F473255

General Info

Members Datasets Scaffolds Average Seq Length
659 339 659 277

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10028160|Ga0265760_100281602
Length 323
Sequence MAQPVAVHRPLGLPRYFQIIAVLLSVGPQAPRKGALTSPATAGPRADMDQELIAVVITVGETLMKNVPISIALAAVFTILTQFWACNPGKRWWQKRDLVTDLCYWFFIPVITRFLRIGLLIAAAAMIFNITTAGGLIAFYENGHGPLAALPLFAQGVIFLIGEDFIMYWSHRWFHGEPVLWKYHAVHHSSEELEWISAARFHPINLFLGSVLADVVMLFAGISPNVFVVLGPLTIAHSAFVHANLDWSLGPFKYVLAGPVFHRWHHTAAERGGEKNFASTFPILDVMFGTFYMPAGQLPDRYGIDDRAFPESFGAQLMHPFTH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
75 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
167 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
276 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
326 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
327 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
328 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
334 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
337 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
338 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.65
Nodule 1.21
Rhizoplane 3.79
Rhizosphere 79.97
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002895 3300001979 Bacteria 7667
2 JGI25406J46586_10012002 3300003203 Bacteria 3776
3 JGI25153J46596_10004990 3300003215 Bacteria 7044
4 rootL2_10016153 3300003322 Bacteria 3836
5 JGI25404J52841_10002162 3300003659 Bacteria 3673
6 JGI25404J52841_10027263 3300003659 Bacteria 1229
7 Ga0055526_1012658 3300003771 Bacteria 3655
8 Ga0065165_1004236 3300005262 Bacteria 9108
9 Ga0070676_10169827 3300005328 Bacteria 1410
10 Ga0070676_10179911 3300005328 Bacteria 1374
11 Ga0070670_100014336 3300005331 Bacteria 6801
12 Ga0068869_100026808 3300005334 Bacteria 4013
13 Ga0068869_100152985 3300005334 Bacteria 1790
14 Ga0068869_100238669 3300005334 Bacteria 1447
15 Ga0070666_10096046 3300005335 Bacteria 2040
16 Ga0070680_100047174 3300005336 Bacteria 3507
17 Ga0070680_100185238 3300005336 Bacteria 1754
18 Ga0070680_100626156 3300005336 Unclassified 924
19 Ga0070682_100141865 3300005337 Bacteria 1639
20 Ga0068868_100051453 3300005338 Bacteria 3240
21 Ga0068868_100569111 3300005338 Bacteria 1001
22 Ga0068868_100570817 3300005338 Bacteria 999
23 Ga0070691_10001579 3300005341 Bacteria 9843
24 Ga0070661_100158263 3300005344 Bacteria 1714
25 Ga0070661_100322414 3300005344 Bacteria 1207
26 Ga0070668_100124800 3300005347 Bacteria 2061
27 Ga0070668_100285864 3300005347 Bacteria 1379
28 Ga0070675_100512754 3300005354 Bacteria 1081
29 Ga0070671_100084238 3300005355 Bacteria 2659
30 Ga0070671_100087471 3300005355 Bacteria 2608
31 Ga0070671_100119344 3300005355 Bacteria 2219
32 Ga0070688_100018386 3300005365 Bacteria 4032
33 Ga0070667_100015594 3300005367 Bacteria 6283
34 Ga0070667_100334955 3300005367 Bacteria 1368
35 Ga0070709_10001198 3300005434 Bacteria 14238
36 Ga0070709_10003245 3300005434 Bacteria 8726
37 Ga0070709_10004329 3300005434 Bacteria 7652
38 Ga0070714_100002945 3300005435 Bacteria 12607
39 Ga0070714_100060020 3300005435 Bacteria 3263
40 Ga0070714_100133409 3300005435 Bacteria 2221
41 Ga0070714_100156305 3300005435 Bacteria 2059
42 Ga0070713_100000006 3300005436 Bacteria 190565
43 Ga0070713_100001195 3300005436 Bacteria 16593
44 Ga0070713_100051182 3300005436 Bacteria 3415
45 Ga0070713_100068829 3300005436 Bacteria 2983
46 Ga0070713_100083086 3300005436 Bacteria 2737
47 Ga0070713_100091681 3300005436 Bacteria 2615
48 Ga0070710_10000251 3300005437 Bacteria 25319
49 Ga0070710_10001221 3300005437 Bacteria 12167
50 Ga0070710_10004644 3300005437 Bacteria 6495
51 Ga0070710_10081676 3300005437 Bacteria 1888
52 Ga0070711_100000261 3300005439 Bacteria 27019
53 Ga0070711_100028842 3300005439 Bacteria 3655
54 Ga0070711_100035906 3300005439 Bacteria 3318
55 Ga0070711_100072398 3300005439 Bacteria 2431
56 Ga0070711_100571960 3300005439 Unclassified 940
57 Ga0070694_100418163 3300005444 Bacteria 1053
58 Ga0070663_100066364 3300005455 Bacteria 2614
59 Ga0070678_100025543 3300005456 Bacteria 3976
60 Ga0070662_100165933 3300005457 Bacteria 1730
61 Ga0070662_100373026 3300005457 Bacteria 1173
62 Ga0070681_10009972 3300005458 Bacteria 9367
63 Ga0070698_100045923 3300005471 Bacteria 4468
64 Ga0070698_100075889 3300005471 Bacteria 3365
65 Ga0070679_100292177 3300005530 Bacteria 1581
66 Ga0070679_100418352 3300005530 Bacteria 1286
67 Ga0068853_100001105 3300005539 Bacteria 19110
68 Ga0068853_100017070 3300005539 Bacteria 5987
69 Ga0068853_100074050 3300005539 Bacteria 2971
70 Ga0070695_100016499 3300005545 Bacteria 4471
71 Ga0070695_100230768 3300005545 Bacteria 1338
72 Ga0070693_100009591 3300005547 Bacteria 4818
73 Ga0070693_100277007 3300005547 Bacteria 1122
74 Ga0070665_100005977 3300005548 Bacteria 12455
75 Ga0070704_100038932 3300005549 Bacteria 3260
76 Ga0070704_100103918 3300005549 Bacteria 2147
77 Ga0068855_100041136 3300005563 Bacteria 5480
78 Ga0068855_100091543 3300005563 Bacteria 3508
79 Ga0068855_100496949 3300005563 Bacteria 1326
80 Ga0070664_100082142 3300005564 Bacteria 2778
81 Ga0070664_100343440 3300005564 Bacteria 1356
82 Ga0068857_100000387 3300005577 Bacteria 30877
83 Ga0068857_100005672 3300005577 Bacteria 10671
84 Ga0068857_100063766 3300005577 Bacteria 3276
85 Ga0068854_100046209 3300005578 Bacteria 3099
86 Ga0068854_100317261 3300005578 Bacteria 1265
87 Ga0068856_100000316 3300005614 Bacteria 52971
88 Ga0068856_100001074 3300005614 Bacteria 28942
89 Ga0068856_100005315 3300005614 Bacteria 12714
90 Ga0068856_100013011 3300005614 Bacteria 8058
91 Ga0068856_100077355 3300005614 Bacteria 3297
92 Ga0068856_100586866 3300005614 Bacteria 1136
93 Ga0070702_100146009 3300005615 Bacteria 1513
94 Ga0068852_100006071 3300005616 Bacteria 8704
95 Ga0068852_100048008 3300005616 Bacteria 3646
96 Ga0068852_100293259 3300005616 Bacteria 1572
97 Ga0068859_100142164 3300005617 Bacteria 2473
98 Ga0068859_100350704 3300005617 Bacteria 1571
99 Ga0068851_10000772 3300005834 Bacteria 13788
100 Ga0068863_100134289 3300005841 Bacteria 2364
101 Ga0068863_100277470 3300005841 Bacteria 1623
102 Ga0068863_100753054 3300005841 Bacteria 970
103 Ga0068858_100095939 3300005842 Bacteria 2763
104 Ga0068858_100124907 3300005842 Bacteria 2408
105 Ga0068858_100190624 3300005842 Bacteria 1937
106 Ga0068860_100000610 3300005843 Bacteria 42430
107 Ga0068860_100021819 3300005843 Bacteria 6195
108 Ga0068860_100083762 3300005843 Bacteria 3033
109 Ga0081455_10001271 3300005937 Bacteria 31492
110 Ga0081455_10005762 3300005937 Bacteria 13507
111 Ga0081455_10013694 3300005937 Bacteria 7986
112 Ga0081455_10016360 3300005937 Bacteria 7164
113 Ga0081455_10051042 3300005937 Bacteria 3550
114 Ga0081540_1001726 3300005983 Bacteria 18454
115 Ga0081540_1033074 3300005983 Bacteria 2813
116 Ga0081540_1033429 3300005983 Bacteria 2793
117 Ga0081540_1073041 3300005983 Bacteria 1578
118 Ga0081540_1114638 3300005983 Bacteria 1131
119 Ga0081539_10003011 3300005985 Bacteria 21952
120 Ga0081539_10062422 3300005985 Bacteria 2037
121 Ga0070717_10009877 3300006028 Bacteria 7187
122 Ga0070717_10012461 3300006028 Bacteria 6485
123 Ga0070717_10124778 3300006028 Bacteria 2209
124 Ga0070717_10241947 3300006028 Bacteria 1591
125 Ga0070717_10305060 3300006028 Bacteria 1416
126 Ga0075365_10017347 3300006038 Bacteria 4403
127 Ga0075365_10023744 3300006038 Bacteria 3860
128 Ga0075365_10040996 3300006038 Bacteria 3022
129 Ga0075365_10328728 3300006038 Bacteria 1077
130 Ga0075368_10006574 3300006042 Bacteria 4069
131 Ga0075368_10083912 3300006042 Bacteria 1298
132 Ga0075363_100013182 3300006048 Bacteria 3999
133 Ga0075364_10059124 3300006051 Bacteria 2512
134 Ga0070715_10002749 3300006163 Bacteria 5460
135 Ga0070716_100003853 3300006173 Bacteria 7117
136 Ga0070716_100004368 3300006173 Bacteria 6750
137 Ga0070716_100073098 3300006173 Bacteria 2022
138 Ga0070712_100000184 3300006175 Bacteria 34651
139 Ga0070712_100000907 3300006175 Bacteria 17736
140 Ga0070712_100002943 3300006175 Bacteria 10550
141 Ga0070712_100012355 3300006175 Bacteria 5427
142 Ga0070712_100095099 3300006175 Bacteria 2191
143 Ga0070712_100118976 3300006175 Bacteria 1985
144 Ga0070712_100570819 3300006175 Bacteria 955
145 Ga0075362_10075305 3300006177 Bacteria 1548
146 Ga0075367_10009327 3300006178 Bacteria 5125
147 Ga0075367_10009807 3300006178 Bacteria 5017
148 Ga0075369_10016332 3300006186 Bacteria 2994
149 Ga0075369_10029640 3300006186 Bacteria 2300
150 Ga0075366_10110079 3300006195 Bacteria 1656
151 Ga0097621_100069735 3300006237 Bacteria 2903
152 Ga0097621_100119751 3300006237 Bacteria 2231
153 Ga0097621_100747229 3300006237 Unclassified 903
154 Ga0075370_10095860 3300006353 Bacteria 1714
155 Ga0068871_100126048 3300006358 Bacteria 2167
156 Ga0068871_100330879 3300006358 Bacteria 1343
157 Ga0068871_100592838 3300006358 Unclassified 1007
158 Ga0075428_100439556 3300006844 Bacteria 1397
159 Ga0075434_100010423 3300006871 Bacteria 8711
160 Ga0075434_100057365 3300006871 Bacteria 3870
161 Ga0075434_100099724 3300006871 Bacteria 2910
162 Ga0075429_100018507 3300006880 Bacteria 6033
163 Ga0075436_100003955 3300006914 Bacteria 10157
164 Ga0075436_100009184 3300006914 Bacteria 6765
165 Ga0097620_100142154 3300006931 Bacteria 2473
166 Ga0097620_100350717 3300006931 Bacteria 1571
167 Ga0099824_1017410 3300006942 Bacteria 6229
168 Ga0099822_1008751 3300006943 Bacteria 12906
169 Ga0075435_100058968 3300007076 Bacteria 3110
170 Ga0099795_10032800 3300007788 Bacteria 1799
171 Ga0105251_10108854 3300009011 Bacteria 1263
172 Ga0105250_10010001 3300009092 Bacteria 3972
173 Ga0105240_10006052 3300009093 Bacteria 17871
174 Ga0105240_10006068 3300009093 Bacteria 17849
175 Ga0105240_10011879 3300009093 Bacteria 12083
176 Ga0105240_10056512 3300009093 Bacteria 4910
177 Ga0105240_10502895 3300009093 Bacteria 1347
178 Ga0111539_10037235 3300009094 Bacteria 5877
179 Ga0105245_10106558 3300009098 Bacteria 2601
180 Ga0105247_10010455 3300009101 Bacteria 5611
181 Ga0114129_10127401 3300009147 Bacteria 3499
182 Ga0114129_10362270 3300009147 Unclassified 1918
183 Ga0105243_10109163 3300009148 Bacteria 2311
184 Ga0105243_10181622 3300009148 Bacteria 1830
185 Ga0105241_10041123 3300009174 Bacteria 3491
186 Ga0105241_10041205 3300009174 Bacteria 3488
187 Ga0105241_10076996 3300009174 Bacteria 2603
188 Ga0105241_10122032 3300009174 Bacteria 2099
189 Ga0105241_10381304 3300009174 Bacteria 1232
190 Ga0105241_10574240 3300009174 Unclassified 1015
191 Ga0105242_10249577 3300009176 Bacteria 1598
192 Ga0105237_10008191 3300009545 Bacteria 11353
193 Ga0105237_10015706 3300009545 Bacteria 7871
194 Ga0105237_10030752 3300009545 Bacteria 5450
195 Ga0105237_10043714 3300009545 Bacteria 4512
196 Ga0105237_10059611 3300009545 Bacteria 3818
197 Ga0105237_10136072 3300009545 Bacteria 2451
198 Ga0105237_10188318 3300009545 Bacteria 2064
199 Ga0105237_10476917 3300009545 Bacteria 1254
200 Ga0105237_10568216 3300009545 Bacteria 1141
201 Ga0105238_10000405 3300009551 Bacteria 45922
202 Ga0105238_10002249 3300009551 Bacteria 19487
203 Ga0105238_10052177 3300009551 Bacteria 4112
204 Ga0105238_10093961 3300009551 Bacteria 2987
205 Ga0099796_10104764 3300010159 Bacteria 1069
206 Ga0105239_10001057 3300010375 Bacteria 38270
207 Ga0105239_10012149 3300010375 Bacteria 9601
208 Ga0105239_10051500 3300010375 Bacteria 4513
209 Ga0105239_10064819 3300010375 Bacteria 4011
210 Ga0105239_10237530 3300010375 Bacteria 2046
211 Ga0105239_10246394 3300010375 Bacteria 2006
212 Ga0105246_10029060 3300011119 Bacteria 3636
213 Ga0157373_10007216 3300013100 Bacteria 8287
214 Ga0157371_10154239 3300013102 Bacteria 1639
215 Ga0157370_10000438 3300013104 Bacteria 51999
216 Ga0157370_10021698 3300013104 Bacteria 6397
217 Ga0157369_10003278 3300013105 Bacteria 19270
218 Ga0157369_10020839 3300013105 Bacteria 7328
219 Ga0157369_10054144 3300013105 Bacteria 4333
220 Ga0157374_10015682 3300013296 Bacteria 6653
221 Ga0157374_10834837 3300013296 Unclassified 938
222 Ga0157378_10007897 3300013297 Bacteria 9284
223 Ga0157378_10099211 3300013297 Bacteria 2657
224 Ga0157378_10151127 3300013297 Bacteria 2164
225 Ga0157378_10579593 3300013297 Bacteria 1131
226 Ga0163162_10041805 3300013306 Bacteria 4586
227 Ga0163162_10053553 3300013306 Bacteria 4056
228 Ga0163162_10265255 3300013306 Bacteria 1849
229 Ga0163163_10003826 3300014325 Bacteria 12814
230 Ga0163163_10055474 3300014325 Bacteria 3916
231 Ga0163163_10089138 3300014325 Bacteria 3096
232 Ga0157380_10053667 3300014326 Bacteria 3196
233 Ga0157379_10004187 3300014968 Bacteria 12319
234 Ga0157379_10018730 3300014968 Bacteria 6104
235 Ga0157379_10119890 3300014968 Bacteria 2366
236 Ga0157379_10511151 3300014968 Bacteria 1114
237 Ga0157376_10111931 3300014969 Bacteria 2404
238 Ga0182007_10069620 3300015262 Bacteria 1153
239 Ga0163161_10282765 3300017792 Bacteria 1302
240 Ga0213876_10012814 3300021384 Bacteria 4458
241 Ga0213876_10020048 3300021384 Bacteria 3532
242 Ga0213876_10101007 3300021384 Bacteria 1529
243 Ga0228598_1002005 3300024227 Bacteria 4445
244 Ga0209677_100388 3300025253 Bacteria 26746
245 Ga0209148_1005144 3300025254 Bacteria 3056
246 Ga0209233_1001612 3300025261 Bacteria 8789
247 Ga0209455_1002273 3300025272 Bacteria 7559
248 Ga0209455_1006233 3300025272 Bacteria 3554
249 Ga0209564_1000477 3300025295 Bacteria 66843
250 Ga0209564_1012120 3300025295 Bacteria 3790
251 Ga0209758_1002550 3300025297 Bacteria 18367
252 Ga0209758_1005044 3300025297 Bacteria 10495
253 Ga0209758_1016059 3300025297 Bacteria 3827
254 Ga0207426_1004036 3300025302 Bacteria 7436
255 Ga0207656_10062172 3300025321 Bacteria 1640
256 Ga0207692_10000148 3300025898 Bacteria 21949
257 Ga0207692_10000717 3300025898 Bacteria 11668
258 Ga0207692_10005747 3300025898 Bacteria 4990
259 Ga0207692_10023773 3300025898 Bacteria 2839
260 Ga0207710_10004963 3300025900 Bacteria 5766
261 Ga0207699_10000440 3300025906 Bacteria 21190
262 Ga0207699_10000967 3300025906 Bacteria 13702
263 Ga0207699_10029228 3300025906 Bacteria 3072
264 Ga0207645_10159657 3300025907 Bacteria 1474
265 Ga0207705_10033639 3300025909 Bacteria 3663
266 Ga0207654_10000201 3300025911 Bacteria 36898
267 Ga0207654_10112762 3300025911 Bacteria 1694
268 Ga0207707_10016259 3300025912 Bacteria 6490
269 Ga0207707_10056283 3300025912 Bacteria 3422
270 Ga0207695_10000343 3300025913 Bacteria 107739
271 Ga0207695_10197090 3300025913 Bacteria 1930
272 Ga0207695_10397318 3300025913 Bacteria 1263
273 Ga0207671_10087870 3300025914 Bacteria 2338
274 Ga0207671_10131542 3300025914 Bacteria 1921
275 Ga0207671_10286709 3300025914 Bacteria 1300
276 Ga0207693_10000127 3300025915 Bacteria 68379
277 Ga0207693_10000733 3300025915 Bacteria 29584
278 Ga0207693_10001801 3300025915 Bacteria 18789
279 Ga0207693_10003226 3300025915 Bacteria 14002
280 Ga0207693_10015330 3300025915 Bacteria 6152
281 Ga0207693_10022417 3300025915 Bacteria 5018
282 Ga0207693_10023532 3300025915 Bacteria 4890
283 Ga0207663_10000161 3300025916 Bacteria 30665
284 Ga0207663_10032451 3300025916 Bacteria 3100
285 Ga0207663_10111931 3300025916 Bacteria 1853
286 Ga0207663_10142208 3300025916 Bacteria 1673
287 Ga0207663_10423226 3300025916 Unclassified 1023
288 Ga0207660_10017097 3300025917 Bacteria 4813
289 Ga0207662_10124437 3300025918 Bacteria 1620
290 Ga0207649_10266439 3300025920 Bacteria 1240
291 Ga0207652_10608084 3300025921 Bacteria 980
292 Ga0207646_10222845 3300025922 Bacteria 1704
293 Ga0207694_10000339 3300025924 Bacteria 44198
294 Ga0207694_10118627 3300025924 Bacteria 2111
295 Ga0207694_10143082 3300025924 Bacteria 1924
296 Ga0207694_10486499 3300025924 Bacteria 1033
297 Ga0207650_10012783 3300025925 Bacteria 5800
298 Ga0207687_10089106 3300025927 Bacteria 2246
299 Ga0207687_10131136 3300025927 Bacteria 1889
300 Ga0207700_10000020 3300025928 Bacteria 176182
301 Ga0207700_10004801 3300025928 Bacteria 8020
302 Ga0207700_10040023 3300025928 Bacteria 3418
303 Ga0207700_10236735 3300025928 Bacteria 1555
304 Ga0207700_10411029 3300025928 Bacteria 1187
305 Ga0207700_10645700 3300025928 Bacteria 943
306 Ga0207664_10018907 3300025929 Bacteria 5081
307 Ga0207664_10033629 3300025929 Bacteria 3941
308 Ga0207644_10002440 3300025931 Bacteria 11989
309 Ga0207706_10040916 3300025933 Bacteria 4109
310 Ga0207706_10298909 3300025933 Bacteria 1403
311 Ga0207686_10316868 3300025934 Bacteria 1164
312 Ga0207665_10000183 3300025939 Bacteria 41938
313 Ga0207665_10006487 3300025939 Bacteria 7757
314 Ga0207711_10532489 3300025941 Bacteria 1096
315 Ga0207689_10054175 3300025942 Bacteria 3304
316 Ga0207689_10101884 3300025942 Bacteria 2358
317 Ga0207667_10008033 3300025949 Bacteria 12586
318 Ga0207667_10008487 3300025949 Bacteria 12203
319 Ga0207667_10030570 3300025949 Bacteria 5825
320 Ga0207667_10308457 3300025949 Bacteria 1617
321 Ga0207651_10235052 3300025960 Bacteria 1490
322 Ga0207668_10064056 3300025972 Bacteria 2596
323 Ga0207668_10117537 3300025972 Bacteria 2007
324 Ga0207640_10175770 3300025981 Bacteria 1600
325 Ga0207640_10288534 3300025981 Bacteria 1293
326 Ga0207658_10024740 3300025986 Bacteria 4202
327 Ga0207658_10186472 3300025986 Bacteria 1721
328 Ga0207703_10126684 3300026035 Bacteria 2199
329 Ga0207703_10189182 3300026035 Bacteria 1822
330 Ga0207639_10021031 3300026041 Bacteria 4680
331 Ga0207639_10447927 3300026041 Bacteria 1171
332 Ga0207678_10023778 3300026067 Bacteria 5357
333 Ga0207678_10043964 3300026067 Bacteria 3865
334 Ga0207678_10053722 3300026067 Bacteria 3471
335 Ga0207702_10000006 3300026078 Bacteria 346370
336 Ga0207702_10000030 3300026078 Bacteria 178718
337 Ga0207702_10000063 3300026078 Bacteria 123034
338 Ga0207702_10009151 3300026078 Bacteria 8333
339 Ga0207702_10404333 3300026078 Bacteria 1317
340 Ga0207641_10139163 3300026088 Bacteria 2188
341 Ga0207641_10419428 3300026088 Bacteria 1288
342 Ga0207648_10254601 3300026089 Bacteria 1566
343 Ga0207674_10000051 3300026116 Bacteria 116114
344 Ga0207674_10003146 3300026116 Bacteria 20343
345 Ga0207675_100051965 3300026118 Bacteria 3825
346 Ga0207675_100360384 3300026118 Bacteria 1426
347 Ga0207683_10074562 3300026121 Bacteria 3002
348 Ga0207698_10002358 3300026142 Bacteria 11199
349 Ga0207698_10087616 3300026142 Bacteria 2536
350 Ga0207698_10525338 3300026142 Bacteria 1156
351 Ga0209389_1000034 3300027296 Bacteria 127289
352 Ga0209589_1000038 3300027357 Bacteria 127285
353 Ga0209589_1000055 3300027357 Bacteria 111890
354 Ga0209489_100023 3300027361 Bacteria 198829
355 Ga0209489_100128 3300027361 Bacteria 111890
356 Ga0209700_100137 3300027363 Bacteria 111890
357 Ga0207428_10145827 3300027907 Bacteria 1804
358 Ga0268266_10004140 3300028379 Bacteria 14003
359 Ga0268266_10005567 3300028379 Bacteria 11711
360 Ga0268265_10479870 3300028380 Bacteria 1167
361 Ga0268264_10000194 3300028381 Bacteria 125395
362 Ga0268264_10044321 3300028381 Bacteria 3690
363 Ga0268264_10181007 3300028381 Bacteria 1914
364 Ga0268264_10253501 3300028381 Bacteria 1636
365 Ga0265337_1007152 3300028556 Bacteria 4209
366 Ga0265326_10003812 3300028558 Bacteria 4909
367 Ga0265334_10001143 3300028573 Bacteria 12967
368 Ga0265334_10021025 3300028573 Bacteria 2667
369 Ga0265318_10017156 3300028577 Bacteria 2976
370 Ga0265323_10000720 3300028653 Bacteria 17903
371 Ga0265336_10000640 3300028666 Bacteria 19119
372 Ga0265338_10001434 3300028800 Bacteria 38730
373 Ga0265338_10021310 3300028800 Bacteria 6764
374 Ga0265338_10056597 3300028800 Bacteria 3476
375 Ga0265338_10076221 3300028800 Unclassified 2841
376 Ga0265338_10291695 3300028800 Bacteria 1188
377 Ga0265324_10001605 3300029957 Bacteria 12590
378 Ga0307511_10101061 3300030521 Bacteria 1893
379 Ga0265763_1000067 3300030763 Bacteria 4398
380 Ga0265770_1011232 3300030878 Bacteria 1312
381 Ga0265773_1001569 3300031018 Bacteria 1256
382 Ga0265760_10028160 3300031090 Bacteria 1648
383 Ga0265330_10080093 3300031235 Bacteria 1407
384 Ga0265320_10000123 3300031240 Bacteria 67449
385 Ga0265325_10000027 3300031241 Bacteria 106598
386 Ga0265340_10071430 3300031247 Bacteria 1645
387 Ga0265340_10084100 3300031247 Bacteria 1494
388 Ga0265340_10108254 3300031247 Bacteria 1287
389 Ga0265340_10179227 3300031247 Bacteria 958
390 Ga0265339_10000069 3300031249 Bacteria 90219
391 Ga0265339_10009612 3300031249 Bacteria 6057
392 Ga0265339_10012935 3300031249 Bacteria 5072
393 Ga0265331_10004007 3300031250 Bacteria 9301
394 Ga0265316_10166512 3300031344 Unclassified 1646
395 Ga0307509_10086792 3300031507 Bacteria 3217
396 Ga0265313_10000335 3300031595 Bacteria 51231
397 Ga0265313_10000386 3300031595 Bacteria 47422
398 Ga0307508_10000012 3300031616 Bacteria 243167
399 Ga0307508_10009028 3300031616 Bacteria 9185
400 Ga0265314_10005246 3300031711 Bacteria 11739
401 Ga0265314_10007404 3300031711 Bacteria 9517
402 Ga0265314_10035570 3300031711 Bacteria 3629
403 Ga0265342_10015294 3300031712 Bacteria 5054
404 Ga0265342_10044744 3300031712 Bacteria 2667
405 Ga0265342_10061317 3300031712 Bacteria 2216
406 Ga0307407_10102978 3300031903 Bacteria 1776
407 Ga0307412_10420942 3300031911 Bacteria 1093
408 Ga0307416_100225076 3300032002 Bacteria 1803
409 Ga0307411_10130182 3300032005 Bacteria 1838
410 Ga0307415_100038841 3300032126 Bacteria 3141
411 Ga0307507_10075565 3300033179 Bacteria 3012
412 Ga0307510_10084921 3300033180 Bacteria 3046
413 Ga0373934_0002654 3300035086 Bacteria 6568
414 Ga0373934_0080222 3300035086 Bacteria 1311
415 Ga0373953_0004142 3300035117 Bacteria 4598
416 Ga0373954_0004128 3300035118 Bacteria 6223
417 Ga0373954_0013878 3300035118 Bacteria 3590
418 Ga0373956_0002781 3300035119 Bacteria 7078
419 Ga0373956_0151321 3300035119 Unclassified 1092
420 Ga0373957_0106097 3300035120 Unclassified 1128
421 Ga0373955_0002080 3300035172 Bacteria 8630
422 Ga0373955_0015922 3300035172 Bacteria 3691
423 Ga0373955_0114990 3300035172 Bacteria 1559
424 Ga0373924_0018232 3300035410 Bacteria 2702
425 Ga0373924_0068024 3300035410 Bacteria 1499
426 Ga0373931_0100776 3300035691 Bacteria 1624
427 Ga0373935_0113966 3300035692 Bacteria 1798
428 Ga0373927_0006235 3300035695 Bacteria 8140
429 Ga0373927_0040216 3300035695 Bacteria 3034
430 Ga0373927_0134953 3300035695 Bacteria 1613
431 Ga0373933_0000105 3300035724 Bacteria 53488
432 Ga0373933_0007754 3300035724 Bacteria 5863
433 Ga0373933_0008964 3300035724 Bacteria 5457
434 Ga0373933_0014901 3300035724 Bacteria 4328
435 Ga0373947_0200879 3300035725 Bacteria 1304
436 Ga0373937_0001334 3300036401 Bacteria 20640
437 Ga0373937_0017696 3300036401 Bacteria 6357
438 Ga0373937_0018383 3300036401 Bacteria 6242
439 Ga0373937_0019279 3300036401 Bacteria 6105
440 Ga0373937_0185936 3300036401 Bacteria 1951
441 Ga0316582_0048559 3300036647 Bacteria 2684
442 Ga0373925_0010972 3300037068 Bacteria 6577
443 Ga0373925_0080099 3300037068 Bacteria 2482
444 Ga0373925_0408333 3300037068 Bacteria 1108
445 Ga0395898_0072855 3300037466 Bacteria 3318
446 Ga0436364_1053992 3300037853 Bacteria 955
447 Ga0436365_0139851 3300039437 Bacteria 5712
448 Ga0436365_0371645 3300039437 Bacteria 4674
449 Ga0436365_1570748 3300039437 Bacteria 3379
450 Ga0436360_0366032 3300039438 Bacteria 1964
451 Ga0436361_1152014 3300039447 Bacteria 4131
452 Ga0436363_1472785 3300039450 Bacteria 2020
453 Ga0436362_0101659 3300039453 Bacteria 1720
454 Ga0436362_0421234 3300039453 Bacteria 8413
455 Ga0451804_1168769 3300041463 Bacteria 1266
456 Ga0466965_0020681 3300044683 Bacteria 3166
457 Ga0466966_0314994 3300044684 Bacteria 940
458 Ga0466963_0405721 3300044694 Bacteria 961
459 Ga0466957_0057879 3300044842 Bacteria 2373
460 Ga0466957_0159583 3300044842 Bacteria 1464
461 Ga0466960_0031793 3300044901 Bacteria 2438
462 Ga0466959_0049008 3300045049 Bacteria 3103
463 Ga0466959_0088909 3300045049 Bacteria 2220
464 Ga0466958_0025519 3300045836 Bacteria 3485
465 Ga0466967_0337384 3300045976 Bacteria 1457
466 Ga0495592_0085127 3300046454 Bacteria 2280
467 Ga0495592_0141675 3300046454 Bacteria 1671
468 Ga0495603_0040327 3300046455 Bacteria 2795
469 Ga0495603_0255091 3300046455 Unclassified 1010
470 Ga0495629_0000331 3300046459 Bacteria 40528
471 Ga0495629_0046328 3300046459 Bacteria 3050
472 Ga0495651_0000611 3300046462 Bacteria 27721
473 Ga0495653_0005332 3300046463 Bacteria 10464
474 Ga0495650_0074939 3300046471 Bacteria 1318
475 Ga0495582_0032041 3300046473 Bacteria 2892
476 Ga0495605_0034972 3300046474 Bacteria 2541
477 Ga0495639_0037730 3300046475 Bacteria 2167
478 Ga0495639_0045535 3300046475 Bacteria 1985
479 Ga0495606_0151446 3300046507 Bacteria 1361
480 Ga0495606_0198747 3300046507 Bacteria 1144
481 Ga0495606_0286225 3300046507 Bacteria 899
482 Ga0495608_0000988 3300046511 Bacteria 20058
483 Ga0495608_0007468 3300046511 Bacteria 7717
484 Ga0495608_0158045 3300046511 Bacteria 1442
485 Ga0495618_0001167 3300046514 Bacteria 17799
486 Ga0495628_0059720 3300046516 Bacteria 2993
487 Ga0495628_0134746 3300046516 Bacteria 1888
488 Ga0495628_0372223 3300046516 Bacteria 1047
489 Ga0495630_0071378 3300046517 Bacteria 2613
490 Ga0495631_0107584 3300046518 Bacteria 1199
491 Ga0495648_0009857 3300046524 Bacteria 7342
492 Ga0495648_0172523 3300046524 Bacteria 1107
493 Ga0495652_0004200 3300046529 Bacteria 13860
494 Ga0495652_0031734 3300046529 Bacteria 4623
495 Ga0495652_0195963 3300046529 Bacteria 1537
496 Ga0495640_0008206 3300046533 Bacteria 8198
497 Ga0495640_0008281 3300046533 Bacteria 8156
498 Ga0495640_0123091 3300046533 Bacteria 1684
499 Ga0495587_0000782 3300046536 Bacteria 21245
500 Ga0495587_0219407 3300046536 Bacteria 1072
501 Ga0495609_0070370 3300046538 Bacteria 1538
502 Ga0495645_0029128 3300046543 Bacteria 4014
503 Ga0495622_0005907 3300046557 Bacteria 5686
504 Ga0495622_0060262 3300046557 Bacteria 1757
505 Ga0495667_0012543 3300046559 Bacteria 5746
506 Ga0495667_0082272 3300046559 Bacteria 2092
507 Ga0495656_0012170 3300046615 Bacteria 3170
508 Ga0495668_0006816 3300046616 Bacteria 7415
509 Ga0495668_0035267 3300046616 Bacteria 2804
510 Ga0495634_0027762 3300046642 Bacteria 3936
511 Ga0495634_0071972 3300046642 Bacteria 2275
512 Ga0495611_0047658 3300046648 Bacteria 1924
513 Ga0495635_0024756 3300046663 Bacteria 4183
514 Ga0495635_0339139 3300046663 Bacteria 1004
515 Ga0495661_0120753 3300046665 Bacteria 1448
516 Ga0495657_0006539 3300046675 Bacteria 9114
517 Ga0495657_0015390 3300046675 Bacteria 5600
518 Ga0495599_0003332 3300046678 Bacteria 9379
519 Ga0495623_0004022 3300046679 Bacteria 9677
520 Ga0495646_0002775 3300046680 Bacteria 10841
521 Ga0495646_0004946 3300046680 Bacteria 8415
522 Ga0495613_0007833 3300046689 Bacteria 7945
523 Ga0495671_0047958 3300046692 Bacteria 2132
524 Ga0495589_0107047 3300046794 Bacteria 1351
525 Ga0495600_0036905 3300046809 Bacteria 3176
526 Ga0495600_0054587 3300046809 Bacteria 2610
527 Ga0495581_0040360 3300047315 Bacteria 2701
528 Ga0495581_0111765 3300047315 Bacteria 1589
529 Ga0495604_0000791 3300047317 Bacteria 26609
530 Ga0495604_0006191 3300047317 Bacteria 9497
531 Ga0495604_0057415 3300047317 Bacteria 2992
532 Ga0495674_0000747 3300047319 Bacteria 30766
533 Ga0495674_0016373 3300047319 Bacteria 6914
534 Ga0495672_0009045 3300047320 Bacteria 7262
535 Ga0495672_0009692 3300047320 Bacteria 6946
536 Ga0495672_0048283 3300047320 Bacteria 2525
537 Ga0495672_0118382 3300047320 Bacteria 1412
538 Ga0495680_0106263 3300047322 Bacteria 2086
539 Ga0495680_0132694 3300047322 Bacteria 1828
540 Ga0495675_0017181 3300047444 Bacteria 4582
541 Ga0495675_0019152 3300047444 Bacteria 4348
542 Ga0495675_0111646 3300047444 Bacteria 1706
543 Ga0495684_0000842 3300047471 Bacteria 24799
544 Ga0495686_0021671 3300047472 Bacteria 4261
545 Ga0495686_0057319 3300047472 Bacteria 2432
546 Ga0495602_0006011 3300048088 Bacteria 12744
547 Ga0495615_0023597 3300048090 Bacteria 1411
548 Ga0495615_0038136 3300048090 Bacteria 1187
549 Ga0495626_0116380 3300048091 Bacteria 1153
550 Ga0496100_0023354 3300048903 Bacteria 3756
551 Ga0496100_0218220 3300048903 Bacteria 1398
552 Ga0496101_0022046 3300048904 Bacteria 4381
553 Ga0496101_0048513 3300048904 Bacteria 3052
554 Ga0496101_0430546 3300048904 Bacteria 1040
555 Ga0496102_0128225 3300048905 Bacteria 2373
556 Ga0496104_0111787 3300048907 Bacteria 2619
557 Ga0496104_0141451 3300048907 Bacteria 2312
558 Ga0496104_0366861 3300048907 Bacteria 1352
559 Ga0496105_0043187 3300048908 Bacteria 3717
560 Ga0496105_0176454 3300048908 Bacteria 1750
561 Ga0496106_0034635 3300048909 Bacteria 3772
562 Ga0496106_0042512 3300048909 Bacteria 3408
563 Ga0496107_0044647 3300048910 Bacteria 3186
564 Ga0496108_0103965 3300048911 Bacteria 2424
565 Ga0496109_0084633 3300048912 Bacteria 2926
566 Ga0496109_0108281 3300048912 Bacteria 2583
567 Ga0496109_0481946 3300048912 Bacteria 1171
568 Ga0496110_0153421 3300048913 Bacteria 2086
569 Ga0496110_0250211 3300048913 Bacteria 1613
570 Ga0496112_0010997 3300048915 Bacteria 8245
571 Ga0496113_0024839 3300048916 Bacteria 4265
572 Ga0496114_0024541 3300048917 Bacteria 4923
573 Ga0496115_0047577 3300048918 Bacteria 3430
574 Ga0496116_0025104 3300048919 Bacteria 4390
575 Ga0496116_0166567 3300048919 Bacteria 1201
576 Ga0496117_0036779 3300048920 Bacteria 3658
577 Ga0496117_0069713 3300048920 Bacteria 2366
578 Ga0496117_0121830 3300048920 Bacteria 1600
579 Ga0496118_0008250 3300048921 Bacteria 10802
580 Ga0496121_0002294 3300048924 Bacteria 29707
581 Ga0496121_0002330 3300048924 Bacteria 29336
582 Ga0496121_0017911 3300048924 Bacteria 7186
583 Ga0496121_0042163 3300048924 Bacteria 3975
584 Ga0496121_0052943 3300048924 Bacteria 3403
585 Ga0496121_0100375 3300048924 Bacteria 2234
586 Ga0496121_0131364 3300048924 Bacteria 1873
587 Ga0496124_0013092 3300048927 Bacteria 8124
588 Ga0496124_0031907 3300048927 Bacteria 4659
589 Ga0496124_0111797 3300048927 Bacteria 2197
590 Ga0496125_0001204 3300048928 Bacteria 38897
591 Ga0496125_0002521 3300048928 Bacteria 23642
592 Ga0496125_0027673 3300048928 Bacteria 5134
593 Ga0496125_0028221 3300048928 Bacteria 5074
594 Ga0496125_0054342 3300048928 Bacteria 3273
595 Ga0496125_0101045 3300048928 Bacteria 2124
596 Ga0496126_0010565 3300048929 Bacteria 9656
597 Ga0496126_0014202 3300048929 Bacteria 8059
598 Ga0496126_0030609 3300048929 Bacteria 5095
599 Ga0496126_0148059 3300048929 Bacteria 2014
600 Ga0496126_0385304 3300048929 Bacteria 1140
601 Ga0501034_0000734 3300049571 Bacteria 49577
602 Ga0501034_0132315 3300049571 Bacteria 2477
603 Ga0501038_0022920 3300049574 Bacteria 5590
604 Ga0501047_0156691 3300049581 Bacteria 2151
605 Ga0501047_0350503 3300049581 Bacteria 1313
606 Ga0501070_0073675 3300049586 Bacteria 2825
607 Ga0501044_0169363 3300049823 Bacteria 2156
608 nmdc:mga03683_115673_c1 3300050489 Bacteria 1189
609 nmdc:mga03n38_32897_c1 3300050490 Bacteria 2201
610 nmdc:mga03n38_51277_c1 3300050490 Bacteria 1842
611 nmdc:mga00v17_182555_c1 3300050491 Bacteria 1354
612 nmdc:mga0yw44_8666_c2 3300050492 Bacteria 4733
613 nmdc:mga06z11_70142_c1 3300050494 Bacteria 1852
614 nmdc:mga05p37_49845_c1 3300050507 Bacteria 5150
615 nmdc:mga09592_24772_c1 3300050508 Bacteria 4962
616 nmdc:mga0qj67_55_c1 3300050509 Bacteria 83015
617 nmdc:mga08y16_54579_c1 3300050511 Bacteria 4175
618 nmdc:mga0n895_10223_c1 3300050512 Bacteria 8267
619 nmdc:mga0n895_119502_c1 3300050512 Bacteria 2656
620 nmdc:mga0n895_275379_c1 3300050512 Bacteria 1707
621 nmdc:mga0n895_276242_c1 3300050512 Bacteria 1704
622 nmdc:mga0rr50_209671_c1 3300050513 Bacteria 1605
623 nmdc:mga0rr50_78989_c1 3300050513 Bacteria 2533
624 nmdc:mga08x19_28772_c1 3300050514 Bacteria 3483
625 nmdc:mga08x19_460_c1 3300050514 Bacteria 27547
626 nmdc:mga0a205_12662_c1 3300050515 Bacteria 7812
627 nmdc:mga0sz30_2760_c1 3300050516 Bacteria 6262
628 Ga0495601_0007866 3300053077 Bacteria 6277
629 Ga0495601_0008933 3300053077 Bacteria 5916
630 Ga0495601_0227772 3300053077 Bacteria 1217
631 Ga0495612_0038918 3300053078 Bacteria 1933
632 Ga0500635_0119267 3300053080 Bacteria 986
633 Ga0495595_0000412 3300053084 Bacteria 16251
634 Ga0495595_0028878 3300053084 Bacteria 2479
635 Ga0495595_0192557 3300053084 Bacteria 1014
636 Ga0495619_0000406 3300053085 Bacteria 29319
637 Ga0495619_0002280 3300053085 Bacteria 12649
638 Ga0495619_0033950 3300053085 Bacteria 3315
639 Ga0500644_0006853 3300053088 Bacteria 2938
640 Ga0500651_0115731 3300053093 Bacteria 1632
641 Ga0500566_0004519 3300053094 Bacteria 8307
642 Ga0500648_079091 3300053097 Bacteria 1852
643 Ga0500595_010825 3300053119 Bacteria 3603
644 Ga0500608_000229 3300053122 Bacteria 22140
645 Ga0500642_0000142 3300053130 Bacteria 32016
646 Ga0500559_0000105 3300053136 Bacteria 65809
647 Ga0500568_0004562 3300053139 Bacteria 7382
648 Ga0500573_0031154 3300053140 Bacteria 3077
649 Ga0500577_0019409 3300053142 Bacteria 2204
650 Ga0500586_028805 3300053145 Bacteria 1816
651 Ga0500590_062512 3300053148 Bacteria 1868
652 Ga0500616_0000038 3300053153 Bacteria 386801
653 Ga0500616_0000784 3300053153 Bacteria 36530
654 Ga0500636_0002483 3300053177 Bacteria 10235
655 Ga0500636_0062671 3300053177 Bacteria 2168
656 Ga0500636_0175633 3300053177 Bacteria 1154
657 Ga0500637_0104449 3300053178 Bacteria 1643
658 Ga0500596_003794 3300053735 Bacteria 2834
659 Ga0466962_0136578 3300061719 Bacteria 1187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0151321 Ga0373956_0151321_250_1065 270
2 3300035172 Ga0373955_0015922 Ga0373955_0015922_973_1788 270
3 3300035410 Ga0373924_0068024 Ga0373924_0068024_43_1020 270
4 3300035724 Ga0373933_0007754 Ga0373933_0007754_3859_4674 270
5 3300036401 Ga0373937_0018383 Ga0373937_0018383_4568_5383 270
6 3300046518 Ga0495631_0107584 Ga0495631_0107584_131_943 270
7 3300005336 Ga0070680_100185238 Ga0070680_1001852381 271
8 3300005341 Ga0070691_10001579 Ga0070691_100015796 271
9 3300005434 Ga0070709_10003245 Ga0070709_100032455 271
10 3300005435 Ga0070714_100060020 Ga0070714_1000600202 271
11 3300005436 Ga0070713_100000006 Ga0070713_100000006143 271
12 3300005539 Ga0068853_100001105 Ga0068853_10000110520 271
13 3300005545 Ga0070695_100016499 Ga0070695_1000164994 271
14 3300005547 Ga0070693_100009591 Ga0070693_1000095916 271
15 3300005563 Ga0068855_100041136 Ga0068855_1000411365 271
16 3300005577 Ga0068857_100000387 Ga0068857_10000038721 271
17 3300005578 Ga0068854_100317261 Ga0068854_1003172612 271
18 3300005614 Ga0068856_100000316 Ga0068856_10000031652 271
19 3300005614 Ga0068856_100013011 Ga0068856_1000130113 271
20 3300005616 Ga0068852_100006071 Ga0068852_1000060717 271
21 3300005842 Ga0068858_100095939 Ga0068858_1000959393 271
22 3300006175 Ga0070712_100000184 Ga0070712_1000001847 271
23 3300006237 Ga0097621_100747229 Ga0097621_1007472291 271
24 3300006358 Ga0068871_100592838 Ga0068871_1005928381 271
25 3300006871 Ga0075434_100057365 Ga0075434_1000573654 271
26 3300006914 Ga0075436_100003955 Ga0075436_1000039558 271
27 3300006914 Ga0075436_100009184 Ga0075436_1000091845 271
28 3300009093 Ga0105240_10006052 Ga0105240_100060529 271
29 3300009174 Ga0105241_10041205 Ga0105241_100412052 271
30 3300009174 Ga0105241_10381304 Ga0105241_103813041 271
31 3300009174 Ga0105241_10574240 Ga0105241_105742402 271
32 3300009545 Ga0105237_10008191 Ga0105237_100081918 271
33 3300009551 Ga0105238_10000405 Ga0105238_1000040541 271
34 3300010375 Ga0105239_10064819 Ga0105239_100648193 271
35 3300013100 Ga0157373_10007216 Ga0157373_100072169 271
36 3300013104 Ga0157370_10000438 Ga0157370_1000043816 271
37 3300013105 Ga0157369_10054144 Ga0157369_100541443 271
38 3300013296 Ga0157374_10834837 Ga0157374_108348371 271
39 3300013297 Ga0157378_10099211 Ga0157378_100992114 271
40 3300013306 Ga0163162_10053553 Ga0163162_100535533 271
41 3300014968 Ga0157379_10018730 Ga0157379_100187304 271
42 3300025906 Ga0207699_10000440 Ga0207699_1000044010 271
43 3300025913 Ga0207695_10197090 Ga0207695_101970902 271
44 3300025914 Ga0207671_10087870 Ga0207671_100878703 271
45 3300025915 Ga0207693_10000733 Ga0207693_1000073325 271
46 3300025928 Ga0207700_10000020 Ga0207700_1000002029 271
47 3300025929 Ga0207664_10033629 Ga0207664_100336292 271
48 3300025949 Ga0207667_10008487 Ga0207667_1000848712 271
49 3300025981 Ga0207640_10175770 Ga0207640_101757702 271
50 3300026078 Ga0207702_10000030 Ga0207702_10000030118 271
51 3300026078 Ga0207702_10009151 Ga0207702_100091513 271
52 3300026116 Ga0207674_10000051 Ga0207674_1000005155 271
53 3300026142 Ga0207698_10002358 Ga0207698_100023587 271
54 3300035692 Ga0373935_0113966 Ga0373935_0113966_502_1320 271
55 3300048905 Ga0496102_0128225 Ga0496102_0128225_1414_2232 271
56 3300050512 nmdc:mga0n895_275379_c1 nmdc:mga0n895_275379_c1_858_1676 271
57 3300050514 nmdc:mga08x19_28772_c1 nmdc:mga08x19_28772_c1_2507_3325 271
58 3300050514 nmdc:mga08x19_460_c1 nmdc:mga08x19_460_c1_23097_23915 271
59 3300005336 Ga0070680_100626156 Ga0070680_1006261561 272
60 3300005547 Ga0070693_100277007 Ga0070693_1002770072 272
61 3300005843 Ga0068860_100021819 Ga0068860_1000218198 272
62 3300006871 Ga0075434_100099724 Ga0075434_1000997245 272
63 3300009093 Ga0105240_10056512 Ga0105240_100565127 272
64 3300009147 Ga0114129_10362270 Ga0114129_103622702 272
65 3300009174 Ga0105241_10122032 Ga0105241_101220322 272
66 3300009545 Ga0105237_10136072 Ga0105237_101360723 272
67 3300010375 Ga0105239_10001057 Ga0105239_1000105716 272
68 3300013105 Ga0157369_10003278 Ga0157369_1000327817 272
69 3300013105 Ga0157369_10020839 Ga0157369_100208398 272
70 3300013297 Ga0157378_10151127 Ga0157378_101511271 272
71 3300014968 Ga0157379_10004187 Ga0157379_100041875 272
72 3300025911 Ga0207654_10112762 Ga0207654_101127621 272
73 3300026078 Ga0207702_10404333 Ga0207702_104043332 272
74 3300026142 Ga0207698_10087616 Ga0207698_100876161 272
75 3300050512 nmdc:mga0n895_119502_c1 nmdc:mga0n895_119502_c1_1743_2564 272
76 3300005328 Ga0070676_10169827 Ga0070676_101698271 273
77 3300005334 Ga0068869_100026808 Ga0068869_1000268084 273
78 3300005436 Ga0070713_100051182 Ga0070713_1000511822 273
79 3300005439 Ga0070711_100072398 Ga0070711_1000723982 273
80 3300005439 Ga0070711_100571960 Ga0070711_1005719601 273
81 3300005471 Ga0070698_100045923 Ga0070698_1000459232 273
82 3300005549 Ga0070704_100038932 Ga0070704_1000389323 273
83 3300005614 Ga0068856_100077355 Ga0068856_1000773552 273
84 3300006175 Ga0070712_100000907 Ga0070712_1000009074 273
85 3300009545 Ga0105237_10188318 Ga0105237_101883182 273
86 3300014326 Ga0157380_10053667 Ga0157380_100536674 273
87 3300015262 Ga0182007_10069620 Ga0182007_100696202 273
88 3300025907 Ga0207645_10159657 Ga0207645_101596571 273
89 3300025915 Ga0207693_10000127 Ga0207693_1000012722 273
90 3300025916 Ga0207663_10032451 Ga0207663_100324512 273
91 3300025916 Ga0207663_10423226 Ga0207663_104232262 273
92 3300025942 Ga0207689_10101884 Ga0207689_101018842 273
93 3300028381 Ga0268264_10044321 Ga0268264_100443215 273
94 3300028800 Ga0265338_10056597 Ga0265338_100565972 273
95 3300028800 Ga0265338_10076221 Ga0265338_100762212 273
96 3300031240 Ga0265320_10000123 Ga0265320_1000012314 273
97 3300031241 Ga0265325_10000027 Ga0265325_100000275 273
98 3300031247 Ga0265340_10108254 Ga0265340_101082541 273
99 3300031247 Ga0265340_10179227 Ga0265340_101792271 273
100 3300031249 Ga0265339_10009612 Ga0265339_100096123 273
101 3300031249 Ga0265339_10012935 Ga0265339_100129354 273
102 3300031250 Ga0265331_10004007 Ga0265331_1000400710 273
103 3300031344 Ga0265316_10166512 Ga0265316_101665121 273
104 3300031595 Ga0265313_10000335 Ga0265313_1000033551 273
105 3300031711 Ga0265314_10005246 Ga0265314_100052467 273
106 3300035695 Ga0373927_0134953 Ga0373927_0134953_170_994 273
107 3300036401 Ga0373937_0001334 Ga0373937_0001334_16597_17421 273
108 3300039437 Ga0436365_1570748 Ga0436365_1570748_12_836 273
109 3300039453 Ga0436362_0101659 Ga0436362_0101659_520_1344 273
110 3300046516 Ga0495628_0372223 Ga0495628_0372223_200_1024 273
111 3300046533 Ga0495640_0123091 Ga0495640_0123091_378_1202 273
112 3300049571 Ga0501034_0000734 Ga0501034_0000734_22677_23501 273
113 3300050509 nmdc:mga0qj67_55_c1 nmdc:mga0qj67_55_c1_70913_71848 273
114 3300005328 Ga0070676_10179911 Ga0070676_101799112 274
115 3300005331 Ga0070670_100014336 Ga0070670_1000143366 274
116 3300005334 Ga0068869_100152985 Ga0068869_1001529852 274
117 3300005338 Ga0068868_100570817 Ga0068868_1005708171 274
118 3300005344 Ga0070661_100158263 Ga0070661_1001582631 274
119 3300005347 Ga0070668_100285864 Ga0070668_1002858641 274
120 3300005354 Ga0070675_100512754 Ga0070675_1005127541 274
121 3300005355 Ga0070671_100087471 Ga0070671_1000874714 274
122 3300005435 Ga0070714_100156305 Ga0070714_1001563052 274
123 3300005436 Ga0070713_100068829 Ga0070713_1000688292 274
124 3300005436 Ga0070713_100083086 Ga0070713_1000830861 274
125 3300005437 Ga0070710_10081676 Ga0070710_100816761 274
126 3300005457 Ga0070662_100165933 Ga0070662_1001659331 274
127 3300005471 Ga0070698_100075889 Ga0070698_1000758894 274
128 3300005530 Ga0070679_100418352 Ga0070679_1004183522 274
129 3300005577 Ga0068857_100063766 Ga0068857_1000637663 274
130 3300005841 Ga0068863_100277470 Ga0068863_1002774701 274
131 3300005841 Ga0068863_100753054 Ga0068863_1007530541 274
132 3300005842 Ga0068858_100190624 Ga0068858_1001906243 274
133 3300005937 Ga0081455_10001271 Ga0081455_100012719 274
134 3300005937 Ga0081455_10005762 Ga0081455_100057626 274
135 3300005983 Ga0081540_1033074 Ga0081540_10330742 274
136 3300006028 Ga0070717_10009877 Ga0070717_100098778 274
137 3300006028 Ga0070717_10241947 Ga0070717_102419472 274
138 3300006038 Ga0075365_10328728 Ga0075365_103287282 274
139 3300006175 Ga0070712_100002943 Ga0070712_1000029439 274
140 3300006175 Ga0070712_100118976 Ga0070712_1001189762 274
141 3300006177 Ga0075362_10075305 Ga0075362_100753051 274
142 3300006178 Ga0075367_10009807 Ga0075367_100098072 274
143 3300006237 Ga0097621_100119751 Ga0097621_1001197513 274
144 3300006353 Ga0075370_10095860 Ga0075370_100958602 274
145 3300006871 Ga0075434_100010423 Ga0075434_1000104237 274
146 3300006880 Ga0075429_100018507 Ga0075429_1000185077 274
147 3300007788 Ga0099795_10032800 Ga0099795_100328002 274
148 3300009094 Ga0111539_10037235 Ga0111539_100372352 274
149 3300009098 Ga0105245_10106558 Ga0105245_101065581 274
150 3300009147 Ga0114129_10127401 Ga0114129_101274012 274
151 3300009545 Ga0105237_10043714 Ga0105237_100437144 274
152 3300009551 Ga0105238_10093961 Ga0105238_100939612 274
153 3300011119 Ga0105246_10029060 Ga0105246_100290603 274
154 3300014325 Ga0163163_10089138 Ga0163163_100891383 274
155 3300014968 Ga0157379_10119890 Ga0157379_101198901 274
156 3300014969 Ga0157376_10111931 Ga0157376_101119311 274
157 3300021384 Ga0213876_10020048 Ga0213876_100200485 274
158 3300024227 Ga0228598_1002005 Ga0228598_10020054 274
159 3300025898 Ga0207692_10023773 Ga0207692_100237733 274
160 3300025915 Ga0207693_10001801 Ga0207693_100018019 274
161 3300025915 Ga0207693_10022417 Ga0207693_100224171 274
162 3300025916 Ga0207663_10142208 Ga0207663_101422081 274
163 3300025918 Ga0207662_10124437 Ga0207662_101244372 274
164 3300025921 Ga0207652_10608084 Ga0207652_106080841 274
165 3300025924 Ga0207694_10118627 Ga0207694_101186273 274
166 3300025924 Ga0207694_10486499 Ga0207694_104864991 274
167 3300025925 Ga0207650_10012783 Ga0207650_100127837 274
168 3300025927 Ga0207687_10089106 Ga0207687_100891061 274
169 3300025927 Ga0207687_10131136 Ga0207687_101311362 274
170 3300025928 Ga0207700_10040023 Ga0207700_100400233 274
171 3300025928 Ga0207700_10236735 Ga0207700_102367351 274
172 3300025928 Ga0207700_10411029 Ga0207700_104110291 274
173 3300025928 Ga0207700_10645700 Ga0207700_106457001 274
174 3300025931 Ga0207644_10002440 Ga0207644_100024404 274
175 3300025933 Ga0207706_10040916 Ga0207706_100409165 274
176 3300025960 Ga0207651_10235052 Ga0207651_102350521 274
177 3300025986 Ga0207658_10186472 Ga0207658_101864722 274
178 3300026088 Ga0207641_10419428 Ga0207641_104194281 274
179 3300026118 Ga0207675_100051965 Ga0207675_1000519653 274
180 3300027907 Ga0207428_10145827 Ga0207428_101458271 274
181 3300028800 Ga0265338_10021310 Ga0265338_100213106 274
182 3300028800 Ga0265338_10291695 Ga0265338_102916951 274
183 3300030763 Ga0265763_1000067 Ga0265763_10000672 274
184 3300030878 Ga0265770_1011232 Ga0265770_10112321 274
185 3300031018 Ga0265773_1001569 Ga0265773_10015691 274
186 3300031090 Ga0265760_10028160 Ga0265760_100281602 274
187 3300031235 Ga0265330_10080093 Ga0265330_100800931 274
188 3300031247 Ga0265340_10071430 Ga0265340_100714301 274
189 3300031247 Ga0265340_10084100 Ga0265340_100841002 274
190 3300031249 Ga0265339_10000069 Ga0265339_1000006955 274
191 3300031595 Ga0265313_10000386 Ga0265313_1000038624 274
192 3300031712 Ga0265342_10015294 Ga0265342_100152947 274
193 3300035118 Ga0373954_0004128 Ga0373954_0004128_2357_3220 274
194 3300035120 Ga0373957_0106097 Ga0373957_0106097_48_911 274
195 3300035172 Ga0373955_0002080 Ga0373955_0002080_6310_7173 274
196 3300035172 Ga0373955_0114990 Ga0373955_0114990_83_910 274
197 3300035691 Ga0373931_0100776 Ga0373931_0100776_146_973 274
198 3300035695 Ga0373927_0006235 Ga0373927_0006235_1777_2640 274
199 3300035724 Ga0373933_0008964 Ga0373933_0008964_320_1183 274
200 3300036401 Ga0373937_0017696 Ga0373937_0017696_49_912 274
201 3300036401 Ga0373937_0019279 Ga0373937_0019279_3147_3974 274
202 3300036401 Ga0373937_0185936 Ga0373937_0185936_596_1423 274
203 3300036647 Ga0316582_0048559 Ga0316582_0048559_595_1560 274
204 3300037068 Ga0373925_0080099 Ga0373925_0080099_124_987 274
205 3300037068 Ga0373925_0408333 Ga0373925_0408333_16_843 274
206 3300037853 Ga0436364_1053992 Ga0436364_1053992_38_865 274
207 3300039437 Ga0436365_0139851 Ga0436365_0139851_4115_4993 274
208 3300039437 Ga0436365_0371645 Ga0436365_0371645_377_1204 274
209 3300039450 Ga0436363_1472785 Ga0436363_1472785_497_1324 274
210 3300044694 Ga0466963_0405721 Ga0466963_0405721_86_913 274
211 3300044842 Ga0466957_0057879 Ga0466957_0057879_1529_2356 274
212 3300045049 Ga0466959_0088909 Ga0466959_0088909_1001_1828 274
213 3300045836 Ga0466958_0025519 Ga0466958_0025519_1244_2071 274
214 3300045976 Ga0466967_0337384 Ga0466967_0337384_395_1423 274
215 3300046454 Ga0495592_0085127 Ga0495592_0085127_203_1030 274
216 3300046455 Ga0495603_0255091 Ga0495603_0255091_114_977 274
217 3300046462 Ga0495651_0000611 Ga0495651_0000611_3456_4319 274
218 3300046463 Ga0495653_0005332 Ga0495653_0005332_3970_4833 274
219 3300046471 Ga0495650_0074939 Ga0495650_0074939_339_1193 274
220 3300046511 Ga0495608_0007468 Ga0495608_0007468_2319_3182 274
221 3300046511 Ga0495608_0158045 Ga0495608_0158045_452_1279 274
222 3300046514 Ga0495618_0001167 Ga0495618_0001167_4534_5397 274
223 3300046516 Ga0495628_0134746 Ga0495628_0134746_834_1661 274
224 3300046517 Ga0495630_0071378 Ga0495630_0071378_1103_1966 274
225 3300046529 Ga0495652_0004200 Ga0495652_0004200_6607_7470 274
226 3300046529 Ga0495652_0195963 Ga0495652_0195963_511_1338 274
227 3300046533 Ga0495640_0008281 Ga0495640_0008281_5060_5923 274
228 3300046536 Ga0495587_0000782 Ga0495587_0000782_13066_13929 274
229 3300046543 Ga0495645_0029128 Ga0495645_0029128_3120_3983 274
230 3300046559 Ga0495667_0012543 Ga0495667_0012543_2099_2962 274
231 3300046559 Ga0495667_0082272 Ga0495667_0082272_335_1162 274
232 3300046615 Ga0495656_0012170 Ga0495656_0012170_1582_2421 274
233 3300046642 Ga0495634_0071972 Ga0495634_0071972_852_1736 274
234 3300046675 Ga0495657_0015390 Ga0495657_0015390_3432_4295 274
235 3300046679 Ga0495623_0004022 Ga0495623_0004022_357_1220 274
236 3300046680 Ga0495646_0002775 Ga0495646_0002775_7078_7941 274
237 3300046809 Ga0495600_0054587 Ga0495600_0054587_679_1542 274
238 3300047317 Ga0495604_0000791 Ga0495604_0000791_19098_19961 274
239 3300047317 Ga0495604_0057415 Ga0495604_0057415_134_961 274
240 3300047319 Ga0495674_0000747 Ga0495674_0000747_24471_25334 274
241 3300047320 Ga0495672_0009692 Ga0495672_0009692_2366_3193 274
242 3300047320 Ga0495672_0048283 Ga0495672_0048283_744_1571 274
243 3300047322 Ga0495680_0106263 Ga0495680_0106263_612_1439 274
244 3300047444 Ga0495675_0017181 Ga0495675_0017181_3203_4066 274
245 3300047444 Ga0495675_0111646 Ga0495675_0111646_680_1507 274
246 3300048088 Ga0495602_0006011 Ga0495602_0006011_7234_8097 274
247 3300048090 Ga0495615_0038136 Ga0495615_0038136_207_1031 274
248 3300048903 Ga0496100_0023354 Ga0496100_0023354_361_1200 274
249 3300048904 Ga0496101_0048513 Ga0496101_0048513_1716_2543 274
250 3300048907 Ga0496104_0141451 Ga0496104_0141451_565_1404 274
251 3300048907 Ga0496104_0366861 Ga0496104_0366861_171_998 274
252 3300048908 Ga0496105_0176454 Ga0496105_0176454_633_1460 274
253 3300048912 Ga0496109_0108281 Ga0496109_0108281_487_1326 274
254 3300048912 Ga0496109_0481946 Ga0496109_0481946_169_996 274
255 3300048913 Ga0496110_0153421 Ga0496110_0153421_1047_1886 274
256 3300048913 Ga0496110_0250211 Ga0496110_0250211_318_1145 274
257 3300048917 Ga0496114_0024541 Ga0496114_0024541_4069_4896 274
258 3300048929 Ga0496126_0385304 Ga0496126_0385304_182_1009 274
259 3300049571 Ga0501034_0132315 Ga0501034_0132315_361_1188 274
260 3300049574 Ga0501038_0022920 Ga0501038_0022920_465_1292 274
261 3300049581 Ga0501047_0156691 Ga0501047_0156691_659_1486 274
262 3300049586 Ga0501070_0073675 Ga0501070_0073675_237_1064 274
263 3300049823 Ga0501044_0169363 Ga0501044_0169363_1225_2052 274
264 3300050490 nmdc:mga03n38_32897_c1 nmdc:mga03n38_32897_c1_1224_2078 274
265 3300050490 nmdc:mga03n38_51277_c1 nmdc:mga03n38_51277_c1_241_1095 274
266 3300050507 nmdc:mga05p37_49845_c1 nmdc:mga05p37_49845_c1_2316_3155 274
267 3300050508 nmdc:mga09592_24772_c1 nmdc:mga09592_24772_c1_993_1832 274
268 3300050511 nmdc:mga08y16_54579_c1 nmdc:mga08y16_54579_c1_2799_3626 274
269 3300050512 nmdc:mga0n895_10223_c1 nmdc:mga0n895_10223_c1_4096_4923 274
270 3300050513 nmdc:mga0rr50_78989_c1 nmdc:mga0rr50_78989_c1_1037_1864 274
271 3300050515 nmdc:mga0a205_12662_c1 nmdc:mga0a205_12662_c1_5839_6666 274
272 3300053077 Ga0495601_0008933 Ga0495601_0008933_2449_3312 274
273 3300053077 Ga0495601_0227772 Ga0495601_0227772_279_1184 274
274 3300053078 Ga0495612_0038918 Ga0495612_0038918_216_1043 274
275 3300053084 Ga0495595_0000412 Ga0495595_0000412_11955_12818 274
276 3300053084 Ga0495595_0028878 Ga0495595_0028878_922_1749 274
277 3300053085 Ga0495619_0000406 Ga0495619_0000406_5959_6822 274
278 3300053085 Ga0495619_0033950 Ga0495619_0033950_63_890 274
279 3300061719 Ga0466962_0136578 Ga0466962_0136578_207_1034 274
280 3300001979 JGI24740J21852_10002895 JGI24740J21852_100028956 275
281 3300003203 JGI25406J46586_10012002 JGI25406J46586_100120021 275
282 3300003215 JGI25153J46596_10004990 JGI25153J46596_100049905 275
283 3300003322 rootL2_10016153 rootL2_100161531 275
284 3300003659 JGI25404J52841_10002162 JGI25404J52841_100021622 275
285 3300003659 JGI25404J52841_10027263 JGI25404J52841_100272631 275
286 3300003771 Ga0055526_1012658 Ga0055526_10126585 275
287 3300005262 Ga0065165_1004236 Ga0065165_10042369 275
288 3300005334 Ga0068869_100238669 Ga0068869_1002386692 275
289 3300005335 Ga0070666_10096046 Ga0070666_100960462 275
290 3300005336 Ga0070680_100047174 Ga0070680_1000471742 275
291 3300005337 Ga0070682_100141865 Ga0070682_1001418652 275
292 3300005338 Ga0068868_100051453 Ga0068868_1000514533 275
293 3300005338 Ga0068868_100569111 Ga0068868_1005691111 275
294 3300005344 Ga0070661_100322414 Ga0070661_1003224142 275
295 3300005347 Ga0070668_100124800 Ga0070668_1001248002 275
296 3300005355 Ga0070671_100084238 Ga0070671_1000842384 275
297 3300005355 Ga0070671_100119344 Ga0070671_1001193442 275
298 3300005365 Ga0070688_100018386 Ga0070688_1000183862 275
299 3300005367 Ga0070667_100015594 Ga0070667_1000155945 275
300 3300005367 Ga0070667_100334955 Ga0070667_1003349551 275
301 3300005434 Ga0070709_10001198 Ga0070709_1000119810 275
302 3300005434 Ga0070709_10004329 Ga0070709_100043291 275
303 3300005435 Ga0070714_100002945 Ga0070714_1000029452 275
304 3300005435 Ga0070714_100133409 Ga0070714_1001334092 275
305 3300005436 Ga0070713_100001195 Ga0070713_10000119510 275
306 3300005436 Ga0070713_100091681 Ga0070713_1000916811 275
307 3300005437 Ga0070710_10000251 Ga0070710_1000025114 275
308 3300005437 Ga0070710_10001221 Ga0070710_100012218 275
309 3300005437 Ga0070710_10004644 Ga0070710_100046448 275
310 3300005439 Ga0070711_100000261 Ga0070711_10000026111 275
311 3300005439 Ga0070711_100028842 Ga0070711_1000288424 275
312 3300005439 Ga0070711_100035906 Ga0070711_1000359065 275
313 3300005444 Ga0070694_100418163 Ga0070694_1004181632 275
314 3300005455 Ga0070663_100066364 Ga0070663_1000663644 275
315 3300005456 Ga0070678_100025543 Ga0070678_1000255432 275
316 3300005457 Ga0070662_100373026 Ga0070662_1003730261 275
317 3300005458 Ga0070681_10009972 Ga0070681_1000997210 275
318 3300005530 Ga0070679_100292177 Ga0070679_1002921772 275
319 3300005539 Ga0068853_100017070 Ga0068853_1000170702 275
320 3300005539 Ga0068853_100074050 Ga0068853_1000740503 275
321 3300005545 Ga0070695_100230768 Ga0070695_1002307682 275
322 3300005548 Ga0070665_100005977 Ga0070665_1000059774 275
323 3300005549 Ga0070704_100103918 Ga0070704_1001039182 275
324 3300005563 Ga0068855_100091543 Ga0068855_1000915436 275
325 3300005563 Ga0068855_100496949 Ga0068855_1004969491 275
326 3300005564 Ga0070664_100082142 Ga0070664_1000821423 275
327 3300005564 Ga0070664_100343440 Ga0070664_1003434402 275
328 3300005577 Ga0068857_100005672 Ga0068857_10000567210 275
329 3300005578 Ga0068854_100046209 Ga0068854_1000462095 275
330 3300005614 Ga0068856_100001074 Ga0068856_10000107418 275
331 3300005614 Ga0068856_100005315 Ga0068856_1000053157 275
332 3300005614 Ga0068856_100586866 Ga0068856_1005868661 275
333 3300005615 Ga0070702_100146009 Ga0070702_1001460092 275
334 3300005616 Ga0068852_100048008 Ga0068852_1000480082 275
335 3300005616 Ga0068852_100293259 Ga0068852_1002932592 275
336 3300005617 Ga0068859_100142164 Ga0068859_1001421643 275
337 3300005617 Ga0068859_100350704 Ga0068859_1003507042 275
338 3300005834 Ga0068851_10000772 Ga0068851_100007728 275
339 3300005841 Ga0068863_100134289 Ga0068863_1001342891 275
340 3300005842 Ga0068858_100124907 Ga0068858_1001249072 275
341 3300005843 Ga0068860_100000610 Ga0068860_10000061038 275
342 3300005843 Ga0068860_100083762 Ga0068860_1000837621 275
343 3300005937 Ga0081455_10013694 Ga0081455_100136945 275
344 3300005937 Ga0081455_10016360 Ga0081455_100163607 275
345 3300005937 Ga0081455_10051042 Ga0081455_100510422 275
346 3300005983 Ga0081540_1001726 Ga0081540_100172612 275
347 3300005983 Ga0081540_1033429 Ga0081540_10334292 275
348 3300005983 Ga0081540_1073041 Ga0081540_10730413 275
349 3300005983 Ga0081540_1114638 Ga0081540_11146381 275
350 3300005985 Ga0081539_10003011 Ga0081539_100030119 275
351 3300005985 Ga0081539_10062422 Ga0081539_100624222 275
352 3300006028 Ga0070717_10012461 Ga0070717_100124617 275
353 3300006028 Ga0070717_10124778 Ga0070717_101247782 275
354 3300006028 Ga0070717_10305060 Ga0070717_103050602 275
355 3300006038 Ga0075365_10017347 Ga0075365_100173473 275
356 3300006038 Ga0075365_10023744 Ga0075365_100237442 275
357 3300006038 Ga0075365_10040996 Ga0075365_100409963 275
358 3300006042 Ga0075368_10006574 Ga0075368_100065742 275
359 3300006042 Ga0075368_10083912 Ga0075368_100839122 275
360 3300006048 Ga0075363_100013182 Ga0075363_1000131823 275
361 3300006051 Ga0075364_10059124 Ga0075364_100591242 275
362 3300006163 Ga0070715_10002749 Ga0070715_100027496 275
363 3300006173 Ga0070716_100003853 Ga0070716_1000038538 275
364 3300006173 Ga0070716_100004368 Ga0070716_1000043686 275
365 3300006173 Ga0070716_100073098 Ga0070716_1000730982 275
366 3300006175 Ga0070712_100012355 Ga0070712_1000123557 275
367 3300006175 Ga0070712_100095099 Ga0070712_1000950993 275
368 3300006175 Ga0070712_100570819 Ga0070712_1005708191 275
369 3300006178 Ga0075367_10009327 Ga0075367_100093273 275
370 3300006186 Ga0075369_10016332 Ga0075369_100163323 275
371 3300006186 Ga0075369_10029640 Ga0075369_100296402 275
372 3300006195 Ga0075366_10110079 Ga0075366_101100792 275
373 3300006237 Ga0097621_100069735 Ga0097621_1000697353 275
374 3300006358 Ga0068871_100126048 Ga0068871_1001260482 275
375 3300006358 Ga0068871_100330879 Ga0068871_1003308792 275
376 3300006844 Ga0075428_100439556 Ga0075428_1004395562 275
377 3300006931 Ga0097620_100142154 Ga0097620_1001421543 275
378 3300006931 Ga0097620_100350717 Ga0097620_1003507172 275
379 3300006942 Ga0099824_1017410 Ga0099824_10174107 275
380 3300006943 Ga0099822_1008751 Ga0099822_10087515 275
381 3300007076 Ga0075435_100058968 Ga0075435_1000589683 275
382 3300009011 Ga0105251_10108854 Ga0105251_101088542 275
383 3300009092 Ga0105250_10010001 Ga0105250_100100013 275
384 3300009093 Ga0105240_10006068 Ga0105240_1000606816 275
385 3300009093 Ga0105240_10011879 Ga0105240_100118794 275
386 3300009093 Ga0105240_10502895 Ga0105240_105028952 275
387 3300009101 Ga0105247_10010455 Ga0105247_100104555 275
388 3300009148 Ga0105243_10109163 Ga0105243_101091631 275
389 3300009148 Ga0105243_10181622 Ga0105243_101816221 275
390 3300009174 Ga0105241_10041123 Ga0105241_100411231 275
391 3300009174 Ga0105241_10076996 Ga0105241_100769963 275
392 3300009176 Ga0105242_10249577 Ga0105242_102495773 275
393 3300009545 Ga0105237_10015706 Ga0105237_100157062 275
394 3300009545 Ga0105237_10030752 Ga0105237_100307526 275
395 3300009545 Ga0105237_10059611 Ga0105237_100596116 275
396 3300009545 Ga0105237_10476917 Ga0105237_104769171 275
397 3300009545 Ga0105237_10568216 Ga0105237_105682162 275
398 3300009551 Ga0105238_10002249 Ga0105238_1000224919 275
399 3300009551 Ga0105238_10052177 Ga0105238_100521772 275
400 3300010159 Ga0099796_10104764 Ga0099796_101047641 275
401 3300010375 Ga0105239_10012149 Ga0105239_1001214910 275
402 3300010375 Ga0105239_10051500 Ga0105239_100515004 275
403 3300010375 Ga0105239_10237530 Ga0105239_102375301 275
404 3300010375 Ga0105239_10246394 Ga0105239_102463942 275
405 3300013102 Ga0157371_10154239 Ga0157371_101542391 275
406 3300013104 Ga0157370_10021698 Ga0157370_100216987 275
407 3300013296 Ga0157374_10015682 Ga0157374_100156821 275
408 3300013297 Ga0157378_10007897 Ga0157378_100078975 275
409 3300013297 Ga0157378_10579593 Ga0157378_105795932 275
410 3300013306 Ga0163162_10041805 Ga0163162_100418055 275
411 3300013306 Ga0163162_10265255 Ga0163162_102652552 275
412 3300014325 Ga0163163_10003826 Ga0163163_1000382613 275
413 3300014325 Ga0163163_10055474 Ga0163163_100554742 275
414 3300014968 Ga0157379_10511151 Ga0157379_105111511 275
415 3300017792 Ga0163161_10282765 Ga0163161_102827651 275
416 3300021384 Ga0213876_10012814 Ga0213876_100128141 275
417 3300021384 Ga0213876_10101007 Ga0213876_101010072 275
418 3300025253 Ga0209677_100388 Ga0209677_10038820 275
419 3300025254 Ga0209148_1005144 Ga0209148_10051442 275
420 3300025261 Ga0209233_1001612 Ga0209233_10016124 275
421 3300025272 Ga0209455_1002273 Ga0209455_10022737 275
422 3300025272 Ga0209455_1006233 Ga0209455_10062333 275
423 3300025295 Ga0209564_1000477 Ga0209564_100047727 275
424 3300025295 Ga0209564_1012120 Ga0209564_10121205 275
425 3300025297 Ga0209758_1002550 Ga0209758_100255012 275
426 3300025297 Ga0209758_1005044 Ga0209758_10050442 275
427 3300025297 Ga0209758_1016059 Ga0209758_10160593 275
428 3300025302 Ga0207426_1004036 Ga0207426_10040368 275
429 3300025321 Ga0207656_10062172 Ga0207656_100621722 275
430 3300025898 Ga0207692_10000148 Ga0207692_1000014810 275
431 3300025898 Ga0207692_10000717 Ga0207692_1000071712 275
432 3300025898 Ga0207692_10005747 Ga0207692_100057474 275
433 3300025900 Ga0207710_10004963 Ga0207710_100049633 275
434 3300025906 Ga0207699_10000967 Ga0207699_1000096714 275
435 3300025906 Ga0207699_10029228 Ga0207699_100292284 275
436 3300025909 Ga0207705_10033639 Ga0207705_100336395 275
437 3300025911 Ga0207654_10000201 Ga0207654_1000020120 275
438 3300025912 Ga0207707_10016259 Ga0207707_100162594 275
439 3300025912 Ga0207707_10056283 Ga0207707_100562834 275
440 3300025913 Ga0207695_10000343 Ga0207695_1000034317 275
441 3300025913 Ga0207695_10397318 Ga0207695_103973182 275
442 3300025914 Ga0207671_10131542 Ga0207671_101315422 275
443 3300025914 Ga0207671_10286709 Ga0207671_102867091 275
444 3300025915 Ga0207693_10003226 Ga0207693_1000322614 275
445 3300025915 Ga0207693_10015330 Ga0207693_100153307 275
446 3300025915 Ga0207693_10023532 Ga0207693_100235321 275
447 3300025916 Ga0207663_10000161 Ga0207663_1000016127 275
448 3300025916 Ga0207663_10111931 Ga0207663_101119312 275
449 3300025917 Ga0207660_10017097 Ga0207660_100170974 275
450 3300025920 Ga0207649_10266439 Ga0207649_102664391 275
451 3300025922 Ga0207646_10222845 Ga0207646_102228452 275
452 3300025924 Ga0207694_10000339 Ga0207694_1000033931 275
453 3300025924 Ga0207694_10143082 Ga0207694_101430823 275
454 3300025928 Ga0207700_10004801 Ga0207700_100048019 275
455 3300025929 Ga0207664_10018907 Ga0207664_100189071 275
456 3300025933 Ga0207706_10298909 Ga0207706_102989092 275
457 3300025934 Ga0207686_10316868 Ga0207686_103168681 275
458 3300025939 Ga0207665_10000183 Ga0207665_1000018314 275
459 3300025939 Ga0207665_10006487 Ga0207665_100064879 275
460 3300025941 Ga0207711_10532489 Ga0207711_105324891 275
461 3300025942 Ga0207689_10054175 Ga0207689_100541751 275
462 3300025949 Ga0207667_10008033 Ga0207667_1000803311 275
463 3300025949 Ga0207667_10030570 Ga0207667_100305704 275
464 3300025949 Ga0207667_10308457 Ga0207667_103084572 275
465 3300025972 Ga0207668_10064056 Ga0207668_100640563 275
466 3300025972 Ga0207668_10117537 Ga0207668_101175371 275
467 3300025981 Ga0207640_10288534 Ga0207640_102885341 275
468 3300025986 Ga0207658_10024740 Ga0207658_100247403 275
469 3300026035 Ga0207703_10126684 Ga0207703_101266841 275
470 3300026035 Ga0207703_10189182 Ga0207703_101891822 275
471 3300026041 Ga0207639_10021031 Ga0207639_100210311 275
472 3300026041 Ga0207639_10447927 Ga0207639_104479271 275
473 3300026067 Ga0207678_10023778 Ga0207678_100237784 275
474 3300026067 Ga0207678_10043964 Ga0207678_100439644 275
475 3300026067 Ga0207678_10053722 Ga0207678_100537223 275
476 3300026078 Ga0207702_10000006 Ga0207702_10000006268 275
477 3300026078 Ga0207702_10000063 Ga0207702_1000006376 275
478 3300026088 Ga0207641_10139163 Ga0207641_101391632 275
479 3300026089 Ga0207648_10254601 Ga0207648_102546011 275
480 3300026116 Ga0207674_10003146 Ga0207674_100031465 275
481 3300026118 Ga0207675_100360384 Ga0207675_1003603841 275
482 3300026121 Ga0207683_10074562 Ga0207683_100745622 275
483 3300026142 Ga0207698_10525338 Ga0207698_105253381 275
484 3300027296 Ga0209389_1000034 Ga0209389_100003488 275
485 3300027357 Ga0209589_1000038 Ga0209589_100003832 275
486 3300027357 Ga0209589_1000055 Ga0209589_100005581 275
487 3300027361 Ga0209489_100023 Ga0209489_100023161 275
488 3300027361 Ga0209489_100128 Ga0209489_10012881 275
489 3300027363 Ga0209700_100137 Ga0209700_10013781 275
490 3300028379 Ga0268266_10004140 Ga0268266_100041401 275
491 3300028379 Ga0268266_10005567 Ga0268266_100055677 275
492 3300028380 Ga0268265_10479870 Ga0268265_104798701 275
493 3300028381 Ga0268264_10000194 Ga0268264_10000194109 275
494 3300028381 Ga0268264_10181007 Ga0268264_101810071 275
495 3300028381 Ga0268264_10253501 Ga0268264_102535011 275
496 3300028556 Ga0265337_1007152 Ga0265337_10071525 275
497 3300028558 Ga0265326_10003812 Ga0265326_100038125 275
498 3300028573 Ga0265334_10001143 Ga0265334_1000114311 275
499 3300028573 Ga0265334_10021025 Ga0265334_100210251 275
500 3300028577 Ga0265318_10017156 Ga0265318_100171563 275
501 3300028653 Ga0265323_10000720 Ga0265323_100007206 275
502 3300028666 Ga0265336_10000640 Ga0265336_1000064014 275
503 3300028800 Ga0265338_10001434 Ga0265338_1000143429 275
504 3300029957 Ga0265324_10001605 Ga0265324_100016056 275
505 3300030521 Ga0307511_10101061 Ga0307511_101010612 275
506 3300031507 Ga0307509_10086792 Ga0307509_100867922 275
507 3300031616 Ga0307508_10000012 Ga0307508_1000001274 275
508 3300031616 Ga0307508_10009028 Ga0307508_100090282 275
509 3300031711 Ga0265314_10007404 Ga0265314_100074043 275
510 3300031711 Ga0265314_10035570 Ga0265314_100355704 275
511 3300031712 Ga0265342_10044744 Ga0265342_100447444 275
512 3300031712 Ga0265342_10061317 Ga0265342_100613173 275
513 3300031903 Ga0307407_10102978 Ga0307407_101029782 275
514 3300031911 Ga0307412_10420942 Ga0307412_104209421 275
515 3300032002 Ga0307416_100225076 Ga0307416_1002250762 275
516 3300032005 Ga0307411_10130182 Ga0307411_101301822 275
517 3300032126 Ga0307415_100038841 Ga0307415_1000388412 275
518 3300033179 Ga0307507_10075565 Ga0307507_100755652 275
519 3300033180 Ga0307510_10084921 Ga0307510_100849213 275
520 3300035086 Ga0373934_0002654 Ga0373934_0002654_3913_4743 275
521 3300035086 Ga0373934_0080222 Ga0373934_0080222_261_1091 275
522 3300035117 Ga0373953_0004142 Ga0373953_0004142_3240_4070 275
523 3300035118 Ga0373954_0013878 Ga0373954_0013878_1234_2064 275
524 3300035119 Ga0373956_0002781 Ga0373956_0002781_2410_3240 275
525 3300035410 Ga0373924_0018232 Ga0373924_0018232_648_1478 275
526 3300035695 Ga0373927_0040216 Ga0373927_0040216_729_1556 275
527 3300035724 Ga0373933_0000105 Ga0373933_0000105_40277_41104 275
528 3300035724 Ga0373933_0014901 Ga0373933_0014901_1237_2067 275
529 3300035725 Ga0373947_0200879 Ga0373947_0200879_338_1165 275
530 3300037068 Ga0373925_0010972 Ga0373925_0010972_1381_2211 275
531 3300037466 Ga0395898_0072855 Ga0395898_0072855_924_1751 275
532 3300039438 Ga0436360_0366032 Ga0436360_0366032_85_933 275
533 3300039447 Ga0436361_1152014 Ga0436361_1152014_2812_3660 275
534 3300039453 Ga0436362_0421234 Ga0436362_0421234_3133_3960 275
535 3300041463 Ga0451804_1168769 Ga0451804_1168769_116_943 275
536 3300044683 Ga0466965_0020681 Ga0466965_0020681_1293_2123 275
537 3300044684 Ga0466966_0314994 Ga0466966_0314994_57_884 275
538 3300044842 Ga0466957_0159583 Ga0466957_0159583_96_929 275
539 3300044901 Ga0466960_0031793 Ga0466960_0031793_854_1681 275
540 3300045049 Ga0466959_0049008 Ga0466959_0049008_1898_2731 275
541 3300046454 Ga0495592_0141675 Ga0495592_0141675_744_1574 275
542 3300046455 Ga0495603_0040327 Ga0495603_0040327_1115_1942 275
543 3300046459 Ga0495629_0000331 Ga0495629_0000331_37019_37849 275
544 3300046459 Ga0495629_0046328 Ga0495629_0046328_1061_1888 275
545 3300046473 Ga0495582_0032041 Ga0495582_0032041_1449_2276 275
546 3300046474 Ga0495605_0034972 Ga0495605_0034972_1165_1992 275
547 3300046475 Ga0495639_0037730 Ga0495639_0037730_1239_2090 275
548 3300046475 Ga0495639_0045535 Ga0495639_0045535_872_1699 275
549 3300046507 Ga0495606_0151446 Ga0495606_0151446_104_931 275
550 3300046507 Ga0495606_0198747 Ga0495606_0198747_82_933 275
551 3300046507 Ga0495606_0286225 Ga0495606_0286225_57_884 275
552 3300046511 Ga0495608_0000988 Ga0495608_0000988_11806_12636 275
553 3300046516 Ga0495628_0059720 Ga0495628_0059720_794_1624 275
554 3300046524 Ga0495648_0009857 Ga0495648_0009857_4713_5540 275
555 3300046524 Ga0495648_0172523 Ga0495648_0172523_205_1059 275
556 3300046529 Ga0495652_0031734 Ga0495652_0031734_1338_2168 275
557 3300046533 Ga0495640_0008206 Ga0495640_0008206_1235_2065 275
558 3300046536 Ga0495587_0219407 Ga0495587_0219407_98_928 275
559 3300046538 Ga0495609_0070370 Ga0495609_0070370_417_1244 275
560 3300046557 Ga0495622_0005907 Ga0495622_0005907_2155_2982 275
561 3300046557 Ga0495622_0060262 Ga0495622_0060262_537_1364 275
562 3300046616 Ga0495668_0006816 Ga0495668_0006816_424_1275 275
563 3300046616 Ga0495668_0035267 Ga0495668_0035267_1455_2306 275
564 3300046642 Ga0495634_0027762 Ga0495634_0027762_1858_2688 275
565 3300046648 Ga0495611_0047658 Ga0495611_0047658_165_992 275
566 3300046663 Ga0495635_0024756 Ga0495635_0024756_674_1504 275
567 3300046663 Ga0495635_0339139 Ga0495635_0339139_38_865 275
568 3300046665 Ga0495661_0120753 Ga0495661_0120753_342_1169 275
569 3300046675 Ga0495657_0006539 Ga0495657_0006539_7733_8563 275
570 3300046678 Ga0495599_0003332 Ga0495599_0003332_1989_2819 275
571 3300046680 Ga0495646_0004946 Ga0495646_0004946_2503_3333 275
572 3300046689 Ga0495613_0007833 Ga0495613_0007833_112_942 275
573 3300046692 Ga0495671_0047958 Ga0495671_0047958_359_1186 275
574 3300046794 Ga0495589_0107047 Ga0495589_0107047_88_915 275
575 3300046809 Ga0495600_0036905 Ga0495600_0036905_98_928 275
576 3300047315 Ga0495581_0040360 Ga0495581_0040360_623_1450 275
577 3300047315 Ga0495581_0111765 Ga0495581_0111765_721_1572 275
578 3300047317 Ga0495604_0006191 Ga0495604_0006191_2680_3510 275
579 3300047319 Ga0495674_0016373 Ga0495674_0016373_2573_3403 275
580 3300047320 Ga0495672_0009045 Ga0495672_0009045_2327_3154 275
581 3300047320 Ga0495672_0118382 Ga0495672_0118382_390_1217 275
582 3300047322 Ga0495680_0132694 Ga0495680_0132694_901_1731 275
583 3300047444 Ga0495675_0019152 Ga0495675_0019152_552_1382 275
584 3300047471 Ga0495684_0000842 Ga0495684_0000842_5803_6633 275
585 3300047472 Ga0495686_0021671 Ga0495686_0021671_384_1211 275
586 3300047472 Ga0495686_0057319 Ga0495686_0057319_952_1803 275
587 3300048090 Ga0495615_0023597 Ga0495615_0023597_41_868 275
588 3300048091 Ga0495626_0116380 Ga0495626_0116380_93_947 275
589 3300048903 Ga0496100_0218220 Ga0496100_0218220_418_1245 275
590 3300048904 Ga0496101_0022046 Ga0496101_0022046_2312_3139 275
591 3300048904 Ga0496101_0430546 Ga0496101_0430546_20_847 275
592 3300048907 Ga0496104_0111787 Ga0496104_0111787_104_931 275
593 3300048908 Ga0496105_0043187 Ga0496105_0043187_514_1341 275
594 3300048909 Ga0496106_0034635 Ga0496106_0034635_554_1381 275
595 3300048909 Ga0496106_0042512 Ga0496106_0042512_111_941 275
596 3300048910 Ga0496107_0044647 Ga0496107_0044647_40_867 275
597 3300048911 Ga0496108_0103965 Ga0496108_0103965_1260_2087 275
598 3300048912 Ga0496109_0084633 Ga0496109_0084633_801_1628 275
599 3300048915 Ga0496112_0010997 Ga0496112_0010997_5068_5895 275
600 3300048916 Ga0496113_0024839 Ga0496113_0024839_2811_3638 275
601 3300048918 Ga0496115_0047577 Ga0496115_0047577_105_932 275
602 3300048919 Ga0496116_0025104 Ga0496116_0025104_2200_3027 275
603 3300048919 Ga0496116_0166567 Ga0496116_0166567_175_1029 275
604 3300048920 Ga0496117_0036779 Ga0496117_0036779_773_1600 275
605 3300048920 Ga0496117_0069713 Ga0496117_0069713_387_1214 275
606 3300048920 Ga0496117_0121830 Ga0496117_0121830_422_1276 275
607 3300048921 Ga0496118_0008250 Ga0496118_0008250_5177_6004 275
608 3300048924 Ga0496121_0002294 Ga0496121_0002294_5341_6168 275
609 3300048924 Ga0496121_0002330 Ga0496121_0002330_14003_14830 275
610 3300048924 Ga0496121_0017911 Ga0496121_0017911_5715_6542 275
611 3300048924 Ga0496121_0042163 Ga0496121_0042163_3102_3956 275
612 3300048924 Ga0496121_0052943 Ga0496121_0052943_1601_2428 275
613 3300048924 Ga0496121_0100375 Ga0496121_0100375_686_1513 275
614 3300048924 Ga0496121_0131364 Ga0496121_0131364_218_1045 275
615 3300048927 Ga0496124_0013092 Ga0496124_0013092_1581_2408 275
616 3300048927 Ga0496124_0031907 Ga0496124_0031907_3106_3933 275
617 3300048927 Ga0496124_0111797 Ga0496124_0111797_857_1684 275
618 3300048928 Ga0496125_0001204 Ga0496125_0001204_11309_12136 275
619 3300048928 Ga0496125_0002521 Ga0496125_0002521_13158_13985 275
620 3300048928 Ga0496125_0027673 Ga0496125_0027673_3507_4361 275
621 3300048928 Ga0496125_0028221 Ga0496125_0028221_251_1105 275
622 3300048928 Ga0496125_0054342 Ga0496125_0054342_797_1624 275
623 3300048928 Ga0496125_0101045 Ga0496125_0101045_613_1440 275
624 3300048929 Ga0496126_0010565 Ga0496126_0010565_2986_3813 275
625 3300048929 Ga0496126_0014202 Ga0496126_0014202_1891_2718 275
626 3300048929 Ga0496126_0030609 Ga0496126_0030609_4023_4850 275
627 3300048929 Ga0496126_0148059 Ga0496126_0148059_227_1054 275
628 3300049581 Ga0501047_0350503 Ga0501047_0350503_139_966 275
629 3300050489 nmdc:mga03683_115673_c1 nmdc:mga03683_115673_c1_126_953 275
630 3300050491 nmdc:mga00v17_182555_c1 nmdc:mga00v17_182555_c1_302_1156 275
631 3300050492 nmdc:mga0yw44_8666_c2 nmdc:mga0yw44_8666_c2_1451_2278 275
632 3300050494 nmdc:mga06z11_70142_c1 nmdc:mga06z11_70142_c1_972_1799 275
633 3300050512 nmdc:mga0n895_276242_c1 nmdc:mga0n895_276242_c1_734_1561 275
634 3300050513 nmdc:mga0rr50_209671_c1 nmdc:mga0rr50_209671_c1_716_1543 275
635 3300050516 nmdc:mga0sz30_2760_c1 nmdc:mga0sz30_2760_c1_4245_5099 275
636 3300053077 Ga0495601_0007866 Ga0495601_0007866_781_1611 275
637 3300053080 Ga0500635_0119267 Ga0500635_0119267_50_877 275
638 3300053084 Ga0495595_0192557 Ga0495595_0192557_21_863 275
639 3300053085 Ga0495619_0002280 Ga0495619_0002280_2249_3079 275
640 3300053088 Ga0500644_0006853 Ga0500644_0006853_1248_2078 275
641 3300053093 Ga0500651_0115731 Ga0500651_0115731_505_1332 275
642 3300053094 Ga0500566_0004519 Ga0500566_0004519_4923_5750 275
643 3300053097 Ga0500648_079091 Ga0500648_079091_157_984 275
644 3300053119 Ga0500595_010825 Ga0500595_010825_2752_3579 275
645 3300053122 Ga0500608_000229 Ga0500608_000229_164_1018 275
646 3300053130 Ga0500642_0000142 Ga0500642_0000142_30747_31601 275
647 3300053136 Ga0500559_0000105 Ga0500559_0000105_2956_3810 275
648 3300053139 Ga0500568_0004562 Ga0500568_0004562_372_1238 275
649 3300053140 Ga0500573_0031154 Ga0500573_0031154_730_1557 275
650 3300053142 Ga0500577_0019409 Ga0500577_0019409_1324_2151 275
651 3300053145 Ga0500586_028805 Ga0500586_028805_162_1016 275
652 3300053148 Ga0500590_062512 Ga0500590_062512_437_1264 275
653 3300053153 Ga0500616_0000038 Ga0500616_0000038_337633_338463 275
654 3300053153 Ga0500616_0000784 Ga0500616_0000784_94_948 275
655 3300053177 Ga0500636_0002483 Ga0500636_0002483_1130_1957 275
656 3300053177 Ga0500636_0062671 Ga0500636_0062671_795_1634 275
657 3300053177 Ga0500636_0175633 Ga0500636_0175633_50_877 275
658 3300053178 Ga0500637_0104449 Ga0500637_0104449_228_1082 275
659 3300053735 Ga0500596_003794 Ga0500596_003794_1152_1979 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

156

290

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u4v-assembly1.cif.gz_A structure of a nitrate/nitrite antiporter nark in apo inward-open state 0.2665 37 193
6hco-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to estrone 3-sulfate and 5d3-fab 0.2533 45 195
7rtb-assembly1.cif.gz_R peptide-19 bound to the glucagon-like peptide-1 receptor (glp-1r) 0.2225 1 192
7lic-assembly1.cif.gz_A the structure of the insect olfactory receptor or5 from machilis hrabei 0.1825 22 194
4u4v-assembly1.cif.gz_A structure of a nitrate/nitrite antiporter nark in apo inward-open state 0.1821 37 193
ID Description Score Start End Superfamily
af_Q7JL16_30_260_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2751 12 198 1.20.1080.10
af_O46024_32_266_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2538 1 191 1.20.1080.10
af_Q7JL16_30_260_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2378 12 198 1.20.1080.10
3aocC01 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.2337 9 171 1.20.1640.10
4u9nB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.2298 17 191 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A0E4BMH1-F1-model_v4 Uncharacterized protein 0.9886 1 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A6N7H1F3-F1-model_v4 Sterol desaturase family protein 0.9877 32 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A533IPT2-F1-model_v4 deleted 0.9865 96 275
AF-A0A849ICG2-F1-model_v4 Sterol desaturase family protein 0.9814 6 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479
AF-A0A6N7H1F3-F1-model_v4 Sterol desaturase family protein 0.9797 32 275 GO:0005506
GO:0006643
GO:0008610
GO:0012505
GO:0016020
GO:0050479

Feature Viewer

pLDDT pTM Quality
93.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map