 | Bacteria | 10550 |
| 141 | Ga0070712_100012355 | 3300006175 | Bacteria | 5427 |
| 142 | Ga0070712_100095099 | 3300006175 | Bacteria | 2191 |
| 143 | Ga0070712_100118976 | 3300006175 | Bacteria | 1985 |
| 144 | Ga0070712_100570819 | 3300006175 | Bacteria | 955 |
| 145 | Ga0075362_10075305 | 3300006177 | Bacteria | 1548 |
| 146 | Ga0075367_10009327 | 3300006178 | Bacteria | 5125 |
| 147 | Ga0075367_10009807 | 3300006178 | Bacteria | 5017 |
| 148 | Ga0075369_10016332 | 3300006186 | Bacteria | 2994 |
| 149 | Ga0075369_10029640 | 3300006186 | Bacteria | 2300 |
| 150 | Ga0075366_10110079 | 3300006195 | Bacteria | 1656 |
| 151 | Ga0097621_100069735 | 3300006237 | Bacteria | 2903 |
| 152 | Ga0097621_100119751 | 3300006237 | Bacteria | 2231 |
| 153 | Ga0097621_100747229 | 3300006237 | Unclassified | 903 |
| 154 | Ga0075370_10095860 | 3300006353 | Bacteria | 1714 |
| 155 | Ga0068871_100126048 | 3300006358 | Bacteria | 2167 |
| 156 | Ga0068871_100330879 | 3300006358 | Bacteria | 1343 |
| 157 | Ga0068871_100592838 | 3300006358 | Unclassified | 1007 |
| 158 | Ga0075428_100439556 | 3300006844 | Bacteria | 1397 |
| 159 | Ga0075434_100010423 | 3300006871 | Bacteria | 8711 |
| 160 | Ga0075434_100057365 | 3300006871 | Bacteria | 3870 |
| 161 | Ga0075434_100099724 | 3300006871 | Bacteria | 2910 |
| 162 | Ga0075429_100018507 | 3300006880 | Bacteria | 6033 |
| 163 | Ga0075436_100003955 | 3300006914 | Bacteria | 10157 |
| 164 | Ga0075436_100009184 | 3300006914 | Bacteria | 6765 |
| 165 | Ga0097620_100142154 | 3300006931 | Bacteria | 2473 |
| 166 | Ga0097620_100350717 | 3300006931 | Bacteria | 1571 |
| 167 | Ga0099824_1017410 | 3300006942 | Bacteria | 6229 |
| 168 | Ga0099822_1008751 | 3300006943 | Bacteria | 12906 |
| 169 | Ga0075435_100058968 | 3300007076 | Bacteria | 3110 |
| 170 | Ga0099795_10032800 | 3300007788 | Bacteria | 1799 |
| 171 | Ga0105251_10108854 | 3300009011 | Bacteria | 1263 |
| 172 | Ga0105250_10010001 | 3300009092 | Bacteria | 3972 |
| 173 | Ga0105240_10006052 | 3300009093 | Bacteria | 17871 |
| 174 | Ga0105240_10006068 | 3300009093 | Bacteria | 17849 |
| 175 | Ga0105240_10011879 | 3300009093 | Bacteria | 12083 |
| 176 | Ga0105240_10056512 | 3300009093 | Bacteria | 4910 |
| 177 | Ga0105240_10502895 | 3300009093 | Bacteria | 1347 |
| 178 | Ga0111539_10037235 | 3300009094 | Bacteria | 5877 |
| 179 | Ga0105245_10106558 | 3300009098 | Bacteria | 2601 |
| 180 | Ga0105247_10010455 | 3300009101 | Bacteria | 5611 |
| 181 | Ga0114129_10127401 | 3300009147 | Bacteria | 3499 |
| 182 | Ga0114129_10362270 | 3300009147 | Unclassified | 1918 |
| 183 | Ga0105243_10109163 | 3300009148 | Bacteria | 2311 |
| 184 | Ga0105243_10181622 | 3300009148 | Bacteria | 1830 |
| 185 | Ga0105241_10041123 | 3300009174 | Bacteria | 3491 |
| 186 | Ga0105241_10041205 | 3300009174 | Bacteria | 3488 |
| 187 | Ga0105241_10076996 | 3300009174 | Bacteria | 2603 |
| 188 | Ga0105241_10122032 | 3300009174 | Bacteria | 2099 |
| 189 | Ga0105241_10381304 | 3300009174 | Bacteria | 1232 |
| 190 | Ga0105241_10574240 | 3300009174 | Unclassified | 1015 |
| 191 | Ga0105242_10249577 | 3300009176 | Bacteria | 1598 |
| 192 | Ga0105237_10008191 | 3300009545 | Bacteria | 11353 |
| 193 | Ga0105237_10015706 | 3300009545 | Bacteria | 7871 |
| 194 | Ga0105237_10030752 | 3300009545 | Bacteria | 5450 |
| 195 | Ga0105237_10043714 | 3300009545 | Bacteria | 4512 |
| 196 | Ga0105237_10059611 | 3300009545 | Bacteria | 3818 |
| 197 | Ga0105237_10136072 | 3300009545 | Bacteria | 2451 |
| 198 | Ga0105237_10188318 | 3300009545 | Bacteria | 2064 |
| 199 | Ga0105237_10476917 | 3300009545 | Bacteria | 1254 |
| 200 | Ga0105237_10568216 | 3300009545 | Bacteria | 1141 |
| 201 | Ga0105238_10000405 | 3300009551 | Bacteria | 45922 |
| 202 | Ga0105238_10002249 | 3300009551 | Bacteria | 19487 |
| 203 | Ga0105238_10052177 | 3300009551 | Bacteria | 4112 |
| 204 | Ga0105238_10093961 | 3300009551 | Bacteria | 2987 |
| 205 | Ga0099796_10104764 | 3300010159 | Bacteria | 1069 |
| 206 | Ga0105239_10001057 | 3300010375 | Bacteria | 38270 |
| 207 | Ga0105239_10012149 | 3300010375 | Bacteria | 9601 |
| 208 | Ga0105239_10051500 | 3300010375 | Bacteria | 4513 |
| 209 | Ga0105239_10064819 | 3300010375 | Bacteria | 4011 |
| 210 | Ga0105239_10237530 | 3300010375 | Bacteria | 2046 |
| 211 | Ga0105239_10246394 | 3300010375 | Bacteria | 2006 |
| 212 | Ga0105246_10029060 | 3300011119 | Bacteria | 3636 |
| 213 | Ga0157373_10007216 | 3300013100 | Bacteria | 8287 |
| 214 | Ga0157371_10154239 | 3300013102 | Bacteria | 1639 |
| 215 | Ga0157370_10000438 | 3300013104 | Bacteria | 51999 |
| 216 | Ga0157370_10021698 | 3300013104 | Bacteria | 6397 |
| 217 | Ga0157369_10003278 | 3300013105 | Bacteria | 19270 |
| 218 | Ga0157369_10020839 | 3300013105 | Bacteria | 7328 |
| 219 | Ga0157369_10054144 | 3300013105 | Bacteria | 4333 |
| 220 | Ga0157374_10015682 | 3300013296 | Bacteria | 6653 |
| 221 | Ga0157374_10834837 | 3300013296 | Unclassified | 938 |
| 222 | Ga0157378_10007897 | 3300013297 | Bacteria | 9284 |
| 223 | Ga0157378_10099211 | 3300013297 | Bacteria | 2657 |
| 224 | Ga0157378_10151127 | 3300013297 | Bacteria | 2164 |
| 225 | Ga0157378_10579593 | 3300013297 | Bacteria | 1131 |
| 226 | Ga0163162_10041805 | 3300013306 | Bacteria | 4586 |
| 227 | Ga0163162_10053553 | 3300013306 | Bacteria | 4056 |
| 228 | Ga0163162_10265255 | 3300013306 | Bacteria | 1849 |
| 229 | Ga0163163_10003826 | 3300014325 | Bacteria | 12814 |
| 230 | Ga0163163_10055474 | 3300014325 | Bacteria | 3916 |
| 231 | Ga0163163_10089138 | 3300014325 | Bacteria | 3096 |
| 232 | Ga0157380_10053667 | 3300014326 | Bacteria | 3196 |
| 233 | Ga0157379_10004187 | 3300014968 | Bacteria | 12319 |
| 234 | Ga0157379_10018730 | 3300014968 | Bacteria | 6104 |
| 235 | Ga0157379_10119890 | 3300014968 | Bacteria | 2366 |
| 236 | Ga0157379_10511151 | 3300014968 | Bacteria | 1114 |
| 237 | Ga0157376_10111931 | 3300014969 | Bacteria | 2404 |
| 238 | Ga0182007_10069620 | 3300015262 | Bacteria | 1153 |
| 239 | Ga0163161_10282765 | 3300017792 | Bacteria | 1302 |
| 240 | Ga0213876_10012814 | 3300021384 | Bacteria | 4458 |
| 241 | Ga0213876_10020048 | 3300021384 | Bacteria | 3532 |
| 242 | Ga0213876_10101007 | 3300021384 | Bacteria | 1529 |
| 243 | Ga0228598_1002005 | 3300024227 | Bacteria | 4445 |
| 244 | Ga0209677_100388 | 3300025253 | Bacteria | 26746 |
| 245 | Ga0209148_1005144 | 3300025254 | Bacteria | 3056 |
| 246 | Ga0209233_1001612 | 3300025261 | Bacteria | 8789 |
| 247 | Ga0209455_1002273 | 3300025272 | Bacteria | 7559 |
| 248 | Ga0209455_1006233 | 3300025272 | Bacteria | 3554 |
| 249 | Ga0209564_1000477 | 3300025295 | Bacteria | 66843 |
| 250 | Ga0209564_1012120 | 3300025295 | Bacteria | 3790 |
| 251 | Ga0209758_1002550 | 3300025297 | Bacteria | 18367 |
| 252 | Ga0209758_1005044 | 3300025297 | Bacteria | 10495 |
| 253 | Ga0209758_1016059 | 3300025297 | Bacteria | 3827 |
| 254 | Ga0207426_1004036 | 3300025302 | Bacteria | 7436 |
| 255 | Ga0207656_10062172 | 3300025321 | Bacteria | 1640 |
| 256 | Ga0207692_10000148 | 3300025898 | Bacteria | 21949 |
| 257 | Ga0207692_10000717 | 3300025898 | Bacteria | 11668 |
| 258 | Ga0207692_10005747 | 3300025898 | Bacteria | 4990 |
| 259 | Ga0207692_10023773 | 3300025898 | Bacteria | 2839 |
| 260 | Ga0207710_10004963 | 3300025900 | Bacteria | 5766 |
| 261 | Ga0207699_10000440 | 3300025906 | Bacteria | 21190 |
| 262 | Ga0207699_10000967 | 3300025906 | Bacteria | 13702 |
| 263 | Ga0207699_10029228 | 3300025906 | Bacteria | 3072 |
| 264 | Ga0207645_10159657 | 3300025907 | Bacteria | 1474 |
| 265 | Ga0207705_10033639 | 3300025909 | Bacteria | 3663 |
| 266 | Ga0207654_10000201 | 3300025911 | Bacteria | 36898 |
| 267 | Ga0207654_10112762 | 3300025911 | Bacteria | 1694 |
| 268 | Ga0207707_10016259 | 3300025912 | Bacteria | 6490 |
| 269 | Ga0207707_10056283 | 3300025912 | Bacteria | 3422 |
| 270 | Ga0207695_10000343 | 3300025913 | Bacteria | 107739 |
| 271 | Ga0207695_10197090 | 3300025913 | Bacteria | 1930 |
| 272 | Ga0207695_10397318 | 3300025913 | Bacteria | 1263 |
| 273 | Ga0207671_10087870 | 3300025914 | Bacteria | 2338 |
| 274 | Ga0207671_10131542 | 3300025914 | Bacteria | 1921 |
| 275 | Ga0207671_10286709 | 3300025914 | Bacteria | 1300 |
| 276 | Ga0207693_10000127 | 3300025915 | Bacteria | 68379 |
| 277 | Ga0207693_10000733 | 3300025915 | Bacteria | 29584 |
| 278 | Ga0207693_10001801 | 3300025915 | Bacteria | 18789 |
| 279 | Ga0207693_10003226 | 3300025915 | Bacteria | 14002 |
| 280 | Ga0207693_10015330 | 3300025915 | Bacteria | 6152 |
| 281 | Ga0207693_10022417 | 3300025915 | Bacteria | 5018 |
| 282 | Ga0207693_10023532 | 3300025915 | Bacteria | 4890 |
| 283 | Ga0207663_10000161 | 3300025916 | Bacteria | 30665 |
| 284 | Ga0207663_10032451 | 3300025916 | Bacteria | 3100 |
| 285 | Ga0207663_10111931 | 3300025916 | Bacteria | 1853 |
| 286 | Ga0207663_10142208 | 3300025916 | Bacteria | 1673 |
| 287 | Ga0207663_10423226 | 3300025916 | Unclassified | 1023 |
| 288 | Ga0207660_10017097 | 3300025917 | Bacteria | 4813 |
| 289 | Ga0207662_10124437 | 3300025918 | Bacteria | 1620 |
| 290 | Ga0207649_10266439 | 3300025920 | Bacteria | 1240 |
| 291 | Ga0207652_10608084 | 3300025921 | Bacteria | 980 |
| 292 | Ga0207646_10222845 | 3300025922 | Bacteria | 1704 |
| 293 | Ga0207694_10000339 | 3300025924 | Bacteria | 44198 |
| 294 | Ga0207694_10118627 | 3300025924 | Bacteria | 2111 |
| 295 | Ga0207694_10143082 | 3300025924 | Bacteria | 1924 |
| 296 | Ga0207694_10486499 | 3300025924 | Bacteria | 1033 |
| 297 | Ga0207650_10012783 | 3300025925 | Bacteria | 5800 |
| 298 | Ga0207687_10089106 | 3300025927 | Bacteria | 2246 |
| 299 | Ga0207687_10131136 | 3300025927 | Bacteria | 1889 |
| 300 | Ga0207700_10000020 | 3300025928 | Bacteria | 176182 |
| 301 | Ga0207700_10004801 | 3300025928 | Bacteria | 8020 |
| 302 | Ga0207700_10040023 | 3300025928 | Bacteria | 3418 |
| 303 | Ga0207700_10236735 | 3300025928 | Bacteria | 1555 |
| 304 | Ga0207700_10411029 | 3300025928 | Bacteria | 1187 |
| 305 | Ga0207700_10645700 | 3300025928 | Bacteria | 943 |
| 306 | Ga0207664_10018907 | 3300025929 | Bacteria | 5081 |
| 307 | Ga0207664_10033629 | 3300025929 | Bacteria | 3941 |
| 308 | Ga0207644_10002440 | 3300025931 | Bacteria | 11989 |
| 309 | Ga0207706_10040916 | 3300025933 | Bacteria | 4109 |
| 310 | Ga0207706_10298909 | 3300025933 | Bacteria | 1403 |
| 311 | Ga0207686_10316868 | 3300025934 | Bacteria | 1164 |
| 312 | Ga0207665_10000183 | 3300025939 | Bacteria | 41938 |
| 313 | Ga0207665_10006487 | 3300025939 | Bacteria | 7757 |
| 314 | Ga0207711_10532489 | 3300025941 | Bacteria | 1096 |
| 315 | Ga0207689_10054175 | 3300025942 | Bacteria | 3304 |
| 316 | Ga0207689_10101884 | 3300025942 | Bacteria | 2358 |
| 317 | Ga0207667_10008033 | 3300025949 | Bacteria | 12586 |
| 318 | Ga0207667_10008487 | 3300025949 | Bacteria | 12203 |
| 319 | Ga0207667_10030570 | 3300025949 | Bacteria | 5825 |
| 320 | Ga0207667_10308457 | 3300025949 | Bacteria | 1617 |
| 321 | Ga0207651_10235052 | 3300025960 | Bacteria | 1490 |
| 322 | Ga0207668_10064056 | 3300025972 | Bacteria | 2596 |
| 323 | Ga0207668_10117537 | 3300025972 | Bacteria | 2007 |
| 324 | Ga0207640_10175770 | 3300025981 | Bacteria | 1600 |
| 325 | Ga0207640_10288534 | 3300025981 | Bacteria | 1293 |
| 326 | Ga0207658_10024740 | 3300025986 | Bacteria | 4202 |
| 327 | Ga0207658_10186472 | 3300025986 | Bacteria | 1721 |
| 328 | Ga0207703_10126684 | 3300026035 | Bacteria | 2199 |
| 329 | Ga0207703_10189182 | 3300026035 | Bacteria | 1822 |
| 330 | Ga0207639_10021031 | 3300026041 | Bacteria | 4680 |
| 331 | Ga0207639_10447927 | 3300026041 | Bacteria | 1171 |
| 332 | Ga0207678_10023778 | 3300026067 | Bacteria | 5357 |
| 333 | Ga0207678_10043964 | 3300026067 | Bacteria | 3865 |
| 334 | Ga0207678_10053722 | 3300026067 | Bacteria | 3471 |
| 335 | Ga0207702_10000006 | 3300026078 | Bacteria | 346370 |
| 336 | Ga0207702_10000030 | 3300026078 | Bacteria | 178718 |
| 337 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 338 | Ga0207702_10009151 | 3300026078 | Bacteria | 8333 |
| 339 | Ga0207702_10404333 | 3300026078 | Bacteria | 1317 |
| 340 | Ga0207641_10139163 | 3300026088 | Bacteria | 2188 |
| 341 | Ga0207641_10419428 | 3300026088 | Bacteria | 1288 |
| 342 | Ga0207648_10254601 | 3300026089 | Bacteria | 1566 |
| 343 | Ga0207674_10000051 | 3300026116 | Bacteria | 116114 |
| 344 | Ga0207674_10003146 | 3300026116 | Bacteria | 20343 |
| 345 | Ga0207675_100051965 | 3300026118 | Bacteria | 3825 |
| 346 | Ga0207675_100360384 | 3300026118 | Bacteria | 1426 |
| 347 | Ga0207683_10074562 | 3300026121 | Bacteria | 3002 |
| 348 | Ga0207698_10002358 | 3300026142 | Bacteria | 11199 |
| 349 | Ga0207698_10087616 | 3300026142 | Bacteria | 2536 |
| 350 | Ga0207698_10525338 | 3300026142 | Bacteria | 1156 |
| 351 | Ga0209389_1000034 | 3300027296 | Bacteria | 127289 |
| 352 | Ga0209589_1000038 | 3300027357 | Bacteria | 127285 |
| 353 | Ga0209589_1000055 | 3300027357 | Bacteria | 111890 |
| 354 | Ga0209489_100023 | 3300027361 | Bacteria | 198829 |
| 355 | Ga0209489_100128 | 3300027361 | Bacteria | 111890 |
| 356 | Ga0209700_100137 | 3300027363 | Bacteria | 111890 |
| 357 | Ga0207428_10145827 | 3300027907 | Bacteria | 1804 |
| 358 | Ga0268266_10004140 | 3300028379 | Bacteria | 14003 |
| 359 | Ga0268266_10005567 | 3300028379 | Bacteria | 11711 |
| 360 | Ga0268265_10479870 | 3300028380 | Bacteria | 1167 |
| 361 | Ga0268264_10000194 | 3300028381 | Bacteria | 125395 |
| 362 | Ga0268264_10044321 | 3300028381 | Bacteria | 3690 |
| 363 | Ga0268264_10181007 | 3300028381 | Bacteria | 1914 |
| 364 | Ga0268264_10253501 | 3300028381 | Bacteria | 1636 |
| 365 | Ga0265337_1007152 | 3300028556 | Bacteria | 4209 |
| 366 | Ga0265326_10003812 | 3300028558 | Bacteria | 4909 |
| 367 | Ga0265334_10001143 | 3300028573 | Bacteria | 12967 |
| 368 | Ga0265334_10021025 | 3300028573 | Bacteria | 2667 |
| 369 | Ga0265318_10017156 | 3300028577 | Bacteria | 2976 |
| 370 | Ga0265323_10000720 | 3300028653 | Bacteria | 17903 |
| 371 | Ga0265336_10000640 | 3300028666 | Bacteria | 19119 |
| 372 | Ga0265338_10001434 | 3300028800 | Bacteria | 38730 |
| 373 | Ga0265338_10021310 | 3300028800 | Bacteria | 6764 |
| 374 | Ga0265338_10056597 | 3300028800 | Bacteria | 3476 |
| 375 | Ga0265338_10076221 | 3300028800 | Unclassified | 2841 |
| 376 | Ga0265338_10291695 | 3300028800 | Bacteria | 1188 |
| 377 | Ga0265324_10001605 | 3300029957 | Bacteria | 12590 |
| 378 | Ga0307511_10101061 | 3300030521 | Bacteria | 1893 |
| 379 | Ga0265763_1000067 | 3300030763 | Bacteria | 4398 |
| 380 | Ga0265770_1011232 | 3300030878 | Bacteria | 1312 |
| 381 | Ga0265773_1001569 | 3300031018 | Bacteria | 1256 |
| 382 | Ga0265760_10028160 | 3300031090 | Bacteria | 1648 |
| 383 | Ga0265330_10080093 | 3300031235 | Bacteria | 1407 |
| 384 | Ga0265320_10000123 | 3300031240 | Bacteria | 67449 |
| 385 | Ga0265325_10000027 | 3300031241 | Bacteria | 106598 |
| 386 | Ga0265340_10071430 | 3300031247 | Bacteria | 1645 |
| 387 | Ga0265340_10084100 | 3300031247 | Bacteria | 1494 |
| 388 | Ga0265340_10108254 | 3300031247 | Bacteria | 1287 |
| 389 | Ga0265340_10179227 | 3300031247 | Bacteria | 958 |
| 390 | Ga0265339_10000069 | 3300031249 | Bacteria | 90219 |
| 391 | Ga0265339_10009612 | 3300031249 | Bacteria | 6057 |
| 392 | Ga0265339_10012935 | 3300031249 | Bacteria | 5072 |
| 393 | Ga0265331_10004007 | 3300031250 | Bacteria | 9301 |
| 394 | Ga0265316_10166512 | 3300031344 | Unclassified | 1646 |
| 395 | Ga0307509_10086792 | 3300031507 | Bacteria | 3217 |
| 396 | Ga0265313_10000335 | 3300031595 | Bacteria | 51231 |
| 397 | Ga0265313_10000386 | 3300031595 | Bacteria | 47422 |
| 398 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 399 | Ga0307508_10009028 | 3300031616 | Bacteria | 9185 |
| 400 | Ga0265314_10005246 | 3300031711 | Bacteria | 11739 |
| 401 | Ga0265314_10007404 | 3300031711 | Bacteria | 9517 |
| 402 | Ga0265314_10035570 | 3300031711 | Bacteria | 3629 |
| 403 | Ga0265342_10015294 | 3300031712 | Bacteria | 5054 |
| 404 | Ga0265342_10044744 | 3300031712 | Bacteria | 2667 |
| 405 | Ga0265342_10061317 | 3300031712 | Bacteria | 2216 |
| 406 | Ga0307407_10102978 | 3300031903 | Bacteria | 1776 |
| 407 | Ga0307412_10420942 | 3300031911 | Bacteria | 1093 |
| 408 | Ga0307416_100225076 | 3300032002 | Bacteria | 1803 |
| 409 | Ga0307411_10130182 | 3300032005 | Bacteria | 1838 |
| 410 | Ga0307415_100038841 | 3300032126 | Bacteria | 3141 |
| 411 | Ga0307507_10075565 | 3300033179 | Bacteria | 3012 |
| 412 | Ga0307510_10084921 | 3300033180 | Bacteria | 3046 |
| 413 | Ga0373934_0002654 | 3300035086 | Bacteria | 6568 |
| 414 | Ga0373934_0080222 | 3300035086 | Bacteria | 1311 |
| 415 | Ga0373953_0004142 | 3300035117 | Bacteria | 4598 |
| 416 | Ga0373954_0004128 | 3300035118 | Bacteria | 6223 |
| 417 | Ga0373954_0013878 | 3300035118 | Bacteria | 3590 |
| 418 | Ga0373956_0002781 | 3300035119 | Bacteria | 7078 |
| 419 | Ga0373956_0151321 | 3300035119 | Unclassified | 1092 |
| 420 | Ga0373957_0106097 | 3300035120 | Unclassified | 1128 |
| 421 | Ga0373955_0002080 | 3300035172 | Bacteria | 8630 |
| 422 | Ga0373955_0015922 | 3300035172 | Bacteria | 3691 |
| 423 | Ga0373955_0114990 | 3300035172 | Bacteria | 1559 |
| 424 | Ga0373924_0018232 | 3300035410 | Bacteria | 2702 |
| 425 | Ga0373924_0068024 | 3300035410 | Bacteria | 1499 |
| 426 | Ga0373931_0100776 | 3300035691 | Bacteria | 1624 |
| 427 | Ga0373935_0113966 | 3300035692 | Bacteria | 1798 |
| 428 | Ga0373927_0006235 | 3300035695 | Bacteria | 8140 |
| 429 | Ga0373927_0040216 | 3300035695 | Bacteria | 3034 |
| 430 | Ga0373927_0134953 | 3300035695 | Bacteria | 1613 |
| 431 | Ga0373933_0000105 | 3300035724 | Bacteria | 53488 |
| 432 | Ga0373933_0007754 | 3300035724 | Bacteria | 5863 |
| 433 | Ga0373933_0008964 | 3300035724 | Bacteria | 5457 |
| 434 | Ga0373933_0014901 | 3300035724 | Bacteria | 4328 |
| 435 | Ga0373947_0200879 | 3300035725 | Bacteria | 1304 |
| 436 | Ga0373937_0001334 | 3300036401 | Bacteria | 20640 |
| 437 | Ga0373937_0017696 | 3300036401 | Bacteria | 6357 |
| 438 | Ga0373937_0018383 | 3300036401 | Bacteria | 6242 |
| 439 | Ga0373937_0019279 | 3300036401 | Bacteria | 6105 |
| 440 | Ga0373937_0185936 | 3300036401 | Bacteria | 1951 |
| 441 | Ga0316582_0048559 | 3300036647 | Bacteria | 2684 |
| 442 | Ga0373925_0010972 | 3300037068 | Bacteria | 6577 |
| 443 | Ga0373925_0080099 | 3300037068 | Bacteria | 2482 |
| 444 | Ga0373925_0408333 | 3300037068 | Bacteria | 1108 |
| 445 | Ga0395898_0072855 | 3300037466 | Bacteria | 3318 |
| 446 | Ga0436364_1053992 | 3300037853 | Bacteria | 955 |
| 447 | Ga0436365_0139851 | 3300039437 | Bacteria | 5712 |
| 448 | Ga0436365_0371645 | 3300039437 | Bacteria | 4674 |
| 449 | Ga0436365_1570748 | 3300039437 | Bacteria | 3379 |
| 450 | Ga0436360_0366032 | 3300039438 | Bacteria | 1964 |
| 451 | Ga0436361_1152014 | 3300039447 | Bacteria | 4131 |
| 452 | Ga0436363_1472785 | 3300039450 | Bacteria | 2020 |
| 453 | Ga0436362_0101659 | 3300039453 | Bacteria | 1720 |
| 454 | Ga0436362_0421234 | 3300039453 | Bacteria | 8413 |
| 455 | Ga0451804_1168769 | 3300041463 | Bacteria | 1266 |
| 456 | Ga0466965_0020681 | 3300044683 | Bacteria | 3166 |
| 457 | Ga0466966_0314994 | 3300044684 | Bacteria | 940 |
| 458 | Ga0466963_0405721 | 3300044694 | Bacteria | 961 |
| 459 | Ga0466957_0057879 | 3300044842 | Bacteria | 2373 |
| 460 | Ga0466957_0159583 | 3300044842 | Bacteria | 1464 |
| 461 | Ga0466960_0031793 | 3300044901 | Bacteria | 2438 |
| 462 | Ga0466959_0049008 | 3300045049 | Bacteria | 3103 |
| 463 | Ga0466959_0088909 | 3300045049 | Bacteria | 2220 |
| 464 | Ga0466958_0025519 | 3300045836 | Bacteria | 3485 |
| 465 | Ga0466967_0337384 | 3300045976 | Bacteria | 1457 |
| 466 | Ga0495592_0085127 | 3300046454 | Bacteria | 2280 |
| 467 | Ga0495592_0141675 | 3300046454 | Bacteria | 1671 |
| 468 | Ga0495603_0040327 | 3300046455 | Bacteria | 2795 |
| 469 | Ga0495603_0255091 | 3300046455 | Unclassified | 1010 |
| 470 | Ga0495629_0000331 | 3300046459 | Bacteria | 40528 |
| 471 | Ga0495629_0046328 | 3300046459 | Bacteria | 3050 |
| 472 | Ga0495651_0000611 | 3300046462 | Bacteria | 27721 |
| 473 | Ga0495653_0005332 | 3300046463 | Bacteria | 10464 |
| 474 | Ga0495650_0074939 | 3300046471 | Bacteria | 1318 |
| 475 | Ga0495582_0032041 | 3300046473 | Bacteria | 2892 |
| 476 | Ga0495605_0034972 | 3300046474 | Bacteria | 2541 |
| 477 | Ga0495639_0037730 | 3300046475 | Bacteria | 2167 |
| 478 | Ga0495639_0045535 | 3300046475 | Bacteria | 1985 |
| 479 | Ga0495606_0151446 | 3300046507 | Bacteria | 1361 |
| 480 | Ga0495606_0198747 | 3300046507 | Bacteria | 1144 |
| 481 | Ga0495606_0286225 | 3300046507 | Bacteria | 899 |
| 482 | Ga0495608_0000988 | 3300046511 | Bacteria | 20058 |
| 483 | Ga0495608_0007468 | 3300046511 | Bacteria | 7717 |
| 484 | Ga0495608_0158045 | 3300046511 | Bacteria | 1442 |
| 485 | Ga0495618_0001167 | 3300046514 | Bacteria | 17799 |
| 486 | Ga0495628_0059720 | 3300046516 | Bacteria | 2993 |
| 487 | Ga0495628_0134746 | 3300046516 | Bacteria | 1888 |
| 488 | Ga0495628_0372223 | 3300046516 | Bacteria | 1047 |
| 489 | Ga0495630_0071378 | 3300046517 | Bacteria | 2613 |
| 490 | Ga0495631_0107584 | 3300046518 | Bacteria | 1199 |
| 491 | Ga0495648_0009857 | 3300046524 | Bacteria | 7342 |
| 492 | Ga0495648_0172523 | 3300046524 | Bacteria | 1107 |
| 493 | Ga0495652_0004200 | 3300046529 | Bacteria | 13860 |
| 494 | Ga0495652_0031734 | 3300046529 | Bacteria | 4623 |
| 495 | Ga0495652_0195963 | 3300046529 | Bacteria | 1537 |
| 496 | Ga0495640_0008206 | 3300046533 | Bacteria | 8198 |
| 497 | Ga0495640_0008281 | 3300046533 | Bacteria | 8156 |
| 498 | Ga0495640_0123091 | 3300046533 | Bacteria | 1684 |
| 499 | Ga0495587_0000782 | 3300046536 | Bacteria | 21245 |
| 500 | Ga0495587_0219407 | 3300046536 | Bacteria | 1072 |
| 501 | Ga0495609_0070370 | 3300046538 | Bacteria | 1538 |
| 502 | Ga0495645_0029128 | 3300046543 | Bacteria | 4014 |
| 503 | Ga0495622_0005907 | 3300046557 | Bacteria | 5686 |
| 504 | Ga0495622_0060262 | 3300046557 | Bacteria | 1757 |
| 505 | Ga0495667_0012543 | 3300046559 | Bacteria | 5746 |
| 506 | Ga0495667_0082272 | 3300046559 | Bacteria | 2092 |
| 507 | Ga0495656_0012170 | 3300046615 | Bacteria | 3170 |
| 508 | Ga0495668_0006816 | 3300046616 | Bacteria | 7415 |
| 509 | Ga0495668_0035267 | 3300046616 | Bacteria | 2804 |
| 510 | Ga0495634_0027762 | 3300046642 | Bacteria | 3936 |
| 511 | Ga0495634_0071972 | 3300046642 | Bacteria | 2275 |
| 512 | Ga0495611_0047658 | 3300046648 | Bacteria | 1924 |
| 513 | Ga0495635_0024756 | 3300046663 | Bacteria | 4183 |
| 514 | Ga0495635_0339139 | 3300046663 | Bacteria | 1004 |
| 515 | Ga0495661_0120753 | 3300046665 | Bacteria | 1448 |
| 516 | Ga0495657_0006539 | 3300046675 | Bacteria | 9114 |
| 517 | Ga0495657_0015390 | 3300046675 | Bacteria | 5600 |
| 518 | Ga0495599_0003332 | 3300046678 | Bacteria | 9379 |
| 519 | Ga0495623_0004022 | 3300046679 | Bacteria | 9677 |
| 520 | Ga0495646_0002775 | 3300046680 | Bacteria | 10841 |
| 521 | Ga0495646_0004946 | 3300046680 | Bacteria | 8415 |
| 522 | Ga0495613_0007833 | 3300046689 | Bacteria | 7945 |
| 523 | Ga0495671_0047958 | 3300046692 | Bacteria | 2132 |
| 524 | Ga0495589_0107047 | 3300046794 | Bacteria | 1351 |
| 525 | Ga0495600_0036905 | 3300046809 | Bacteria | 3176 |
| 526 | Ga0495600_0054587 | 3300046809 | Bacteria | 2610 |
| 527 | Ga0495581_0040360 | 3300047315 | Bacteria | 2701 |
| 528 | Ga0495581_0111765 | 3300047315 | Bacteria | 1589 |
| 529 | Ga0495604_0000791 | 3300047317 | Bacteria | 26609 |
| 530 | Ga0495604_0006191 | 3300047317 | Bacteria | 9497 |
| 531 | Ga0495604_0057415 | 3300047317 | Bacteria | 2992 |
| 532 | Ga0495674_0000747 | 3300047319 | Bacteria | 30766 |
| 533 | Ga0495674_0016373 | 3300047319 | Bacteria | 6914 |
| 534 | Ga0495672_0009045 | 3300047320 | Bacteria | 7262 |
| 535 | Ga0495672_0009692 | 3300047320 | Bacteria | 6946 |
| 536 | Ga0495672_0048283 | 3300047320 | Bacteria | 2525 |
| 537 | Ga0495672_0118382 | 3300047320 | Bacteria | 1412 |
| 538 | Ga0495680_0106263 | 3300047322 | Bacteria | 2086 |
| 539 | Ga0495680_0132694 | 3300047322 | Bacteria | 1828 |
| 540 | Ga0495675_0017181 | 3300047444 | Bacteria | 4582 |
| 541 | Ga0495675_0019152 | 3300047444 | Bacteria | 4348 |
| 542 | Ga0495675_0111646 | 3300047444 | Bacteria | 1706 |
| 543 | Ga0495684_0000842 | 3300047471 | Bacteria | 24799 |
| 544 | Ga0495686_0021671 | 3300047472 | Bacteria | 4261 |
| 545 | Ga0495686_0057319 | 3300047472 | Bacteria | 2432 |
| 546 | Ga0495602_0006011 | 3300048088 | Bacteria | 12744 |
| 547 | Ga0495615_0023597 | 3300048090 | Bacteria | 1411 |
| 548 | Ga0495615_0038136 | 3300048090 | Bacteria | 1187 |
| 549 | Ga0495626_0116380 | 3300048091 | Bacteria | 1153 |
| 550 | Ga0496100_0023354 | 3300048903 | Bacteria | 3756 |
| 551 | Ga0496100_0218220 | 3300048903 | Bacteria | 1398 |
| 552 | Ga0496101_0022046 | 3300048904 | Bacteria | 4381 |
| 553 | Ga0496101_0048513 | 3300048904 | Bacteria | 3052 |
| 554 | Ga0496101_0430546 | 3300048904 | Bacteria | 1040 |
| 555 | Ga0496102_0128225 | 3300048905 | Bacteria | 2373 |
| 556 | Ga0496104_0111787 | 3300048907 | Bacteria | 2619 |
| 557 | Ga0496104_0141451 | 3300048907 | Bacteria | 2312 |
| 558 | Ga0496104_0366861 | 3300048907 | Bacteria | 1352 |
| 559 | Ga0496105_0043187 | 3300048908 | Bacteria | 3717 |
| 560 | Ga0496105_0176454 | 3300048908 | Bacteria | 1750 |
| 561 | Ga0496106_0034635 | 3300048909 | Bacteria | 3772 |
| 562 | Ga0496106_0042512 | 3300048909 | Bacteria | 3408 |
| 563 | Ga0496107_0044647 | 3300048910 | Bacteria | 3186 |
| 564 | Ga0496108_0103965 | 3300048911 | Bacteria | 2424 |
| 565 | Ga0496109_0084633 | 3300048912 | Bacteria | 2926 |
| 566 | Ga0496109_0108281 | 3300048912 | Bacteria | 2583 |
| 567 | Ga0496109_0481946 | 3300048912 | Bacteria | 1171 |
| 568 | Ga0496110_0153421 | 3300048913 | Bacteria | 2086 |
| 569 | Ga0496110_0250211 | 3300048913 | Bacteria | 1613 |
| 570 | Ga0496112_0010997 | 3300048915 | Bacteria | 8245 |
| 571 | Ga0496113_0024839 | 3300048916 | Bacteria | 4265 |
| 572 | Ga0496114_0024541 | 3300048917 | Bacteria | 4923 |
| 573 | Ga0496115_0047577 | 3300048918 | Bacteria | 3430 |
| 574 | Ga0496116_0025104 | 3300048919 | Bacteria | 4390 |
| 575 | Ga0496116_0166567 | 3300048919 | Bacteria | 1201 |
| 576 | Ga0496117_0036779 | 3300048920 | Bacteria | 3658 |
| 577 | Ga0496117_0069713 | 3300048920 | Bacteria | 2366 |
| 578 | Ga0496117_0121830 | 3300048920 | Bacteria | 1600 |
| 579 | Ga0496118_0008250 | 3300048921 | Bacteria | 10802 |
| 580 | Ga0496121_0002294 | 3300048924 | Bacteria | 29707 |
| 581 | Ga0496121_0002330 | 3300048924 | Bacteria | 29336 |
| 582 | Ga0496121_0017911 | 3300048924 | Bacteria | 7186 |
| 583 | Ga0496121_0042163 | 3300048924 | Bacteria | 3975 |
| 584 | Ga0496121_0052943 | 3300048924 | Bacteria | 3403 |
| 585 | Ga0496121_0100375 | 3300048924 | Bacteria | 2234 |
| 586 | Ga0496121_0131364 | 3300048924 | Bacteria | 1873 |
| 587 | Ga0496124_0013092 | 3300048927 | Bacteria | 8124 |
| 588 | Ga0496124_0031907 | 3300048927 | Bacteria | 4659 |
| 589 | Ga0496124_0111797 | 3300048927 | Bacteria | 2197 |
| 590 | Ga0496125_0001204 | 3300048928 | Bacteria | 38897 |
| 591 | Ga0496125_0002521 | 3300048928 | Bacteria | 23642 |
| 592 | Ga0496125_0027673 | 3300048928 | Bacteria | 5134 |
| 593 | Ga0496125_0028221 | 3300048928 | Bacteria | 5074 |
| 594 | Ga0496125_0054342 | 3300048928 | Bacteria | 3273 |
| 595 | Ga0496125_0101045 | 3300048928 | Bacteria | 2124 |
| 596 | Ga0496126_0010565 | 3300048929 | Bacteria | 9656 |
| 597 | Ga0496126_0014202 | 3300048929 | Bacteria | 8059 |
| 598 | Ga0496126_0030609 | 3300048929 | Bacteria | 5095 |
| 599 | Ga0496126_0148059 | 3300048929 | Bacteria | 2014 |
| 600 | Ga0496126_0385304 | 3300048929 | Bacteria | 1140 |
| 601 | Ga0501034_0000734 | 3300049571 | Bacteria | 49577 |
| 602 | Ga0501034_0132315 | 3300049571 | Bacteria | 2477 |
| 603 | Ga0501038_0022920 | 3300049574 | Bacteria | 5590 |
| 604 | Ga0501047_0156691 | 3300049581 | Bacteria | 2151 |
| 605 | Ga0501047_0350503 | 3300049581 | Bacteria | 1313 |
| 606 | Ga0501070_0073675 | 3300049586 | Bacteria | 2825 |
| 607 | Ga0501044_0169363 | 3300049823 | Bacteria | 2156 |
| 608 | nmdc:mga03683_115673_c1 | 3300050489 | Bacteria | 1189 |
| 609 | nmdc:mga03n38_32897_c1 | 3300050490 | Bacteria | 2201 |
| 610 | nmdc:mga03n38_51277_c1 | 3300050490 | Bacteria | 1842 |
| 611 | nmdc:mga00v17_182555_c1 | 3300050491 | Bacteria | 1354 |
| 612 | nmdc:mga0yw44_8666_c2 | 3300050492 | Bacteria | 4733 |
| 613 | nmdc:mga06z11_70142_c1 | 3300050494 | Bacteria | 1852 |
| 614 | nmdc:mga05p37_49845_c1 | 3300050507 | Bacteria | 5150 |
| 615 | nmdc:mga09592_24772_c1 | 3300050508 | Bacteria | 4962 |
| 616 | nmdc:mga0qj67_55_c1 | 3300050509 | Bacteria | 83015 |
| 617 | nmdc:mga08y16_54579_c1 | 3300050511 | Bacteria | 4175 |
| 618 | nmdc:mga0n895_10223_c1 | 3300050512 | Bacteria | 8267 |
| 619 | nmdc:mga0n895_119502_c1 | 3300050512 | Bacteria | 2656 |
| 620 | nmdc:mga0n895_275379_c1 | 3300050512 | Bacteria | 1707 |
| 621 | nmdc:mga0n895_276242_c1 | 3300050512 | Bacteria | 1704 |
| 622 | nmdc:mga0rr50_209671_c1 | 3300050513 | Bacteria | 1605 |
| 623 | nmdc:mga0rr50_78989_c1 | 3300050513 | Bacteria | 2533 |
| 624 | nmdc:mga08x19_28772_c1 | 3300050514 | Bacteria | 3483 |
| 625 | nmdc:mga08x19_460_c1 | 3300050514 | Bacteria | 27547 |
| 626 | nmdc:mga0a205_12662_c1 | 3300050515 | Bacteria | 7812 |
| 627 | nmdc:mga0sz30_2760_c1 | 3300050516 | Bacteria | 6262 |
| 628 | Ga0495601_0007866 | 3300053077 | Bacteria | 6277 |
| 629 | Ga0495601_0008933 | 3300053077 | Bacteria | 5916 |
| 630 | Ga0495601_0227772 | 3300053077 | Bacteria | 1217 |
| 631 | Ga0495612_0038918 | 3300053078 | Bacteria | 1933 |
| 632 | Ga0500635_0119267 | 3300053080 | Bacteria | 986 |
| 633 | Ga0495595_0000412 | 3300053084 | Bacteria | 16251 |
| 634 | Ga0495595_0028878 | 3300053084 | Bacteria | 2479 |
| 635 | Ga0495595_0192557 | 3300053084 | Bacteria | 1014 |
| 636 | Ga0495619_0000406 | 3300053085 | Bacteria | 29319 |
| 637 | Ga0495619_0002280 | 3300053085 | Bacteria | 12649 |
| 638 | Ga0495619_0033950 | 3300053085 | Bacteria | 3315 |
| 639 | Ga0500644_0006853 | 3300053088 | Bacteria | 2938 |
| 640 | Ga0500651_0115731 | 3300053093 | Bacteria | 1632 |
| 641 | Ga0500566_0004519 | 3300053094 | Bacteria | 8307 |
| 642 | Ga0500648_079091 | 3300053097 | Bacteria | 1852 |
| 643 | Ga0500595_010825 | 3300053119 | Bacteria | 3603 |
| 644 | Ga0500608_000229 | 3300053122 | Bacteria | 22140 |
| 645 | Ga0500642_0000142 | 3300053130 | Bacteria | 32016 |
| 646 | Ga0500559_0000105 | 3300053136 | Bacteria | 65809 |
| 647 | Ga0500568_0004562 | 3300053139 | Bacteria | 7382 |
| 648 | Ga0500573_0031154 | 3300053140 | Bacteria | 3077 |
| 649 | Ga0500577_0019409 | 3300053142 | Bacteria | 2204 |
| 650 | Ga0500586_028805 | 3300053145 | Bacteria | 1816 |
| 651 | Ga0500590_062512 | 3300053148 | Bacteria | 1868 |
| 652 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 653 | Ga0500616_0000784 | 3300053153 | Bacteria | 36530 |
| 654 | Ga0500636_0002483 | 3300053177 | Bacteria | 10235 |
| 655 | Ga0500636_0062671 | 3300053177 | Bacteria | 2168 |
| 656 | Ga0500636_0175633 | 3300053177 | Bacteria | 1154 |
| 657 | Ga0500637_0104449 | 3300053178 | Bacteria | 1643 |
| 658 | Ga0500596_003794 | 3300053735 | Bacteria | 2834 |
| 659 | Ga0466962_0136578 | 3300061719 | Bacteria | 1187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035119 | Ga0373956_0151321 | Ga0373956_0151321_250_1065 | 270 |
| 2 | 3300035172 | Ga0373955_0015922 | Ga0373955_0015922_973_1788 | 270 |
| 3 | 3300035410 | Ga0373924_0068024 | Ga0373924_0068024_43_1020 | 270 |
| 4 | 3300035724 | Ga0373933_0007754 | Ga0373933_0007754_3859_4674 | 270 |
| 5 | 3300036401 | Ga0373937_0018383 | Ga0373937_0018383_4568_5383 | 270 |
| 6 | 3300046518 | Ga0495631_0107584 | Ga0495631_0107584_131_943 | 270 |
| 7 | 3300005336 | Ga0070680_100185238 | Ga0070680_1001852381 | 271 |
| 8 | 3300005341 | Ga0070691_10001579 | Ga0070691_100015796 | 271 |
| 9 | 3300005434 | Ga0070709_10003245 | Ga0070709_100032455 | 271 |
| 10 | 3300005435 | Ga0070714_100060020 | Ga0070714_1000600202 | 271 |
| 11 | 3300005436 | Ga0070713_100000006 | Ga0070713_100000006143 | 271 |
| 12 | 3300005539 | Ga0068853_100001105 | Ga0068853_10000110520 | 271 |
| 13 | 3300005545 | Ga0070695_100016499 | Ga0070695_1000164994 | 271 |
| 14 | 3300005547 | Ga0070693_100009591 | Ga0070693_1000095916 | 271 |
| 15 | 3300005563 | Ga0068855_100041136 | Ga0068855_1000411365 | 271 |
| 16 | 3300005577 | Ga0068857_100000387 | Ga0068857_10000038721 | 271 |
| 17 | 3300005578 | Ga0068854_100317261 | Ga0068854_1003172612 | 271 |
| 18 | 3300005614 | Ga0068856_100000316 | Ga0068856_10000031652 | 271 |
| 19 | 3300005614 | Ga0068856_100013011 | Ga0068856_1000130113 | 271 |
| 20 | 3300005616 | Ga0068852_100006071 | Ga0068852_1000060717 | 271 |
| 21 | 3300005842 | Ga0068858_100095939 | Ga0068858_1000959393 | 271 |
| 22 | 3300006175 | Ga0070712_100000184 | Ga0070712_1000001847 | 271 |
| 23 | 3300006237 | Ga0097621_100747229 | Ga0097621_1007472291 | 271 |
| 24 | 3300006358 | Ga0068871_100592838 | Ga0068871_1005928381 | 271 |
| 25 | 3300006871 | Ga0075434_100057365 | Ga0075434_1000573654 | 271 |
| 26 | 3300006914 | Ga0075436_100003955 | Ga0075436_1000039558 | 271 |
| 27 | 3300006914 | Ga0075436_100009184 | Ga0075436_1000091845 | 271 |
| 28 | 3300009093 | Ga0105240_10006052 | Ga0105240_100060529 | 271 |
| 29 | 3300009174 | Ga0105241_10041205 | Ga0105241_100412052 | 271 |
| 30 | 3300009174 | Ga0105241_10381304 | Ga0105241_103813041 | 271 |
| 31 | 3300009174 | Ga0105241_10574240 | Ga0105241_105742402 | 271 |
| 32 | 3300009545 | Ga0105237_10008191 | Ga0105237_100081918 | 271 |
| 33 | 3300009551 | Ga0105238_10000405 | Ga0105238_1000040541 | 271 |
| 34 | 3300010375 | Ga0105239_10064819 | Ga0105239_100648193 | 271 |
| 35 | 3300013100 | Ga0157373_10007216 | Ga0157373_100072169 | 271 |
| 36 | 3300013104 | Ga0157370_10000438 | Ga0157370_1000043816 | 271 |
| 37 | 3300013105 | Ga0157369_10054144 | Ga0157369_100541443 | 271 |
| 38 | 3300013296 | Ga0157374_10834837 | Ga0157374_108348371 | 271 |
| 39 | 3300013297 | Ga0157378_10099211 | Ga0157378_100992114 | 271 |
| 40 | 3300013306 | Ga0163162_10053553 | Ga0163162_100535533 | 271 |
| 41 | 3300014968 | Ga0157379_10018730 | Ga0157379_100187304 | 271 |
| 42 | 3300025906 | Ga0207699_10000440 | Ga0207699_1000044010 | 271 |
| 43 | 3300025913 | Ga0207695_10197090 | Ga0207695_101970902 | 271 |
| 44 | 3300025914 | Ga0207671_10087870 | Ga0207671_100878703 | 271 |
| 45 | 3300025915 | Ga0207693_10000733 | Ga0207693_1000073325 | 271 |
| 46 | 3300025928 | Ga0207700_10000020 | Ga0207700_1000002029 | 271 |
| 47 | 3300025929 | Ga0207664_10033629 | Ga0207664_100336292 | 271 |
| 48 | 3300025949 | Ga0207667_10008487 | Ga0207667_1000848712 | 271 |
| 49 | 3300025981 | Ga0207640_10175770 | Ga0207640_101757702 | 271 |
| 50 | 3300026078 | Ga0207702_10000030 | Ga0207702_10000030118 | 271 |
| 51 | 3300026078 | Ga0207702_10009151 | Ga0207702_100091513 | 271 |
| 52 | 3300026116 | Ga0207674_10000051 | Ga0207674_1000005155 | 271 |
| 53 | 3300026142 | Ga0207698_10002358 | Ga0207698_100023587 | 271 |
| 54 | 3300035692 | Ga0373935_0113966 | Ga0373935_0113966_502_1320 | 271 |
| 55 | 3300048905 | Ga0496102_0128225 | Ga0496102_0128225_1414_2232 | 271 |
| 56 | 3300050512 | nmdc:mga0n895_275379_c1 | nmdc:mga0n895_275379_c1_858_1676 | 271 |
| 57 | 3300050514 | nmdc:mga08x19_28772_c1 | nmdc:mga08x19_28772_c1_2507_3325 | 271 |
| 58 | 3300050514 | nmdc:mga08x19_460_c1 | nmdc:mga08x19_460_c1_23097_23915 | 271 |
| 59 | 3300005336 | Ga0070680_100626156 | Ga0070680_1006261561 | 272 |
| 60 | 3300005547 | Ga0070693_100277007 | Ga0070693_1002770072 | 272 |
| 61 | 3300005843 | Ga0068860_100021819 | Ga0068860_1000218198 | 272 |
| 62 | 3300006871 | Ga0075434_100099724 | Ga0075434_1000997245 | 272 |
| 63 | 3300009093 | Ga0105240_10056512 | Ga0105240_100565127 | 272 |
| 64 | 3300009147 | Ga0114129_10362270 | Ga0114129_103622702 | 272 |
| 65 | 3300009174 | Ga0105241_10122032 | Ga0105241_101220322 | 272 |
| 66 | 3300009545 | Ga0105237_10136072 | Ga0105237_101360723 | 272 |
| 67 | 3300010375 | Ga0105239_10001057 | Ga0105239_1000105716 | 272 |
| 68 | 3300013105 | Ga0157369_10003278 | Ga0157369_1000327817 | 272 |
| 69 | 3300013105 | Ga0157369_10020839 | Ga0157369_100208398 | 272 |
| 70 | 3300013297 | Ga0157378_10151127 | Ga0157378_101511271 | 272 |
| 71 | 3300014968 | Ga0157379_10004187 | Ga0157379_100041875 | 272 |
| 72 | 3300025911 | Ga0207654_10112762 | Ga0207654_101127621 | 272 |
| 73 | 3300026078 | Ga0207702_10404333 | Ga0207702_104043332 | 272 |
| 74 | 3300026142 | Ga0207698_10087616 | Ga0207698_100876161 | 272 |
| 75 | 3300050512 | nmdc:mga0n895_119502_c1 | nmdc:mga0n895_119502_c1_1743_2564 | 272 |
| 76 | 3300005328 | Ga0070676_10169827 | Ga0070676_101698271 | 273 |
| 77 | 3300005334 | Ga0068869_100026808 | Ga0068869_1000268084 | 273 |
| 78 | 3300005436 | Ga0070713_100051182 | Ga0070713_1000511822 | 273 |
| 79 | 3300005439 | Ga0070711_100072398 | Ga0070711_1000723982 | 273 |
| 80 | 3300005439 | Ga0070711_100571960 | Ga0070711_1005719601 | 273 |
| 81 | 3300005471 | Ga0070698_100045923 | Ga0070698_1000459232 | 273 |
| 82 | 3300005549 | Ga0070704_100038932 | Ga0070704_1000389323 | 273 |
| 83 | 3300005614 | Ga0068856_100077355 | Ga0068856_1000773552 | 273 |
| 84 | 3300006175 | Ga0070712_100000907 | Ga0070712_1000009074 | 273 |
| 85 | 3300009545 | Ga0105237_10188318 | Ga0105237_101883182 | 273 |
| 86 | 3300014326 | Ga0157380_10053667 | Ga0157380_100536674 | 273 |
| 87 | 3300015262 | Ga0182007_10069620 | Ga0182007_100696202 | 273 |
| 88 | 3300025907 | Ga0207645_10159657 | Ga0207645_101596571 | 273 |
| 89 | 3300025915 | Ga0207693_10000127 | Ga0207693_1000012722 | 273 |
| 90 | 3300025916 | Ga0207663_10032451 | Ga0207663_100324512 | 273 |
| 91 | 3300025916 | Ga0207663_10423226 | Ga0207663_104232262 | 273 |
| 92 | 3300025942 | Ga0207689_10101884 | Ga0207689_101018842 | 273 |
| 93 | 3300028381 | Ga0268264_10044321 | Ga0268264_100443215 | 273 |
| 94 | 3300028800 | Ga0265338_10056597 | Ga0265338_100565972 | 273 |
| 95 | 3300028800 | Ga0265338_10076221 | Ga0265338_100762212 | 273 |
| 96 | 3300031240 | Ga0265320_10000123 | Ga0265320_1000012314 | 273 |
| 97 | 3300031241 | Ga0265325_10000027 | Ga0265325_100000275 | 273 |
| 98 | 3300031247 | Ga0265340_10108254 | Ga0265340_101082541 | 273 |
| 99 | 3300031247 | Ga0265340_10179227 | Ga0265340_101792271 | 273 |
| 100 | 3300031249 | Ga0265339_10009612 | Ga0265339_100096123 | 273 |
| 101 | 3300031249 | Ga0265339_10012935 | Ga0265339_100129354 | 273 |
| 102 | 3300031250 | Ga0265331_10004007 | Ga0265331_1000400710 | 273 |
| 103 | 3300031344 | Ga0265316_10166512 | Ga0265316_101665121 | 273 |
| 104 | 3300031595 | Ga0265313_10000335 | Ga0265313_1000033551 | 273 |
| 105 | 3300031711 | Ga0265314_10005246 | Ga0265314_100052467 | 273 |
| 106 | 3300035695 | Ga0373927_0134953 | Ga0373927_0134953_170_994 | 273 |
| 107 | 3300036401 | Ga0373937_0001334 | Ga0373937_0001334_16597_17421 | 273 |
| 108 | 3300039437 | Ga0436365_1570748 | Ga0436365_1570748_12_836 | 273 |
| 109 | 3300039453 | Ga0436362_0101659 | Ga0436362_0101659_520_1344 | 273 |
| 110 | 3300046516 | Ga0495628_0372223 | Ga0495628_0372223_200_1024 | 273 |
| 111 | 3300046533 | Ga0495640_0123091 | Ga0495640_0123091_378_1202 | 273 |
| 112 | 3300049571 | Ga0501034_0000734 | Ga0501034_0000734_22677_23501 | 273 |
| 113 | 3300050509 | nmdc:mga0qj67_55_c1 | nmdc:mga0qj67_55_c1_70913_71848 | 273 |
| 114 | 3300005328 | Ga0070676_10179911 | Ga0070676_101799112 | 274 |
| 115 | 3300005331 | Ga0070670_100014336 | Ga0070670_1000143366 | 274 |
| 116 | 3300005334 | Ga0068869_100152985 | Ga0068869_1001529852 | 274 |
| 117 | 3300005338 | Ga0068868_100570817 | Ga0068868_1005708171 | 274 |
| 118 | 3300005344 | Ga0070661_100158263 | Ga0070661_1001582631 | 274 |
| 119 | 3300005347 | Ga0070668_100285864 | Ga0070668_1002858641 | 274 |
| 120 | 3300005354 | Ga0070675_100512754 | Ga0070675_1005127541 | 274 |
| 121 | 3300005355 | Ga0070671_100087471 | Ga0070671_1000874714 | 274 |
| 122 | 3300005435 | Ga0070714_100156305 | Ga0070714_1001563052 | 274 |
| 123 | 3300005436 | Ga0070713_100068829 | Ga0070713_1000688292 | 274 |
| 124 | 3300005436 | Ga0070713_100083086 | Ga0070713_1000830861 | 274 |
| 125 | 3300005437 | Ga0070710_10081676 | Ga0070710_100816761 | 274 |
| 126 | 3300005457 | Ga0070662_100165933 | Ga0070662_1001659331 | 274 |
| 127 | 3300005471 | Ga0070698_100075889 | Ga0070698_1000758894 | 274 |
| 128 | 3300005530 | Ga0070679_100418352 | Ga0070679_1004183522 | 274 |
| 129 | 3300005577 | Ga0068857_100063766 | Ga0068857_1000637663 | 274 |
| 130 | 3300005841 | Ga0068863_100277470 | Ga0068863_1002774701 | 274 |
| 131 | 3300005841 | Ga0068863_100753054 | Ga0068863_1007530541 | 274 |
| 132 | 3300005842 | Ga0068858_100190624 | Ga0068858_1001906243 | 274 |
| 133 | 3300005937 | Ga0081455_10001271 | Ga0081455_100012719 | 274 |
| 134 | 3300005937 | Ga0081455_10005762 | Ga0081455_100057626 | 274 |
| 135 | 3300005983 | Ga0081540_1033074 | Ga0081540_10330742 | 274 |
| 136 | 3300006028 | Ga0070717_10009877 | Ga0070717_100098778 | 274 |
| 137 | 3300006028 | Ga0070717_10241947 | Ga0070717_102419472 | 274 |
| 138 | 3300006038 | Ga0075365_10328728 | Ga0075365_103287282 | 274 |
| 139 | 3300006175 | Ga0070712_100002943 | Ga0070712_1000029439 | 274 |
| 140 | 3300006175 | Ga0070712_100118976 | Ga0070712_1001189762 | 274 |
| 141 | 3300006177 | Ga0075362_10075305 | Ga0075362_100753051 | 274 |
| 142 | 3300006178 | Ga0075367_10009807 | Ga0075367_100098072 | 274 |
| 143 | 3300006237 | Ga0097621_100119751 | Ga0097621_1001197513 | 274 |
| 144 | 3300006353 | Ga0075370_10095860 | Ga0075370_100958602 | 274 |
| 145 | 3300006871 | Ga0075434_100010423 | Ga0075434_1000104237 | 274 |
| 146 | 3300006880 | Ga0075429_100018507 | Ga0075429_1000185077 | 274 |
| 147 | 3300007788 | Ga0099795_10032800 | Ga0099795_100328002 | 274 |
| 148 | 3300009094 | Ga0111539_10037235 | Ga0111539_100372352 | 274 |
| 149 | 3300009098 | Ga0105245_10106558 | Ga0105245_101065581 | 274 |
| 150 | 3300009147 | Ga0114129_10127401 | Ga0114129_101274012 | 274 |
| 151 | 3300009545 | Ga0105237_10043714 | Ga0105237_100437144 | 274 |
| 152 | 3300009551 | Ga0105238_10093961 | Ga0105238_100939612 | 274 |
| 153 | 3300011119 | Ga0105246_10029060 | Ga0105246_100290603 | 274 |
| 154 | 3300014325 | Ga0163163_10089138 | Ga0163163_100891383 | 274 |
| 155 | 3300014968 | Ga0157379_10119890 | Ga0157379_101198901 | 274 |
| 156 | 3300014969 | Ga0157376_10111931 | Ga0157376_101119311 | 274 |
| 157 | 3300021384 | Ga0213876_10020048 | Ga0213876_100200485 | 274 |
| 158 | 3300024227 | Ga0228598_1002005 | Ga0228598_10020054 | 274 |
| 159 | 3300025898 | Ga0207692_10023773 | Ga0207692_100237733 | 274 |
| 160 | 3300025915 | Ga0207693_10001801 | Ga0207693_100018019 | 274 |
| 161 | 3300025915 | Ga0207693_10022417 | Ga0207693_100224171 | 274 |
| 162 | 3300025916 | Ga0207663_10142208 | Ga0207663_101422081 | 274 |
| 163 | 3300025918 | Ga0207662_10124437 | Ga0207662_101244372 | 274 |
| 164 | 3300025921 | Ga0207652_10608084 | Ga0207652_106080841 | 274 |
| 165 | 3300025924 | Ga0207694_10118627 | Ga0207694_101186273 | 274 |
| 166 | 3300025924 | Ga0207694_10486499 | Ga0207694_104864991 | 274 |
| 167 | 3300025925 | Ga0207650_10012783 | Ga0207650_100127837 | 274 |
| 168 | 3300025927 | Ga0207687_10089106 | Ga0207687_100891061 | 274 |
| 169 | 3300025927 | Ga0207687_10131136 | Ga0207687_101311362 | 274 |
| 170 | 3300025928 | Ga0207700_10040023 | Ga0207700_100400233 | 274 |
| 171 | 3300025928 | Ga0207700_10236735 | Ga0207700_102367351 | 274 |
| 172 | 3300025928 | Ga0207700_10411029 | Ga0207700_104110291 | 274 |
| 173 | 3300025928 | Ga0207700_10645700 | Ga0207700_106457001 | 274 |
| 174 | 3300025931 | Ga0207644_10002440 | Ga0207644_100024404 | 274 |
| 175 | 3300025933 | Ga0207706_10040916 | Ga0207706_100409165 | 274 |
| 176 | 3300025960 | Ga0207651_10235052 | Ga0207651_102350521 | 274 |
| 177 | 3300025986 | Ga0207658_10186472 | Ga0207658_101864722 | 274 |
| 178 | 3300026088 | Ga0207641_10419428 | Ga0207641_104194281 | 274 |
| 179 | 3300026118 | Ga0207675_100051965 | Ga0207675_1000519653 | 274 |
| 180 | 3300027907 | Ga0207428_10145827 | Ga0207428_101458271 | 274 |
| 181 | 3300028800 | Ga0265338_10021310 | Ga0265338_100213106 | 274 |
| 182 | 3300028800 | Ga0265338_10291695 | Ga0265338_102916951 | 274 |
| 183 | 3300030763 | Ga0265763_1000067 | Ga0265763_10000672 | 274 |
| 184 | 3300030878 | Ga0265770_1011232 | Ga0265770_10112321 | 274 |
| 185 | 3300031018 | Ga0265773_1001569 | Ga0265773_10015691 | 274 |
| 186 | 3300031090 | Ga0265760_10028160 | Ga0265760_100281602 | 274 |
| 187 | 3300031235 | Ga0265330_10080093 | Ga0265330_100800931 | 274 |
| 188 | 3300031247 | Ga0265340_10071430 | Ga0265340_100714301 | 274 |
| 189 | 3300031247 | Ga0265340_10084100 | Ga0265340_100841002 | 274 |
| 190 | 3300031249 | Ga0265339_10000069 | Ga0265339_1000006955 | 274 |
| 191 | 3300031595 | Ga0265313_10000386 | Ga0265313_1000038624 | 274 |
| 192 | 3300031712 | Ga0265342_10015294 | Ga0265342_100152947 | 274 |
| 193 | 3300035118 | Ga0373954_0004128 | Ga0373954_0004128_2357_3220 | 274 |
| 194 | 3300035120 | Ga0373957_0106097 | Ga0373957_0106097_48_911 | 274 |
| 195 | 3300035172 | Ga0373955_0002080 | Ga0373955_0002080_6310_7173 | 274 |
| 196 | 3300035172 | Ga0373955_0114990 | Ga0373955_0114990_83_910 | 274 |
| 197 | 3300035691 | Ga0373931_0100776 | Ga0373931_0100776_146_973 | 274 |
| 198 | 3300035695 | Ga0373927_0006235 | Ga0373927_0006235_1777_2640 | 274 |
| 199 | 3300035724 | Ga0373933_0008964 | Ga0373933_0008964_320_1183 | 274 |
| 200 | 3300036401 | Ga0373937_0017696 | Ga0373937_0017696_49_912 | 274 |
| 201 | 3300036401 | Ga0373937_0019279 | Ga0373937_0019279_3147_3974 | 274 |
| 202 | 3300036401 | Ga0373937_0185936 | Ga0373937_0185936_596_1423 | 274 |
| 203 | 3300036647 | Ga0316582_0048559 | Ga0316582_0048559_595_1560 | 274 |
| 204 | 3300037068 | Ga0373925_0080099 | Ga0373925_0080099_124_987 | 274 |
| 205 | 3300037068 | Ga0373925_0408333 | Ga0373925_0408333_16_843 | 274 |
| 206 | 3300037853 | Ga0436364_1053992 | Ga0436364_1053992_38_865 | 274 |
| 207 | 3300039437 | Ga0436365_0139851 | Ga0436365_0139851_4115_4993 | 274 |
| 208 | 3300039437 | Ga0436365_0371645 | Ga0436365_0371645_377_1204 | 274 |
| 209 | 3300039450 | Ga0436363_1472785 | Ga0436363_1472785_497_1324 | 274 |
| 210 | 3300044694 | Ga0466963_0405721 | Ga0466963_0405721_86_913 | 274 |
| 211 | 3300044842 | Ga0466957_0057879 | Ga0466957_0057879_1529_2356 | 274 |
| 212 | 3300045049 | Ga0466959_0088909 | Ga0466959_0088909_1001_1828 | 274 |
| 213 | 3300045836 | Ga0466958_0025519 | Ga0466958_0025519_1244_2071 | 274 |
| 214 | 3300045976 | Ga0466967_0337384 | Ga0466967_0337384_395_1423 | 274 |
| 215 | 3300046454 | Ga0495592_0085127 | Ga0495592_0085127_203_1030 | 274 |
| 216 | 3300046455 | Ga0495603_0255091 | Ga0495603_0255091_114_977 | 274 |
| 217 | 3300046462 | Ga0495651_0000611 | Ga0495651_0000611_3456_4319 | 274 |
| 218 | 3300046463 | Ga0495653_0005332 | Ga0495653_0005332_3970_4833 | 274 |
| 219 | 3300046471 | Ga0495650_0074939 | Ga0495650_0074939_339_1193 | 274 |
| 220 | 3300046511 | Ga0495608_0007468 | Ga0495608_0007468_2319_3182 | 274 |
| 221 | 3300046511 | Ga0495608_0158045 | Ga0495608_0158045_452_1279 | 274 |
| 222 | 3300046514 | Ga0495618_0001167 | Ga0495618_0001167_4534_5397 | 274 |
| 223 | 3300046516 | Ga0495628_0134746 | Ga0495628_0134746_834_1661 | 274 |
| 224 | 3300046517 | Ga0495630_0071378 | Ga0495630_0071378_1103_1966 | 274 |
| 225 | 3300046529 | Ga0495652_0004200 | Ga0495652_0004200_6607_7470 | 274 |
| 226 | 3300046529 | Ga0495652_0195963 | Ga0495652_0195963_511_1338 | 274 |
| 227 | 3300046533 | Ga0495640_0008281 | Ga0495640_0008281_5060_5923 | 274 |
| 228 | 3300046536 | Ga0495587_0000782 | Ga0495587_0000782_13066_13929 | 274 |
| 229 | 3300046543 | Ga0495645_0029128 | Ga0495645_0029128_3120_3983 | 274 |
| 230 | 3300046559 | Ga0495667_0012543 | Ga0495667_0012543_2099_2962 | 274 |
| 231 | 3300046559 | Ga0495667_0082272 | Ga0495667_0082272_335_1162 | 274 |
| 232 | 3300046615 | Ga0495656_0012170 | Ga0495656_0012170_1582_2421 | 274 |
| 233 | 3300046642 | Ga0495634_0071972 | Ga0495634_0071972_852_1736 | 274 |
| 234 | 3300046675 | Ga0495657_0015390 | Ga0495657_0015390_3432_4295 | 274 |
| 235 | 3300046679 | Ga0495623_0004022 | Ga0495623_0004022_357_1220 | 274 |
| 236 | 3300046680 | Ga0495646_0002775 | Ga0495646_0002775_7078_7941 | 274 |
| 237 | 3300046809 | Ga0495600_0054587 | Ga0495600_0054587_679_1542 | 274 |
| 238 | 3300047317 | Ga0495604_0000791 | Ga0495604_0000791_19098_19961 | 274 |
| 239 | 3300047317 | Ga0495604_0057415 | Ga0495604_0057415_134_961 | 274 |
| 240 | 3300047319 | Ga0495674_0000747 | Ga0495674_0000747_24471_25334 | 274 |
| 241 | 3300047320 | Ga0495672_0009692 | Ga0495672_0009692_2366_3193 | 274 |
| 242 | 3300047320 | Ga0495672_0048283 | Ga0495672_0048283_744_1571 | 274 |
| 243 | 3300047322 | Ga0495680_0106263 | Ga0495680_0106263_612_1439 | 274 |
| 244 | 3300047444 | Ga0495675_0017181 | Ga0495675_0017181_3203_4066 | 274 |
| 245 | 3300047444 | Ga0495675_0111646 | Ga0495675_0111646_680_1507 | 274 |
| 246 | 3300048088 | Ga0495602_0006011 | Ga0495602_0006011_7234_8097 | 274 |
| 247 | 3300048090 | Ga0495615_0038136 | Ga0495615_0038136_207_1031 | 274 |
| 248 | 3300048903 | Ga0496100_0023354 | Ga0496100_0023354_361_1200 | 274 |
| 249 | 3300048904 | Ga0496101_0048513 | Ga0496101_0048513_1716_2543 | 274 |
| 250 | 3300048907 | Ga0496104_0141451 | Ga0496104_0141451_565_1404 | 274 |
| 251 | 3300048907 | Ga0496104_0366861 | Ga0496104_0366861_171_998 | 274 |
| 252 | 3300048908 | Ga0496105_0176454 | Ga0496105_0176454_633_1460 | 274 |
| 253 | 3300048912 | Ga0496109_0108281 | Ga0496109_0108281_487_1326 | 274 |
| 254 | 3300048912 | Ga0496109_0481946 | Ga0496109_0481946_169_996 | 274 |
| 255 | 3300048913 | Ga0496110_0153421 | Ga0496110_0153421_1047_1886 | 274 |
| 256 | 3300048913 | Ga0496110_0250211 | Ga0496110_0250211_318_1145 | 274 |
| 257 | 3300048917 | Ga0496114_0024541 | Ga0496114_0024541_4069_4896 | 274 |
| 258 | 3300048929 | Ga0496126_0385304 | Ga0496126_0385304_182_1009 | 274 |
| 259 | 3300049571 | Ga0501034_0132315 | Ga0501034_0132315_361_1188 | 274 |
| 260 | 3300049574 | Ga0501038_0022920 | Ga0501038_0022920_465_1292 | 274 |
| 261 | 3300049581 | Ga0501047_0156691 | Ga0501047_0156691_659_1486 | 274 |
| 262 | 3300049586 | Ga0501070_0073675 | Ga0501070_0073675_237_1064 | 274 |
| 263 | 3300049823 | Ga0501044_0169363 | Ga0501044_0169363_1225_2052 | 274 |
| 264 | 3300050490 | nmdc:mga03n38_32897_c1 | nmdc:mga03n38_32897_c1_1224_2078 | 274 |
| 265 | 3300050490 | nmdc:mga03n38_51277_c1 | nmdc:mga03n38_51277_c1_241_1095 | 274 |
| 266 | 3300050507 | nmdc:mga05p37_49845_c1 | nmdc:mga05p37_49845_c1_2316_3155 | 274 |
| 267 | 3300050508 | nmdc:mga09592_24772_c1 | nmdc:mga09592_24772_c1_993_1832 | 274 |
| 268 | 3300050511 | nmdc:mga08y16_54579_c1 | nmdc:mga08y16_54579_c1_2799_3626 | 274 |
| 269 | 3300050512 | nmdc:mga0n895_10223_c1 | nmdc:mga0n895_10223_c1_4096_4923 | 274 |
| 270 | 3300050513 | nmdc:mga0rr50_78989_c1 | nmdc:mga0rr50_78989_c1_1037_1864 | 274 |
| 271 | 3300050515 | nmdc:mga0a205_12662_c1 | nmdc:mga0a205_12662_c1_5839_6666 | 274 |
| 272 | 3300053077 | Ga0495601_0008933 | Ga0495601_0008933_2449_3312 | 274 |
| 273 | 3300053077 | Ga0495601_0227772 | Ga0495601_0227772_279_1184 | 274 |
| 274 | 3300053078 | Ga0495612_0038918 | Ga0495612_0038918_216_1043 | 274 |
| 275 | 3300053084 | Ga0495595_0000412 | Ga0495595_0000412_11955_12818 | 274 |
| 276 | 3300053084 | Ga0495595_0028878 | Ga0495595_0028878_922_1749 | 274 |
| 277 | 3300053085 | Ga0495619_0000406 | Ga0495619_0000406_5959_6822 | 274 |
| 278 | 3300053085 | Ga0495619_0033950 | Ga0495619_0033950_63_890 | 274 |
| 279 | 3300061719 | Ga0466962_0136578 | Ga0466962_0136578_207_1034 | 274 |
| 280 | 3300001979 | JGI24740J21852_10002895 | JGI24740J21852_100028956 | 275 |
| 281 | 3300003203 | JGI25406J46586_10012002 | JGI25406J46586_100120021 | 275 |
| 282 | 3300003215 | JGI25153J46596_10004990 | JGI25153J46596_100049905 | 275 |
| 283 | 3300003322 | rootL2_10016153 | rootL2_100161531 | 275 |
| 284 | 3300003659 | JGI25404J52841_10002162 | JGI25404J52841_100021622 | 275 |
| 285 | 3300003659 | JGI25404J52841_10027263 | JGI25404J52841_100272631 | 275 |
| 286 | 3300003771 | Ga0055526_1012658 | Ga0055526_10126585 | 275 |
| 287 | 3300005262 | Ga0065165_1004236 | Ga0065165_10042369 | 275 |
| 288 | 3300005334 | Ga0068869_100238669 | Ga0068869_1002386692 | 275 |
| 289 | 3300005335 | Ga0070666_10096046 | Ga0070666_100960462 | 275 |
| 290 | 3300005336 | Ga0070680_100047174 | Ga0070680_1000471742 | 275 |
| 291 | 3300005337 | Ga0070682_100141865 | Ga0070682_1001418652 | 275 |
| 292 | 3300005338 | Ga0068868_100051453 | Ga0068868_1000514533 | 275 |
| 293 | 3300005338 | Ga0068868_100569111 | Ga0068868_1005691111 | 275 |
| 294 | 3300005344 | Ga0070661_100322414 | Ga0070661_1003224142 | 275 |
| 295 | 3300005347 | Ga0070668_100124800 | Ga0070668_1001248002 | 275 |
| 296 | 3300005355 | Ga0070671_100084238 | Ga0070671_1000842384 | 275 |
| 297 | 3300005355 | Ga0070671_100119344 | Ga0070671_1001193442 | 275 |
| 298 | 3300005365 | Ga0070688_100018386 | Ga0070688_1000183862 | 275 |
| 299 | 3300005367 | Ga0070667_100015594 | Ga0070667_1000155945 | 275 |
| 300 | 3300005367 | Ga0070667_100334955 | Ga0070667_1003349551 | 275 |
| 301 | 3300005434 | Ga0070709_10001198 | Ga0070709_1000119810 | 275 |
| 302 | 3300005434 | Ga0070709_10004329 | Ga0070709_100043291 | 275 |
| 303 | 3300005435 | Ga0070714_100002945 | Ga0070714_1000029452 | 275 |
| 304 | 3300005435 | Ga0070714_100133409 | Ga0070714_1001334092 | 275 |
| 305 | 3300005436 | Ga0070713_100001195 | Ga0070713_10000119510 | 275 |
| 306 | 3300005436 | Ga0070713_100091681 | Ga0070713_1000916811 | 275 |
| 307 | 3300005437 | Ga0070710_10000251 | Ga0070710_1000025114 | 275 |
| 308 | 3300005437 | Ga0070710_10001221 | Ga0070710_100012218 | 275 |
| 309 | 3300005437 | Ga0070710_10004644 | Ga0070710_100046448 | 275 |
| 310 | 3300005439 | Ga0070711_100000261 | Ga0070711_10000026111 | 275 |
| 311 | 3300005439 | Ga0070711_100028842 | Ga0070711_1000288424 | 275 |
| 312 | 3300005439 | Ga0070711_100035906 | Ga0070711_1000359065 | 275 |
| 313 | 3300005444 | Ga0070694_100418163 | Ga0070694_1004181632 | 275 |
| 314 | 3300005455 | Ga0070663_100066364 | Ga0070663_1000663644 | 275 |
| 315 | 3300005456 | Ga0070678_100025543 | Ga0070678_1000255432 | 275 |
| 316 | 3300005457 | Ga0070662_100373026 | Ga0070662_1003730261 | 275 |
| 317 | 3300005458 | Ga0070681_10009972 | Ga0070681_1000997210 | 275 |
| 318 | 3300005530 | Ga0070679_100292177 | Ga0070679_1002921772 | 275 |
| 319 | 3300005539 | Ga0068853_100017070 | Ga0068853_1000170702 | 275 |
| 320 | 3300005539 | Ga0068853_100074050 | Ga0068853_1000740503 | 275 |
| 321 | 3300005545 | Ga0070695_100230768 | Ga0070695_1002307682 | 275 |
| 322 | 3300005548 | Ga0070665_100005977 | Ga0070665_1000059774 | 275 |
| 323 | 3300005549 | Ga0070704_100103918 | Ga0070704_1001039182 | 275 |
| 324 | 3300005563 | Ga0068855_100091543 | Ga0068855_1000915436 | 275 |
| 325 | 3300005563 | Ga0068855_100496949 | Ga0068855_1004969491 | 275 |
| 326 | 3300005564 | Ga0070664_100082142 | Ga0070664_1000821423 | 275 |
| 327 | 3300005564 | Ga0070664_100343440 | Ga0070664_1003434402 | 275 |
| 328 | 3300005577 | Ga0068857_100005672 | Ga0068857_10000567210 | 275 |
| 329 | 3300005578 | Ga0068854_100046209 | Ga0068854_1000462095 | 275 |
| 330 | 3300005614 | Ga0068856_100001074 | Ga0068856_10000107418 | 275 |
| 331 | 3300005614 | Ga0068856_100005315 | Ga0068856_1000053157 | 275 |
| 332 | 3300005614 | Ga0068856_100586866 | Ga0068856_1005868661 | 275 |
| 333 | 3300005615 | Ga0070702_100146009 | Ga0070702_1001460092 | 275 |
| 334 | 3300005616 | Ga0068852_100048008 | Ga0068852_1000480082 | 275 |
| 335 | 3300005616 | Ga0068852_100293259 | Ga0068852_1002932592 | 275 |
| 336 | 3300005617 | Ga0068859_100142164 | Ga0068859_1001421643 | 275 |
| 337 | 3300005617 | Ga0068859_100350704 | Ga0068859_1003507042 | 275 |
| 338 | 3300005834 | Ga0068851_10000772 | Ga0068851_100007728 | 275 |
| 339 | 3300005841 | Ga0068863_100134289 | Ga0068863_1001342891 | 275 |
| 340 | 3300005842 | Ga0068858_100124907 | Ga0068858_1001249072 | 275 |
| 341 | 3300005843 | Ga0068860_100000610 | Ga0068860_10000061038 | 275 |
| 342 | 3300005843 | Ga0068860_100083762 | Ga0068860_1000837621 | 275 |
| 343 | 3300005937 | Ga0081455_10013694 | Ga0081455_100136945 | 275 |
| 344 | 3300005937 | Ga0081455_10016360 | Ga0081455_100163607 | 275 |
| 345 | 3300005937 | Ga0081455_10051042 | Ga0081455_100510422 | 275 |
| 346 | 3300005983 | Ga0081540_1001726 | Ga0081540_100172612 | 275 |
| 347 | 3300005983 | Ga0081540_1033429 | Ga0081540_10334292 | 275 |
| 348 | 3300005983 | Ga0081540_1073041 | Ga0081540_10730413 | 275 |
| 349 | 3300005983 | Ga0081540_1114638 | Ga0081540_11146381 | 275 |
| 350 | 3300005985 | Ga0081539_10003011 | Ga0081539_100030119 | 275 |
| 351 | 3300005985 | Ga0081539_10062422 | Ga0081539_100624222 | 275 |
| 352 | 3300006028 | Ga0070717_10012461 | Ga0070717_100124617 | 275 |
| 353 | 3300006028 | Ga0070717_10124778 | Ga0070717_101247782 | 275 |
| 354 | 3300006028 | Ga0070717_10305060 | Ga0070717_103050602 | 275 |
| 355 | 3300006038 | Ga0075365_10017347 | Ga0075365_100173473 | 275 |
| 356 | 3300006038 | Ga0075365_10023744 | Ga0075365_100237442 | 275 |
| 357 | 3300006038 | Ga0075365_10040996 | Ga0075365_100409963 | 275 |
| 358 | 3300006042 | Ga0075368_10006574 | Ga0075368_100065742 | 275 |
| 359 | 3300006042 | Ga0075368_10083912 | Ga0075368_100839122 | 275 |
| 360 | 3300006048 | Ga0075363_100013182 | Ga0075363_1000131823 | 275 |
| 361 | 3300006051 | Ga0075364_10059124 | Ga0075364_100591242 | 275 |
| 362 | 3300006163 | Ga0070715_10002749 | Ga0070715_100027496 | 275 |
| 363 | 3300006173 | Ga0070716_100003853 | Ga0070716_1000038538 | 275 |
| 364 | 3300006173 | Ga0070716_100004368 | Ga0070716_1000043686 | 275 |
| 365 | 3300006173 | Ga0070716_100073098 | Ga0070716_1000730982 | 275 |
| 366 | 3300006175 | Ga0070712_100012355 | Ga0070712_1000123557 | 275 |
| 367 | 3300006175 | Ga0070712_100095099 | Ga0070712_1000950993 | 275 |
| 368 | 3300006175 | Ga0070712_100570819 | Ga0070712_1005708191 | 275 |
| 369 | 3300006178 | Ga0075367_10009327 | Ga0075367_100093273 | 275 |
| 370 | 3300006186 | Ga0075369_10016332 | Ga0075369_100163323 | 275 |
| 371 | 3300006186 | Ga0075369_10029640 | Ga0075369_100296402 | 275 |
| 372 | 3300006195 | Ga0075366_10110079 | Ga0075366_101100792 | 275 |
| 373 | 3300006237 | Ga0097621_100069735 | Ga0097621_1000697353 | 275 |
| 374 | 3300006358 | Ga0068871_100126048 | Ga0068871_1001260482 | 275 |
| 375 | 3300006358 | Ga0068871_100330879 | Ga0068871_1003308792 | 275 |
| 376 | 3300006844 | Ga0075428_100439556 | Ga0075428_1004395562 | 275 |
| 377 | 3300006931 | Ga0097620_100142154 | Ga0097620_1001421543 | 275 |
| 378 | 3300006931 | Ga0097620_100350717 | Ga0097620_1003507172 | 275 |
| 379 | 3300006942 | Ga0099824_1017410 | Ga0099824_10174107 | 275 |
| 380 | 3300006943 | Ga0099822_1008751 | Ga0099822_10087515 | 275 |
| 381 | 3300007076 | Ga0075435_100058968 | Ga0075435_1000589683 | 275 |
| 382 | 3300009011 | Ga0105251_10108854 | Ga0105251_101088542 | 275 |
| 383 | 3300009092 | Ga0105250_10010001 | Ga0105250_100100013 | 275 |
| 384 | 3300009093 | Ga0105240_10006068 | Ga0105240_1000606816 | 275 |
| 385 | 3300009093 | Ga0105240_10011879 | Ga0105240_100118794 | 275 |
| 386 | 3300009093 | Ga0105240_10502895 | Ga0105240_105028952 | 275 |
| 387 | 3300009101 | Ga0105247_10010455 | Ga0105247_100104555 | 275 |
| 388 | 3300009148 | Ga0105243_10109163 | Ga0105243_101091631 | 275 |
| 389 | 3300009148 | Ga0105243_10181622 | Ga0105243_101816221 | 275 |
| 390 | 3300009174 | Ga0105241_10041123 | Ga0105241_100411231 | 275 |
| 391 | 3300009174 | Ga0105241_10076996 | Ga0105241_100769963 | 275 |
| 392 | 3300009176 | Ga0105242_10249577 | Ga0105242_102495773 | 275 |
| 393 | 3300009545 | Ga0105237_10015706 | Ga0105237_100157062 | 275 |
| 394 | 3300009545 | Ga0105237_10030752 | Ga0105237_100307526 | 275 |
| 395 | 3300009545 | Ga0105237_10059611 | Ga0105237_100596116 | 275 |
| 396 | 3300009545 | Ga0105237_10476917 | Ga0105237_104769171 | 275 |
| 397 | 3300009545 | Ga0105237_10568216 | Ga0105237_105682162 | 275 |
| 398 | 3300009551 | Ga0105238_10002249 | Ga0105238_1000224919 | 275 |
| 399 | 3300009551 | Ga0105238_10052177 | Ga0105238_100521772 | 275 |
| 400 | 3300010159 | Ga0099796_10104764 | Ga0099796_101047641 | 275 |
| 401 | 3300010375 | Ga0105239_10012149 | Ga0105239_1001214910 | 275 |
| 402 | 3300010375 | Ga0105239_10051500 | Ga0105239_100515004 | 275 |
| 403 | 3300010375 | Ga0105239_10237530 | Ga0105239_102375301 | 275 |
| 404 | 3300010375 | Ga0105239_10246394 | Ga0105239_102463942 | 275 |
| 405 | 3300013102 | Ga0157371_10154239 | Ga0157371_101542391 | 275 |
| 406 | 3300013104 | Ga0157370_10021698 | Ga0157370_100216987 | 275 |
| 407 | 3300013296 | Ga0157374_10015682 | Ga0157374_100156821 | 275 |
| 408 | 3300013297 | Ga0157378_10007897 | Ga0157378_100078975 | 275 |
| 409 | 3300013297 | Ga0157378_10579593 | Ga0157378_105795932 | 275 |
| 410 | 3300013306 | Ga0163162_10041805 | Ga0163162_100418055 | 275 |
| 411 | 3300013306 | Ga0163162_10265255 | Ga0163162_102652552 | 275 |
| 412 | 3300014325 | Ga0163163_10003826 | Ga0163163_1000382613 | 275 |
| 413 | 3300014325 | Ga0163163_10055474 | Ga0163163_100554742 | 275 |
| 414 | 3300014968 | Ga0157379_10511151 | Ga0157379_105111511 | 275 |
| 415 | 3300017792 | Ga0163161_10282765 | Ga0163161_102827651 | 275 |
| 416 | 3300021384 | Ga0213876_10012814 | Ga0213876_100128141 | 275 |
| 417 | 3300021384 | Ga0213876_10101007 | Ga0213876_101010072 | 275 |
| 418 | 3300025253 | Ga0209677_100388 | Ga0209677_10038820 | 275 |
| 419 | 3300025254 | Ga0209148_1005144 | Ga0209148_10051442 | 275 |
| 420 | 3300025261 | Ga0209233_1001612 | Ga0209233_10016124 | 275 |
| 421 | 3300025272 | Ga0209455_1002273 | Ga0209455_10022737 | 275 |
| 422 | 3300025272 | Ga0209455_1006233 | Ga0209455_10062333 | 275 |
| 423 | 3300025295 | Ga0209564_1000477 | Ga0209564_100047727 | 275 |
| 424 | 3300025295 | Ga0209564_1012120 | Ga0209564_10121205 | 275 |
| 425 | 3300025297 | Ga0209758_1002550 | Ga0209758_100255012 | 275 |
| 426 | 3300025297 | Ga0209758_1005044 | Ga0209758_10050442 | 275 |
| 427 | 3300025297 | Ga0209758_1016059 | Ga0209758_10160593 | 275 |
| 428 | 3300025302 | Ga0207426_1004036 | Ga0207426_10040368 | 275 |
| 429 | 3300025321 | Ga0207656_10062172 | Ga0207656_100621722 | 275 |
| 430 | 3300025898 | Ga0207692_10000148 | Ga0207692_1000014810 | 275 |
| 431 | 3300025898 | Ga0207692_10000717 | Ga0207692_1000071712 | 275 |
| 432 | 3300025898 | Ga0207692_10005747 | Ga0207692_100057474 | 275 |
| 433 | 3300025900 | Ga0207710_10004963 | Ga0207710_100049633 | 275 |
| 434 | 3300025906 | Ga0207699_10000967 | Ga0207699_1000096714 | 275 |
| 435 | 3300025906 | Ga0207699_10029228 | Ga0207699_100292284 | 275 |
| 436 | 3300025909 | Ga0207705_10033639 | Ga0207705_100336395 | 275 |
| 437 | 3300025911 | Ga0207654_10000201 | Ga0207654_1000020120 | 275 |
| 438 | 3300025912 | Ga0207707_10016259 | Ga0207707_100162594 | 275 |
| 439 | 3300025912 | Ga0207707_10056283 | Ga0207707_100562834 | 275 |
| 440 | 3300025913 | Ga0207695_10000343 | Ga0207695_1000034317 | 275 |
| 441 | 3300025913 | Ga0207695_10397318 | Ga0207695_103973182 | 275 |
| 442 | 3300025914 | Ga0207671_10131542 | Ga0207671_101315422 | 275 |
| 443 | 3300025914 | Ga0207671_10286709 | Ga0207671_102867091 | 275 |
| 444 | 3300025915 | Ga0207693_10003226 | Ga0207693_1000322614 | 275 |
| 445 | 3300025915 | Ga0207693_10015330 | Ga0207693_100153307 | 275 |
| 446 | 3300025915 | Ga0207693_10023532 | Ga0207693_100235321 | 275 |
| 447 | 3300025916 | Ga0207663_10000161 | Ga0207663_1000016127 | 275 |
| 448 | 3300025916 | Ga0207663_10111931 | Ga0207663_101119312 | 275 |
| 449 | 3300025917 | Ga0207660_10017097 | Ga0207660_100170974 | 275 |
| 450 | 3300025920 | Ga0207649_10266439 | Ga0207649_102664391 | 275 |
| 451 | 3300025922 | Ga0207646_10222845 | Ga0207646_102228452 | 275 |
| 452 | 3300025924 | Ga0207694_10000339 | Ga0207694_1000033931 | 275 |
| 453 | 3300025924 | Ga0207694_10143082 | Ga0207694_101430823 | 275 |
| 454 | 3300025928 | Ga0207700_10004801 | Ga0207700_100048019 | 275 |
| 455 | 3300025929 | Ga0207664_10018907 | Ga0207664_100189071 | 275 |
| 456 | 3300025933 | Ga0207706_10298909 | Ga0207706_102989092 | 275 |
| 457 | 3300025934 | Ga0207686_10316868 | Ga0207686_103168681 | 275 |
| 458 | 3300025939 | Ga0207665_10000183 | Ga0207665_1000018314 | 275 |
| 459 | 3300025939 | Ga0207665_10006487 | Ga0207665_100064879 | 275 |
| 460 | 3300025941 | Ga0207711_10532489 | Ga0207711_105324891 | 275 |
| 461 | 3300025942 | Ga0207689_10054175 | Ga0207689_100541751 | 275 |
| 462 | 3300025949 | Ga0207667_10008033 | Ga0207667_1000803311 | 275 |
| 463 | 3300025949 | Ga0207667_10030570 | Ga0207667_100305704 | 275 |
| 464 | 3300025949 | Ga0207667_10308457 | Ga0207667_103084572 | 275 |
| 465 | 3300025972 | Ga0207668_10064056 | Ga0207668_100640563 | 275 |
| 466 | 3300025972 | Ga0207668_10117537 | Ga0207668_101175371 | 275 |
| 467 | 3300025981 | Ga0207640_10288534 | Ga0207640_102885341 | 275 |
| 468 | 3300025986 | Ga0207658_10024740 | Ga0207658_100247403 | 275 |
| 469 | 3300026035 | Ga0207703_10126684 | Ga0207703_101266841 | 275 |
| 470 | 3300026035 | Ga0207703_10189182 | Ga0207703_101891822 | 275 |
| 471 | 3300026041 | Ga0207639_10021031 | Ga0207639_100210311 | 275 |
| 472 | 3300026041 | Ga0207639_10447927 | Ga0207639_104479271 | 275 |
| 473 | 3300026067 | Ga0207678_10023778 | Ga0207678_100237784 | 275 |
| 474 | 3300026067 | Ga0207678_10043964 | Ga0207678_100439644 | 275 |
| 475 | 3300026067 | Ga0207678_10053722 | Ga0207678_100537223 | 275 |
| 476 | 3300026078 | Ga0207702_10000006 | Ga0207702_10000006268 | 275 |
| 477 | 3300026078 | Ga0207702_10000063 | Ga0207702_1000006376 | 275 |
| 478 | 3300026088 | Ga0207641_10139163 | Ga0207641_101391632 | 275 |
| 479 | 3300026089 | Ga0207648_10254601 | Ga0207648_102546011 | 275 |
| 480 | 3300026116 | Ga0207674_10003146 | Ga0207674_100031465 | 275 |
| 481 | 3300026118 | Ga0207675_100360384 | Ga0207675_1003603841 | 275 |
| 482 | 3300026121 | Ga0207683_10074562 | Ga0207683_100745622 | 275 |
| 483 | 3300026142 | Ga0207698_10525338 | Ga0207698_105253381 | 275 |
| 484 | 3300027296 | Ga0209389_1000034 | Ga0209389_100003488 | 275 |
| 485 | 3300027357 | Ga0209589_1000038 | Ga0209589_100003832 | 275 |
| 486 | 3300027357 | Ga0209589_1000055 | Ga0209589_100005581 | 275 |
| 487 | 3300027361 | Ga0209489_100023 | Ga0209489_100023161 | 275 |
| 488 | 3300027361 | Ga0209489_100128 | Ga0209489_10012881 | 275 |
| 489 | 3300027363 | Ga0209700_100137 | Ga0209700_10013781 | 275 |
| 490 | 3300028379 | Ga0268266_10004140 | Ga0268266_100041401 | 275 |
| 491 | 3300028379 | Ga0268266_10005567 | Ga0268266_100055677 | 275 |
| 492 | 3300028380 | Ga0268265_10479870 | Ga0268265_104798701 | 275 |
| 493 | 3300028381 | Ga0268264_10000194 | Ga0268264_10000194109 | 275 |
| 494 | 3300028381 | Ga0268264_10181007 | Ga0268264_101810071 | 275 |
| 495 | 3300028381 | Ga0268264_10253501 | Ga0268264_102535011 | 275 |
| 496 | 3300028556 | Ga0265337_1007152 | Ga0265337_10071525 | 275 |
| 497 | 3300028558 | Ga0265326_10003812 | Ga0265326_100038125 | 275 |
| 498 | 3300028573 | Ga0265334_10001143 | Ga0265334_1000114311 | 275 |
| 499 | 3300028573 | Ga0265334_10021025 | Ga0265334_100210251 | 275 |
| 500 | 3300028577 | Ga0265318_10017156 | Ga0265318_100171563 | 275 |
| 501 | 3300028653 | Ga0265323_10000720 | Ga0265323_100007206 | 275 |
| 502 | 3300028666 | Ga0265336_10000640 | Ga0265336_1000064014 | 275 |
| 503 | 3300028800 | Ga0265338_10001434 | Ga0265338_1000143429 | 275 |
| 504 | 3300029957 | Ga0265324_10001605 | Ga0265324_100016056 | 275 |
| 505 | 3300030521 | Ga0307511_10101061 | Ga0307511_101010612 | 275 |
| 506 | 3300031507 | Ga0307509_10086792 | Ga0307509_100867922 | 275 |
| 507 | 3300031616 | Ga0307508_10000012 | Ga0307508_1000001274 | 275 |
| 508 | 3300031616 | Ga0307508_10009028 | Ga0307508_100090282 | 275 |
| 509 | 3300031711 | Ga0265314_10007404 | Ga0265314_100074043 | 275 |
| 510 | 3300031711 | Ga0265314_10035570 | Ga0265314_100355704 | 275 |
| 511 | 3300031712 | Ga0265342_10044744 | Ga0265342_100447444 | 275 |
| 512 | 3300031712 | Ga0265342_10061317 | Ga0265342_100613173 | 275 |
| 513 | 3300031903 | Ga0307407_10102978 | Ga0307407_101029782 | 275 |
| 514 | 3300031911 | Ga0307412_10420942 | Ga0307412_104209421 | 275 |
| 515 | 3300032002 | Ga0307416_100225076 | Ga0307416_1002250762 | 275 |
| 516 | 3300032005 | Ga0307411_10130182 | Ga0307411_101301822 | 275 |
| 517 | 3300032126 | Ga0307415_100038841 | Ga0307415_1000388412 | 275 |
| 518 | 3300033179 | Ga0307507_10075565 | Ga0307507_100755652 | 275 |
| 519 | 3300033180 | Ga0307510_10084921 | Ga0307510_100849213 | 275 |
| 520 | 3300035086 | Ga0373934_0002654 | Ga0373934_0002654_3913_4743 | 275 |
| 521 | 3300035086 | Ga0373934_0080222 | Ga0373934_0080222_261_1091 | 275 |
| 522 | 3300035117 | Ga0373953_0004142 | Ga0373953_0004142_3240_4070 | 275 |
| 523 | 3300035118 | Ga0373954_0013878 | Ga0373954_0013878_1234_2064 | 275 |
| 524 | 3300035119 | Ga0373956_0002781 | Ga0373956_0002781_2410_3240 | 275 |
| 525 | 3300035410 | Ga0373924_0018232 | Ga0373924_0018232_648_1478 | 275 |
| 526 | 3300035695 | Ga0373927_0040216 | Ga0373927_0040216_729_1556 | 275 |
| 527 | 3300035724 | Ga0373933_0000105 | Ga0373933_0000105_40277_41104 | 275 |
| 528 | 3300035724 | Ga0373933_0014901 | Ga0373933_0014901_1237_2067 | 275 |
| 529 | 3300035725 | Ga0373947_0200879 | Ga0373947_0200879_338_1165 | 275 |
| 530 | 3300037068 | Ga0373925_0010972 | Ga0373925_0010972_1381_2211 | 275 |
| 531 | 3300037466 | Ga0395898_0072855 | Ga0395898_0072855_924_1751 | 275 |
| 532 | 3300039438 | Ga0436360_0366032 | Ga0436360_0366032_85_933 | 275 |
| 533 | 3300039447 | Ga0436361_1152014 | Ga0436361_1152014_2812_3660 | 275 |
| 534 | 3300039453 | Ga0436362_0421234 | Ga0436362_0421234_3133_3960 | 275 |
| 535 | 3300041463 | Ga0451804_1168769 | Ga0451804_1168769_116_943 | 275 |
| 536 | 3300044683 | Ga0466965_0020681 | Ga0466965_0020681_1293_2123 | 275 |
| 537 | 3300044684 | Ga0466966_0314994 | Ga0466966_0314994_57_884 | 275 |
| 538 | 3300044842 | Ga0466957_0159583 | Ga0466957_0159583_96_929 | 275 |
| 539 | 3300044901 | Ga0466960_0031793 | Ga0466960_0031793_854_1681 | 275 |
| 540 | 3300045049 | Ga0466959_0049008 | Ga0466959_0049008_1898_2731 | 275 |
| 541 | 3300046454 | Ga0495592_0141675 | Ga0495592_0141675_744_1574 | 275 |
| 542 | 3300046455 | Ga0495603_0040327 | Ga0495603_0040327_1115_1942 | 275 |
| 543 | 3300046459 | Ga0495629_0000331 | Ga0495629_0000331_37019_37849 | 275 |
| 544 | 3300046459 | Ga0495629_0046328 | Ga0495629_0046328_1061_1888 | 275 |
| 545 | 3300046473 | Ga0495582_0032041 | Ga0495582_0032041_1449_2276 | 275 |
| 546 | 3300046474 | Ga0495605_0034972 | Ga0495605_0034972_1165_1992 | 275 |
| 547 | 3300046475 | Ga0495639_0037730 | Ga0495639_0037730_1239_2090 | 275 |
| 548 | 3300046475 | Ga0495639_0045535 | Ga0495639_0045535_872_1699 | 275 |
| 549 | 3300046507 | Ga0495606_0151446 | Ga0495606_0151446_104_931 | 275 |
| 550 | 3300046507 | Ga0495606_0198747 | Ga0495606_0198747_82_933 | 275 |
| 551 | 3300046507 | Ga0495606_0286225 | Ga0495606_0286225_57_884 | 275 |
| 552 | 3300046511 | Ga0495608_0000988 | Ga0495608_0000988_11806_12636 | 275 |
| 553 | 3300046516 | Ga0495628_0059720 | Ga0495628_0059720_794_1624 | 275 |
| 554 | 3300046524 | Ga0495648_0009857 | Ga0495648_0009857_4713_5540 | 275 |
| 555 | 3300046524 | Ga0495648_0172523 | Ga0495648_0172523_205_1059 | 275 |
| 556 | 3300046529 | Ga0495652_0031734 | Ga0495652_0031734_1338_2168 | 275 |
| 557 | 3300046533 | Ga0495640_0008206 | Ga0495640_0008206_1235_2065 | 275 |
| 558 | 3300046536 | Ga0495587_0219407 | Ga0495587_0219407_98_928 | 275 |
| 559 | 3300046538 | Ga0495609_0070370 | Ga0495609_0070370_417_1244 | 275 |
| 560 | 3300046557 | Ga0495622_0005907 | Ga0495622_0005907_2155_2982 | 275 |
| 561 | 3300046557 | Ga0495622_0060262 | Ga0495622_0060262_537_1364 | 275 |
| 562 | 3300046616 | Ga0495668_0006816 | Ga0495668_0006816_424_1275 | 275 |
| 563 | 3300046616 | Ga0495668_0035267 | Ga0495668_0035267_1455_2306 | 275 |
| 564 | 3300046642 | Ga0495634_0027762 | Ga0495634_0027762_1858_2688 | 275 |
| 565 | 3300046648 | Ga0495611_0047658 | Ga0495611_0047658_165_992 | 275 |
| 566 | 3300046663 | Ga0495635_0024756 | Ga0495635_0024756_674_1504 | 275 |
| 567 | 3300046663 | Ga0495635_0339139 | Ga0495635_0339139_38_865 | 275 |
| 568 | 3300046665 | Ga0495661_0120753 | Ga0495661_0120753_342_1169 | 275 |
| 569 | 3300046675 | Ga0495657_0006539 | Ga0495657_0006539_7733_8563 | 275 |
| 570 | 3300046678 | Ga0495599_0003332 | Ga0495599_0003332_1989_2819 | 275 |
| 571 | 3300046680 | Ga0495646_0004946 | Ga0495646_0004946_2503_3333 | 275 |
| 572 | 3300046689 | Ga0495613_0007833 | Ga0495613_0007833_112_942 | 275 |
| 573 | 3300046692 | Ga0495671_0047958 | Ga0495671_0047958_359_1186 | 275 |
| 574 | 3300046794 | Ga0495589_0107047 | Ga0495589_0107047_88_915 | 275 |
| 575 | 3300046809 | Ga0495600_0036905 | Ga0495600_0036905_98_928 | 275 |
| 576 | 3300047315 | Ga0495581_0040360 | Ga0495581_0040360_623_1450 | 275 |
| 577 | 3300047315 | Ga0495581_0111765 | Ga0495581_0111765_721_1572 | 275 |
| 578 | 3300047317 | Ga0495604_0006191 | Ga0495604_0006191_2680_3510 | 275 |
| 579 | 3300047319 | Ga0495674_0016373 | Ga0495674_0016373_2573_3403 | 275 |
| 580 | 3300047320 | Ga0495672_0009045 | Ga0495672_0009045_2327_3154 | 275 |
| 581 | 3300047320 | Ga0495672_0118382 | Ga0495672_0118382_390_1217 | 275 |
| 582 | 3300047322 | Ga0495680_0132694 | Ga0495680_0132694_901_1731 | 275 |
| 583 | 3300047444 | Ga0495675_0019152 | Ga0495675_0019152_552_1382 | 275 |
| 584 | 3300047471 | Ga0495684_0000842 | Ga0495684_0000842_5803_6633 | 275 |
| 585 | 3300047472 | Ga0495686_0021671 | Ga0495686_0021671_384_1211 | 275 |
| 586 | 3300047472 | Ga0495686_0057319 | Ga0495686_0057319_952_1803 | 275 |
| 587 | 3300048090 | Ga0495615_0023597 | Ga0495615_0023597_41_868 | 275 |
| 588 | 3300048091 | Ga0495626_0116380 | Ga0495626_0116380_93_947 | 275 |
| 589 | 3300048903 | Ga0496100_0218220 | Ga0496100_0218220_418_1245 | 275 |
| 590 | 3300048904 | Ga0496101_0022046 | Ga0496101_0022046_2312_3139 | 275 |
| 591 | 3300048904 | Ga0496101_0430546 | Ga0496101_0430546_20_847 | 275 |
| 592 | 3300048907 | Ga0496104_0111787 | Ga0496104_0111787_104_931 | 275 |
| 593 | 3300048908 | Ga0496105_0043187 | Ga0496105_0043187_514_1341 | 275 |
| 594 | 3300048909 | Ga0496106_0034635 | Ga0496106_0034635_554_1381 | 275 |
| 595 | 3300048909 | Ga0496106_0042512 | Ga0496106_0042512_111_941 | 275 |
| 596 | 3300048910 | Ga0496107_0044647 | Ga0496107_0044647_40_867 | 275 |
| 597 | 3300048911 | Ga0496108_0103965 | Ga0496108_0103965_1260_2087 | 275 |
| 598 | 3300048912 | Ga0496109_0084633 | Ga0496109_0084633_801_1628 | 275 |
| 599 | 3300048915 | Ga0496112_0010997 | Ga0496112_0010997_5068_5895 | 275 |
| 600 | 3300048916 | Ga0496113_0024839 | Ga0496113_0024839_2811_3638 | 275 |
| 601 | 3300048918 | Ga0496115_0047577 | Ga0496115_0047577_105_932 | 275 |
| 602 | 3300048919 | Ga0496116_0025104 | Ga0496116_0025104_2200_3027 | 275 |
| 603 | 3300048919 | Ga0496116_0166567 | Ga0496116_0166567_175_1029 | 275 |
| 604 | 3300048920 | Ga0496117_0036779 | Ga0496117_0036779_773_1600 | 275 |
| 605 | 3300048920 | Ga0496117_0069713 | Ga0496117_0069713_387_1214 | 275 |
| 606 | 3300048920 | Ga0496117_0121830 | Ga0496117_0121830_422_1276 | 275 |
| 607 | 3300048921 | Ga0496118_0008250 | Ga0496118_0008250_5177_6004 | 275 |
| 608 | 3300048924 | Ga0496121_0002294 | Ga0496121_0002294_5341_6168 | 275 |
| 609 | 3300048924 | Ga0496121_0002330 | Ga0496121_0002330_14003_14830 | 275 |
| 610 | 3300048924 | Ga0496121_0017911 | Ga0496121_0017911_5715_6542 | 275 |
| 611 | 3300048924 | Ga0496121_0042163 | Ga0496121_0042163_3102_3956 | 275 |
| 612 | 3300048924 | Ga0496121_0052943 | Ga0496121_0052943_1601_2428 | 275 |
| 613 | 3300048924 | Ga0496121_0100375 | Ga0496121_0100375_686_1513 | 275 |
| 614 | 3300048924 | Ga0496121_0131364 | Ga0496121_0131364_218_1045 | 275 |
| 615 | 3300048927 | Ga0496124_0013092 | Ga0496124_0013092_1581_2408 | 275 |
| 616 | 3300048927 | Ga0496124_0031907 | Ga0496124_0031907_3106_3933 | 275 |
| 617 | 3300048927 | Ga0496124_0111797 | Ga0496124_0111797_857_1684 | 275 |
| 618 | 3300048928 | Ga0496125_0001204 | Ga0496125_0001204_11309_12136 | 275 |
| 619 | 3300048928 | Ga0496125_0002521 | Ga0496125_0002521_13158_13985 | 275 |
| 620 | 3300048928 | Ga0496125_0027673 | Ga0496125_0027673_3507_4361 | 275 |
| 621 | 3300048928 | Ga0496125_0028221 | Ga0496125_0028221_251_1105 | 275 |
| 622 | 3300048928 | Ga0496125_0054342 | Ga0496125_0054342_797_1624 | 275 |
| 623 | 3300048928 | Ga0496125_0101045 | Ga0496125_0101045_613_1440 | 275 |
| 624 | 3300048929 | Ga0496126_0010565 | Ga0496126_0010565_2986_3813 | 275 |
| 625 | 3300048929 | Ga0496126_0014202 | Ga0496126_0014202_1891_2718 | 275 |
| 626 | 3300048929 | Ga0496126_0030609 | Ga0496126_0030609_4023_4850 | 275 |
| 627 | 3300048929 | Ga0496126_0148059 | Ga0496126_0148059_227_1054 | 275 |
| 628 | 3300049581 | Ga0501047_0350503 | Ga0501047_0350503_139_966 | 275 |
| 629 | 3300050489 | nmdc:mga03683_115673_c1 | nmdc:mga03683_115673_c1_126_953 | 275 |
| 630 | 3300050491 | nmdc:mga00v17_182555_c1 | nmdc:mga00v17_182555_c1_302_1156 | 275 |
| 631 | 3300050492 | nmdc:mga0yw44_8666_c2 | nmdc:mga0yw44_8666_c2_1451_2278 | 275 |
| 632 | 3300050494 | nmdc:mga06z11_70142_c1 | nmdc:mga06z11_70142_c1_972_1799 | 275 |
| 633 | 3300050512 | nmdc:mga0n895_276242_c1 | nmdc:mga0n895_276242_c1_734_1561 | 275 |
| 634 | 3300050513 | nmdc:mga0rr50_209671_c1 | nmdc:mga0rr50_209671_c1_716_1543 | 275 |
| 635 | 3300050516 | nmdc:mga0sz30_2760_c1 | nmdc:mga0sz30_2760_c1_4245_5099 | 275 |
| 636 | 3300053077 | Ga0495601_0007866 | Ga0495601_0007866_781_1611 | 275 |
| 637 | 3300053080 | Ga0500635_0119267 | Ga0500635_0119267_50_877 | 275 |
| 638 | 3300053084 | Ga0495595_0192557 | Ga0495595_0192557_21_863 | 275 |
| 639 | 3300053085 | Ga0495619_0002280 | Ga0495619_0002280_2249_3079 | 275 |
| 640 | 3300053088 | Ga0500644_0006853 | Ga0500644_0006853_1248_2078 | 275 |
| 641 | 3300053093 | Ga0500651_0115731 | Ga0500651_0115731_505_1332 | 275 |
| 642 | 3300053094 | Ga0500566_0004519 | Ga0500566_0004519_4923_5750 | 275 |
| 643 | 3300053097 | Ga0500648_079091 | Ga0500648_079091_157_984 | 275 |
| 644 | 3300053119 | Ga0500595_010825 | Ga0500595_010825_2752_3579 | 275 |
| 645 | 3300053122 | Ga0500608_000229 | Ga0500608_000229_164_1018 | 275 |
| 646 | 3300053130 | Ga0500642_0000142 | Ga0500642_0000142_30747_31601 | 275 |
| 647 | 3300053136 | Ga0500559_0000105 | Ga0500559_0000105_2956_3810 | 275 |
| 648 | 3300053139 | Ga0500568_0004562 | Ga0500568_0004562_372_1238 | 275 |
| 649 | 3300053140 | Ga0500573_0031154 | Ga0500573_0031154_730_1557 | 275 |
| 650 | 3300053142 | Ga0500577_0019409 | Ga0500577_0019409_1324_2151 | 275 |
| 651 | 3300053145 | Ga0500586_028805 | Ga0500586_028805_162_1016 | 275 |
| 652 | 3300053148 | Ga0500590_062512 | Ga0500590_062512_437_1264 | 275 |
| 653 | 3300053153 | Ga0500616_0000038 | Ga0500616_0000038_337633_338463 | 275 |
| 654 | 3300053153 | Ga0500616_0000784 | Ga0500616_0000784_94_948 | 275 |
| 655 | 3300053177 | Ga0500636_0002483 | Ga0500636_0002483_1130_1957 | 275 |
| 656 | 3300053177 | Ga0500636_0062671 | Ga0500636_0062671_795_1634 | 275 |
| 657 | 3300053177 | Ga0500636_0175633 | Ga0500636_0175633_50_877 | 275 |
| 658 | 3300053178 | Ga0500637_0104449 | Ga0500637_0104449_228_1082 | 275 |
| 659 | 3300053735 | Ga0500596_003794 | Ga0500596_003794_1152_1979 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4u4v-assembly1.cif.gz_A | structure of a nitrate/nitrite antiporter nark in apo inward-open state | 0.2665 | 37 | 193 |
| 6hco-assembly1.cif.gz_A | cryo-em structure of the abcg2 e211q mutant bound to estrone 3-sulfate and 5d3-fab | 0.2533 | 45 | 195 |
| 7rtb-assembly1.cif.gz_R | peptide-19 bound to the glucagon-like peptide-1 receptor (glp-1r) | 0.2225 | 1 | 192 |
| 7lic-assembly1.cif.gz_A | the structure of the insect olfactory receptor or5 from machilis hrabei | 0.1825 | 22 | 194 |
| 4u4v-assembly1.cif.gz_A | structure of a nitrate/nitrite antiporter nark in apo inward-open state | 0.1821 | 37 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7JL16_30_260_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.2751 | 12 | 198 | 1.20.1080.10 |
| af_O46024_32_266_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.2538 | 1 | 191 | 1.20.1080.10 |
| af_Q7JL16_30_260_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.2378 | 12 | 198 | 1.20.1080.10 |
| 3aocC01 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.2337 | 9 | 171 | 1.20.1640.10 |
| 4u9nB00 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain | 0.2298 | 17 | 191 | 1.10.357.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E4BMH1-F1-model_v4 | Uncharacterized protein | 0.9886 | 1 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A6N7H1F3-F1-model_v4 | Sterol desaturase family protein | 0.9877 | 32 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A533IPT2-F1-model_v4 | deleted | 0.9865 | 96 | 275 |
|
| AF-A0A849ICG2-F1-model_v4 | Sterol desaturase family protein | 0.9814 | 6 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
| AF-A0A6N7H1F3-F1-model_v4 | Sterol desaturase family protein | 0.9797 | 32 | 275 |
GO:0005506
GO:0006643 GO:0008610 GO:0012505 GO:0016020 GO:0050479 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar