F473261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 297 | 657 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0087050|Ga0373937_0087050_421_1602 |
| Length | 393 |
| Sequence | VAADRVPLDRTAQPRTPVFEWACCSARRRGAGAPGGVFSYCLLSTTCGVQPAATTAQKEEYMMSKISSFFAFAAIAILLSAPADAQVTMRASHQFPGGKGDVRDDMVQMIAKDVGAANVGLTIQVYPGASLFKPNDQWNAIVNGQLDITLFPLDYASGKVPVFSATLMPGLIRSQDRAKRINNSPFMTDVRAEIEKHGAIVLSDAWFAGGVAAKGGCIVHPSDMKGRKLRAAGPTFAAMWESAGASIVSPPSNEIYNAFQSGVVNGTDTSLGTFQSMRLYEVTDCLTAPGNNALWFMYEPVLMSKKSFDKLNKAQQDAIIAAGKKAQAYYEGKADEVNKEAIKAFEDHKVKVVSLSDADYQAWLEVARKSSYAKFAQDVPNGQKLIDEALAVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 6 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 8 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 13 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 163 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 164 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 165 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 166 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 177 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 295 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.91 |
| Nodule | 0 |
| Rhizoplane | 3.34 |
| Rhizosphere | 95.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214911869 | 2209111006 | Bacteria | 6786 |
| 2 | ARcpr5oldR_c000029 | 3300000041 | Bacteria | 29077 |
| 3 | ARSoilYngRDRAFT_c00072 | 3300000042 | Bacteria | 16897 |
| 4 | ARcpr5yngRDRAFT_c000051 | 3300000043 | Bacteria | 18515 |
| 5 | ARSoilOldRDRAFT_c000078 | 3300000044 | Bacteria | 18538 |
| 6 | ARCol0oldRDRAFT_c00459 | 3300000045 | Bacteria | 3845 |
| 7 | ARCol0yngRDRAFT_1000056 | 3300000652 | Bacteria | 20075 |
| 8 | JGI24737J22298_10012020 | 3300001990 | Bacteria | 2827 |
| 9 | JGI25405J52794_10017317 | 3300003911 | Bacteria | 1430 |
| 10 | Ga0065717_1002104 | 3300005276 | Bacteria | 2915 |
| 11 | Ga0065716_1002476 | 3300005277 | Bacteria | 1756 |
| 12 | Ga0065704_10083802 | 3300005289 | Bacteria | 3415 |
| 13 | Ga0065715_10106453 | 3300005293 | Bacteria | 2829 |
| 14 | Ga0070658_10012028 | 3300005327 | Bacteria | 6951 |
| 15 | Ga0070658_10089225 | 3300005327 | Bacteria | 2539 |
| 16 | Ga0070658_10147435 | 3300005327 | Bacteria | 1968 |
| 17 | Ga0070676_10147513 | 3300005328 | Bacteria | 1503 |
| 18 | Ga0070683_100029663 | 3300005329 | Bacteria | 4957 |
| 19 | Ga0070683_100035510 | 3300005329 | Bacteria | 4556 |
| 20 | Ga0070683_100096539 | 3300005329 | Bacteria | 2780 |
| 21 | Ga0070680_100029424 | 3300005336 | Bacteria | 4413 |
| 22 | Ga0070680_100069612 | 3300005336 | Bacteria | 2889 |
| 23 | Ga0070680_100290154 | 3300005336 | Bacteria | 1387 |
| 24 | Ga0068868_100074621 | 3300005338 | Bacteria | 2709 |
| 25 | Ga0070660_100007264 | 3300005339 | Bacteria | 7714 |
| 26 | Ga0070660_100144635 | 3300005339 | Bacteria | 1909 |
| 27 | Ga0070691_10041412 | 3300005341 | Bacteria | 2178 |
| 28 | Ga0070661_100000534 | 3300005344 | Bacteria | 29159 |
| 29 | Ga0070661_100013055 | 3300005344 | Bacteria | 5825 |
| 30 | Ga0070692_10010043 | 3300005345 | Bacteria | 4294 |
| 31 | Ga0070692_10070074 | 3300005345 | Bacteria | 1866 |
| 32 | Ga0070669_100028908 | 3300005353 | Bacteria | 3994 |
| 33 | Ga0070675_100039583 | 3300005354 | Bacteria | 3847 |
| 34 | Ga0070688_100016727 | 3300005365 | Bacteria | 4199 |
| 35 | Ga0070688_100135663 | 3300005365 | Bacteria | 1666 |
| 36 | Ga0070659_100094240 | 3300005366 | Bacteria | 2404 |
| 37 | Ga0070667_100021395 | 3300005367 | Bacteria | 5371 |
| 38 | Ga0070667_100142260 | 3300005367 | Bacteria | 2102 |
| 39 | Ga0070703_10009780 | 3300005406 | Bacteria | 2703 |
| 40 | Ga0070709_10008931 | 3300005434 | Bacteria | 5517 |
| 41 | Ga0070709_10144689 | 3300005434 | Bacteria | 1636 |
| 42 | Ga0070714_100004852 | 3300005435 | Bacteria | 10210 |
| 43 | Ga0070714_100071605 | 3300005435 | Bacteria | 2998 |
| 44 | Ga0070714_100075499 | 3300005435 | Bacteria | 2924 |
| 45 | Ga0070714_100245884 | 3300005435 | Bacteria | 1653 |
| 46 | Ga0070713_100015251 | 3300005436 | Bacteria | 5734 |
| 47 | Ga0070713_100035154 | 3300005436 | Bacteria | 4031 |
| 48 | Ga0070713_100043614 | 3300005436 | Bacteria | 3668 |
| 49 | Ga0070713_100165511 | 3300005436 | Bacteria | 1977 |
| 50 | Ga0070713_100233619 | 3300005436 | Bacteria | 1672 |
| 51 | Ga0070710_10043415 | 3300005437 | Bacteria | 2490 |
| 52 | Ga0070710_10257431 | 3300005437 | Bacteria | 1124 |
| 53 | Ga0070711_100021985 | 3300005439 | Bacteria | 4130 |
| 54 | Ga0070711_100046980 | 3300005439 | Bacteria | 2944 |
| 55 | Ga0070711_100048137 | 3300005439 | Bacteria | 2913 |
| 56 | Ga0070694_100102197 | 3300005444 | Bacteria | 2029 |
| 57 | Ga0070663_100069216 | 3300005455 | Bacteria | 2563 |
| 58 | Ga0070681_10004821 | 3300005458 | Bacteria | 12928 |
| 59 | Ga0070681_10060239 | 3300005458 | Bacteria | 3774 |
| 60 | Ga0070681_10066993 | 3300005458 | Bacteria | 3559 |
| 61 | Ga0070681_10104672 | 3300005458 | Bacteria | 2772 |
| 62 | Ga0074259_12105788 | 3300005507 | Bacteria | 1310 |
| 63 | Ga0070699_100015846 | 3300005518 | Bacteria | 6470 |
| 64 | Ga0070679_100011066 | 3300005530 | Bacteria | 8583 |
| 65 | Ga0070679_100016685 | 3300005530 | Bacteria | 7093 |
| 66 | Ga0070679_100017604 | 3300005530 | Bacteria | 6917 |
| 67 | Ga0070679_100065636 | 3300005530 | Bacteria | 3617 |
| 68 | Ga0070679_100111202 | 3300005530 | Bacteria | 2726 |
| 69 | Ga0070679_100186321 | 3300005530 | Bacteria | 2046 |
| 70 | Ga0070684_100008632 | 3300005535 | Bacteria | 7983 |
| 71 | Ga0070684_100022129 | 3300005535 | Bacteria | 5299 |
| 72 | Ga0070684_100076053 | 3300005535 | Bacteria | 2963 |
| 73 | Ga0068853_100004769 | 3300005539 | Bacteria | 10539 |
| 74 | Ga0068853_100010929 | 3300005539 | Bacteria | 7359 |
| 75 | Ga0070672_100073562 | 3300005543 | Bacteria | 2724 |
| 76 | Ga0070672_100342037 | 3300005543 | Bacteria | 1274 |
| 77 | Ga0070686_100034533 | 3300005544 | Bacteria | 3117 |
| 78 | Ga0070695_100002680 | 3300005545 | Bacteria | 10305 |
| 79 | Ga0070696_100001722 | 3300005546 | Bacteria | 14339 |
| 80 | Ga0070696_100027300 | 3300005546 | Bacteria | 3888 |
| 81 | Ga0070696_100094394 | 3300005546 | Bacteria | 2135 |
| 82 | Ga0070704_100019446 | 3300005549 | Bacteria | 4363 |
| 83 | Ga0068855_100007766 | 3300005563 | Bacteria | 12955 |
| 84 | Ga0068855_100008252 | 3300005563 | Bacteria | 12590 |
| 85 | Ga0068855_100069930 | 3300005563 | Bacteria | 4084 |
| 86 | Ga0068855_100073898 | 3300005563 | Bacteria | 3960 |
| 87 | Ga0068855_100192890 | 3300005563 | Bacteria | 2297 |
| 88 | Ga0068855_100217464 | 3300005563 | Bacteria | 2144 |
| 89 | Ga0070664_100001929 | 3300005564 | Bacteria | 16665 |
| 90 | Ga0068857_100001319 | 3300005577 | Bacteria | 19521 |
| 91 | Ga0068857_100115620 | 3300005577 | Bacteria | 2413 |
| 92 | Ga0068857_100117321 | 3300005577 | Bacteria | 2395 |
| 93 | Ga0068857_100254726 | 3300005577 | Bacteria | 1610 |
| 94 | Ga0068854_100016881 | 3300005578 | Bacteria | 4875 |
| 95 | Ga0068854_100050830 | 3300005578 | Bacteria | 2968 |
| 96 | Ga0068854_100170336 | 3300005578 | Bacteria | 1694 |
| 97 | Ga0068856_100003061 | 3300005614 | Bacteria | 17098 |
| 98 | Ga0068856_100138006 | 3300005614 | Bacteria | 2444 |
| 99 | Ga0068856_100177033 | 3300005614 | Bacteria | 2146 |
| 100 | Ga0070702_100025455 | 3300005615 | Bacteria | 3171 |
| 101 | Ga0068852_100000554 | 3300005616 | Bacteria | 24527 |
| 102 | Ga0068852_100002959 | 3300005616 | Bacteria | 11801 |
| 103 | Ga0068852_100004557 | 3300005616 | Bacteria | 9813 |
| 104 | Ga0068852_100083301 | 3300005616 | Bacteria | 2844 |
| 105 | Ga0068852_100086236 | 3300005616 | Bacteria | 2798 |
| 106 | Ga0068852_100233337 | 3300005616 | Bacteria | 1755 |
| 107 | Ga0068859_100291001 | 3300005617 | Bacteria | 1726 |
| 108 | Ga0068861_100019068 | 3300005719 | Bacteria | 4897 |
| 109 | Ga0068851_10008121 | 3300005834 | Bacteria | 4844 |
| 110 | Ga0068863_100301324 | 3300005841 | Bacteria | 1555 |
| 111 | Ga0068858_100024666 | 3300005842 | Bacteria | 5600 |
| 112 | Ga0068858_100140765 | 3300005842 | Bacteria | 2265 |
| 113 | Ga0068860_100034634 | 3300005843 | Bacteria | 4844 |
| 114 | Ga0068862_100016334 | 3300005844 | Bacteria | 6178 |
| 115 | Ga0081455_10010000 | 3300005937 | Bacteria | 9697 |
| 116 | Ga0081540_1003907 | 3300005983 | Bacteria | 11608 |
| 117 | Ga0075365_10025911 | 3300006038 | Bacteria | 3716 |
| 118 | Ga0075364_10148885 | 3300006051 | Bacteria | 1577 |
| 119 | Ga0075432_10055282 | 3300006058 | Bacteria | 1406 |
| 120 | Ga0070715_10118308 | 3300006163 | Bacteria | 1260 |
| 121 | Ga0070712_100014927 | 3300006175 | Bacteria | 4994 |
| 122 | Ga0097621_100040496 | 3300006237 | Bacteria | 3746 |
| 123 | Ga0097621_100097801 | 3300006237 | Bacteria | 2465 |
| 124 | Ga0075370_10038270 | 3300006353 | Bacteria | 2699 |
| 125 | Ga0068871_100009241 | 3300006358 | Bacteria | 7130 |
| 126 | Ga0068871_100028870 | 3300006358 | Bacteria | 4353 |
| 127 | Ga0097620_100291019 | 3300006931 | Bacteria | 1726 |
| 128 | Ga0105240_10002585 | 3300009093 | Bacteria | 28988 |
| 129 | Ga0105240_10007789 | 3300009093 | Bacteria | 15482 |
| 130 | Ga0105240_10026466 | 3300009093 | Bacteria | 7611 |
| 131 | Ga0105240_10053422 | 3300009093 | Bacteria | 5070 |
| 132 | Ga0111539_10007739 | 3300009094 | Bacteria | 13721 |
| 133 | Ga0105245_10102254 | 3300009098 | Bacteria | 2654 |
| 134 | Ga0105247_10013648 | 3300009101 | Bacteria | 4873 |
| 135 | Ga0105247_10047888 | 3300009101 | Bacteria | 2626 |
| 136 | Ga0105243_10009481 | 3300009148 | Bacteria | 7411 |
| 137 | Ga0105241_10013737 | 3300009174 | Bacteria | 5931 |
| 138 | Ga0105241_10033974 | 3300009174 | Bacteria | 3831 |
| 139 | Ga0105242_10003746 | 3300009176 | Bacteria | 11815 |
| 140 | Ga0105248_10008602 | 3300009177 | Bacteria | 11211 |
| 141 | Ga0105237_10162124 | 3300009545 | Bacteria | 2235 |
| 142 | Ga0105238_10005650 | 3300009551 | Bacteria | 12365 |
| 143 | Ga0105238_10009355 | 3300009551 | Bacteria | 9813 |
| 144 | Ga0105238_10018906 | 3300009551 | Bacteria | 7017 |
| 145 | Ga0105238_10156841 | 3300009551 | Bacteria | 2251 |
| 146 | Ga0105238_10198599 | 3300009551 | Bacteria | 1981 |
| 147 | Ga0105238_10266416 | 3300009551 | Bacteria | 1693 |
| 148 | Ga0105249_10006636 | 3300009553 | Bacteria | 10070 |
| 149 | Ga0105246_10014859 | 3300011119 | Bacteria | 4904 |
| 150 | Ga0157315_1000484 | 3300012508 | Bacteria | 1851 |
| 151 | Ga0157373_10091002 | 3300013100 | Bacteria | 2148 |
| 152 | Ga0157373_10119000 | 3300013100 | Bacteria | 1856 |
| 153 | Ga0157371_10019442 | 3300013102 | Bacteria | 5010 |
| 154 | Ga0157371_10041023 | 3300013102 | Bacteria | 3304 |
| 155 | Ga0157371_10102975 | 3300013102 | Bacteria | 2026 |
| 156 | Ga0157370_10001270 | 3300013104 | Bacteria | 31545 |
| 157 | Ga0157370_10003871 | 3300013104 | Bacteria | 17431 |
| 158 | Ga0157370_10009975 | 3300013104 | Bacteria | 10050 |
| 159 | Ga0157370_10020607 | 3300013104 | Bacteria | 6582 |
| 160 | Ga0157370_10061699 | 3300013104 | Bacteria | 3558 |
| 161 | Ga0157370_10136016 | 3300013104 | Bacteria | 2291 |
| 162 | Ga0157370_10160929 | 3300013104 | Bacteria | 2089 |
| 163 | Ga0157370_10238178 | 3300013104 | Bacteria | 1684 |
| 164 | Ga0157369_10000895 | 3300013105 | Bacteria | 38049 |
| 165 | Ga0157369_10002601 | 3300013105 | Bacteria | 21597 |
| 166 | Ga0157369_10113846 | 3300013105 | Bacteria | 2873 |
| 167 | Ga0157369_10196083 | 3300013105 | Bacteria | 2121 |
| 168 | Ga0157369_10399800 | 3300013105 | Bacteria | 1425 |
| 169 | Ga0157374_10081300 | 3300013296 | Bacteria | 3075 |
| 170 | Ga0157374_10154841 | 3300013296 | Bacteria | 2230 |
| 171 | Ga0157378_10302397 | 3300013297 | Bacteria | 1548 |
| 172 | Ga0163162_10021249 | 3300013306 | Bacteria | 6388 |
| 173 | Ga0163162_10056217 | 3300013306 | Bacteria | 3964 |
| 174 | Ga0163162_10114262 | 3300013306 | Bacteria | 2799 |
| 175 | Ga0163162_10241467 | 3300013306 | Bacteria | 1937 |
| 176 | Ga0157372_10004580 | 3300013307 | Bacteria | 14701 |
| 177 | Ga0157372_10022454 | 3300013307 | Bacteria | 6829 |
| 178 | Ga0157372_10027347 | 3300013307 | Bacteria | 6210 |
| 179 | Ga0157372_10034933 | 3300013307 | Bacteria | 5532 |
| 180 | Ga0157372_10126363 | 3300013307 | Bacteria | 2940 |
| 181 | Ga0157372_10232687 | 3300013307 | Bacteria | 2136 |
| 182 | Ga0157375_10015977 | 3300013308 | Bacteria | 6733 |
| 183 | Ga0157375_10154689 | 3300013308 | Bacteria | 2431 |
| 184 | Ga0163163_10000757 | 3300014325 | Bacteria | 27476 |
| 185 | Ga0163163_10001222 | 3300014325 | Bacteria | 21707 |
| 186 | Ga0157380_10038881 | 3300014326 | Bacteria | 3696 |
| 187 | Ga0157377_10030644 | 3300014745 | Bacteria | 2916 |
| 188 | Ga0157377_10169037 | 3300014745 | Bacteria | 1366 |
| 189 | Ga0157379_10134030 | 3300014968 | Bacteria | 2231 |
| 190 | Ga0157379_10245781 | 3300014968 | Bacteria | 1623 |
| 191 | Ga0157376_10041184 | 3300014969 | Bacteria | 3781 |
| 192 | Ga0157376_10247744 | 3300014969 | Bacteria | 1663 |
| 193 | Ga0207666_1000343 | 3300025271 | Bacteria | 6396 |
| 194 | Ga0207697_10007410 | 3300025315 | Bacteria | 4897 |
| 195 | Ga0207656_10088259 | 3300025321 | Bacteria | 1404 |
| 196 | Ga0207692_10004582 | 3300025898 | Bacteria | 5481 |
| 197 | Ga0207688_10004300 | 3300025901 | Bacteria | 7767 |
| 198 | Ga0207680_10266326 | 3300025903 | Bacteria | 1187 |
| 199 | Ga0207647_10047471 | 3300025904 | Bacteria | 2671 |
| 200 | Ga0207699_10052120 | 3300025906 | Bacteria | 2421 |
| 201 | Ga0207645_10040159 | 3300025907 | Bacteria | 2997 |
| 202 | Ga0207705_10016504 | 3300025909 | Bacteria | 5290 |
| 203 | Ga0207705_10019680 | 3300025909 | Bacteria | 4827 |
| 204 | Ga0207705_10060216 | 3300025909 | Bacteria | 2742 |
| 205 | Ga0207705_10102758 | 3300025909 | Bacteria | 2104 |
| 206 | Ga0207654_10023112 | 3300025911 | Bacteria | 3326 |
| 207 | Ga0207654_10023523 | 3300025911 | Bacteria | 3301 |
| 208 | Ga0207654_10128529 | 3300025911 | Bacteria | 1601 |
| 209 | Ga0207707_10011542 | 3300025912 | Bacteria | 7692 |
| 210 | Ga0207707_10028062 | 3300025912 | Bacteria | 4920 |
| 211 | Ga0207707_10194815 | 3300025912 | Bacteria | 1768 |
| 212 | Ga0207707_10264712 | 3300025912 | Bacteria | 1491 |
| 213 | Ga0207707_10457711 | 3300025912 | Bacteria | 1091 |
| 214 | Ga0207695_10004433 | 3300025913 | Bacteria | 19160 |
| 215 | Ga0207695_10017259 | 3300025913 | Bacteria | 8404 |
| 216 | Ga0207695_10032370 | 3300025913 | Bacteria | 5722 |
| 217 | Ga0207695_10096789 | 3300025913 | Bacteria | 2953 |
| 218 | Ga0207695_10130049 | 3300025913 | Bacteria | 2476 |
| 219 | Ga0207671_10060402 | 3300025914 | Bacteria | 2812 |
| 220 | Ga0207693_10026873 | 3300025915 | Bacteria | 4552 |
| 221 | Ga0207663_10108042 | 3300025916 | Bacteria | 1883 |
| 222 | Ga0207660_10047796 | 3300025917 | Bacteria | 3027 |
| 223 | Ga0207660_10195634 | 3300025917 | Bacteria | 1577 |
| 224 | Ga0207660_10223221 | 3300025917 | Bacteria | 1479 |
| 225 | Ga0207662_10208455 | 3300025918 | Bacteria | 1268 |
| 226 | Ga0207657_10009889 | 3300025919 | Bacteria | 9548 |
| 227 | Ga0207657_10133464 | 3300025919 | Bacteria | 2033 |
| 228 | Ga0207657_10262520 | 3300025919 | Bacteria | 1374 |
| 229 | Ga0207649_10002364 | 3300025920 | Bacteria | 10572 |
| 230 | Ga0207649_10019384 | 3300025920 | Bacteria | 3887 |
| 231 | Ga0207649_10032953 | 3300025920 | Bacteria | 3092 |
| 232 | Ga0207652_10008705 | 3300025921 | Bacteria | 8168 |
| 233 | Ga0207652_10041447 | 3300025921 | Bacteria | 3914 |
| 234 | Ga0207652_10062760 | 3300025921 | Bacteria | 3211 |
| 235 | Ga0207652_10070843 | 3300025921 | Bacteria | 3028 |
| 236 | Ga0207652_10092261 | 3300025921 | Bacteria | 2664 |
| 237 | Ga0207646_10077035 | 3300025922 | Bacteria | 2980 |
| 238 | Ga0207681_10066864 | 3300025923 | Bacteria | 2489 |
| 239 | Ga0207681_10319148 | 3300025923 | Bacteria | 1235 |
| 240 | Ga0207694_10002378 | 3300025924 | Bacteria | 15389 |
| 241 | Ga0207694_10014709 | 3300025924 | Bacteria | 5900 |
| 242 | Ga0207694_10035460 | 3300025924 | Bacteria | 3827 |
| 243 | Ga0207694_10058866 | 3300025924 | Bacteria | 2988 |
| 244 | Ga0207694_10085831 | 3300025924 | Bacteria | 2478 |
| 245 | Ga0207659_10065689 | 3300025926 | Bacteria | 2630 |
| 246 | Ga0207687_10022697 | 3300025927 | Bacteria | 4179 |
| 247 | Ga0207687_10233088 | 3300025927 | Bacteria | 1455 |
| 248 | Ga0207700_10137977 | 3300025928 | Bacteria | 2000 |
| 249 | Ga0207700_10212529 | 3300025928 | Bacteria | 1636 |
| 250 | Ga0207664_10003344 | 3300025929 | Bacteria | 10662 |
| 251 | Ga0207664_10007925 | 3300025929 | Bacteria | 7381 |
| 252 | Ga0207664_10023865 | 3300025929 | Bacteria | 4589 |
| 253 | Ga0207690_10094227 | 3300025932 | Bacteria | 2124 |
| 254 | Ga0207690_10107839 | 3300025932 | Bacteria | 2001 |
| 255 | Ga0207690_10136275 | 3300025932 | Bacteria | 1803 |
| 256 | Ga0207706_10007810 | 3300025933 | Bacteria | 9874 |
| 257 | Ga0207686_10017403 | 3300025934 | Bacteria | 4050 |
| 258 | Ga0207686_10064900 | 3300025934 | Bacteria | 2326 |
| 259 | Ga0207686_10241750 | 3300025934 | Bacteria | 1314 |
| 260 | Ga0207709_10092973 | 3300025935 | Bacteria | 1976 |
| 261 | Ga0207665_10242423 | 3300025939 | Bacteria | 1329 |
| 262 | Ga0207711_10067338 | 3300025941 | Bacteria | 3099 |
| 263 | Ga0207711_10116633 | 3300025941 | Bacteria | 2381 |
| 264 | Ga0207661_10081182 | 3300025944 | Bacteria | 2678 |
| 265 | Ga0207661_10259003 | 3300025944 | Bacteria | 1549 |
| 266 | Ga0207667_10001311 | 3300025949 | Bacteria | 31212 |
| 267 | Ga0207667_10018592 | 3300025949 | Bacteria | 7788 |
| 268 | Ga0207667_10038687 | 3300025949 | Bacteria | 5090 |
| 269 | Ga0207667_10048328 | 3300025949 | Bacteria | 4499 |
| 270 | Ga0207667_10065695 | 3300025949 | Bacteria | 3783 |
| 271 | Ga0207667_10070130 | 3300025949 | Bacteria | 3648 |
| 272 | Ga0207667_10142924 | 3300025949 | Bacteria | 2464 |
| 273 | Ga0207667_10152458 | 3300025949 | Bacteria | 2378 |
| 274 | Ga0207668_10140812 | 3300025972 | Bacteria | 1855 |
| 275 | Ga0207640_10042585 | 3300025981 | Bacteria | 2896 |
| 276 | Ga0207640_10154434 | 3300025981 | Bacteria | 1690 |
| 277 | Ga0207658_10011174 | 3300025986 | Bacteria | 6116 |
| 278 | Ga0207658_10112167 | 3300025986 | Bacteria | 2158 |
| 279 | Ga0207703_10047022 | 3300026035 | Bacteria | 3478 |
| 280 | Ga0207703_10108888 | 3300026035 | Bacteria | 2360 |
| 281 | Ga0207703_10390416 | 3300026035 | Bacteria | 1289 |
| 282 | Ga0207639_10016878 | 3300026041 | Bacteria | 5173 |
| 283 | Ga0207639_10132234 | 3300026041 | Bacteria | 2067 |
| 284 | Ga0207639_10225641 | 3300026041 | Bacteria | 1621 |
| 285 | Ga0207678_10012696 | 3300026067 | Bacteria | 7399 |
| 286 | Ga0207708_10004283 | 3300026075 | Bacteria | 10507 |
| 287 | Ga0207702_10002277 | 3300026078 | Bacteria | 18412 |
| 288 | Ga0207702_10105381 | 3300026078 | Bacteria | 2497 |
| 289 | Ga0207641_10193239 | 3300026088 | Bacteria | 1872 |
| 290 | Ga0207674_10000039 | 3300026116 | Bacteria | 131096 |
| 291 | Ga0207674_10092964 | 3300026116 | Bacteria | 3005 |
| 292 | Ga0207674_10146800 | 3300026116 | Bacteria | 2317 |
| 293 | Ga0207675_100015653 | 3300026118 | Bacteria | 7073 |
| 294 | Ga0207698_10003989 | 3300026142 | Bacteria | 8953 |
| 295 | Ga0207698_10011251 | 3300026142 | Bacteria | 5792 |
| 296 | Ga0207698_10019968 | 3300026142 | Bacteria | 4601 |
| 297 | Ga0207698_10405485 | 3300026142 | Bacteria | 1304 |
| 298 | Ga0209966_1002877 | 3300027695 | Bacteria | 2886 |
| 299 | Ga0209998_10000758 | 3300027717 | Bacteria | 8460 |
| 300 | Ga0207428_10014000 | 3300027907 | Bacteria | 6986 |
| 301 | Ga0268264_10069274 | 3300028381 | Bacteria | 2983 |
| 302 | Ga0265338_10033308 | 3300028800 | Bacteria | 5002 |
| 303 | Ga0265338_10098428 | 3300028800 | Bacteria | 2393 |
| 304 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 305 | Ga0265325_10034833 | 3300031241 | Bacteria | 2676 |
| 306 | Ga0265325_10043495 | 3300031241 | Bacteria | 2343 |
| 307 | Ga0265325_10048228 | 3300031241 | Bacteria | 2202 |
| 308 | Ga0265325_10086133 | 3300031241 | Bacteria | 1555 |
| 309 | Ga0265340_10025334 | 3300031247 | Bacteria | 3004 |
| 310 | Ga0265339_10010467 | 3300031249 | Bacteria | 5761 |
| 311 | Ga0265316_10066828 | 3300031344 | Bacteria | 2781 |
| 312 | Ga0265313_10009264 | 3300031595 | Bacteria | 6412 |
| 313 | Ga0265313_10048143 | 3300031595 | Bacteria | 2059 |
| 314 | Ga0265314_10016876 | 3300031711 | Bacteria | 5752 |
| 315 | Ga0265342_10000182 | 3300031712 | Bacteria | 70252 |
| 316 | Ga0307405_10072929 | 3300031731 | Bacteria | 2215 |
| 317 | Ga0373930_0000532 | 3300034816 | Bacteria | 5242 |
| 318 | Ga0373948_0000419 | 3300034817 | Bacteria | 5248 |
| 319 | Ga0373950_0000167 | 3300034818 | Bacteria | 9380 |
| 320 | Ga0373958_0002350 | 3300034819 | Bacteria | 2638 |
| 321 | Ga0373938_0000028 | 3300034957 | Bacteria | 18996 |
| 322 | Ga0373928_0000334 | 3300035084 | Bacteria | 9420 |
| 323 | Ga0373929_0001866 | 3300035085 | Bacteria | 3948 |
| 324 | Ga0373934_0001517 | 3300035086 | Bacteria | 8514 |
| 325 | Ga0373934_0005199 | 3300035086 | Bacteria | 4815 |
| 326 | Ga0373934_0012356 | 3300035086 | Bacteria | 3224 |
| 327 | Ga0373934_0013164 | 3300035086 | Bacteria | 3124 |
| 328 | Ga0373949_0001620 | 3300035090 | Bacteria | 6293 |
| 329 | Ga0373951_0000666 | 3300035091 | Bacteria | 9448 |
| 330 | Ga0373952_0000851 | 3300035092 | Bacteria | 5544 |
| 331 | Ga0373923_0024586 | 3300035111 | Bacteria | 2378 |
| 332 | Ga0373923_0049411 | 3300035111 | Bacteria | 1759 |
| 333 | Ga0373932_0000749 | 3300035112 | Bacteria | 9676 |
| 334 | Ga0373936_0005568 | 3300035113 | Bacteria | 4751 |
| 335 | Ga0373939_0001838 | 3300035114 | Bacteria | 5105 |
| 336 | Ga0373939_0016499 | 3300035114 | Bacteria | 1948 |
| 337 | Ga0373941_0000671 | 3300035115 | Bacteria | 6933 |
| 338 | Ga0373941_0005651 | 3300035115 | Bacteria | 2960 |
| 339 | Ga0373945_0053045 | 3300035116 | Bacteria | 1496 |
| 340 | Ga0373945_0097102 | 3300035116 | Bacteria | 1149 |
| 341 | Ga0373953_0008219 | 3300035117 | Bacteria | 3533 |
| 342 | Ga0373953_0012296 | 3300035117 | Bacteria | 3027 |
| 343 | Ga0373953_0019942 | 3300035117 | Bacteria | 2501 |
| 344 | Ga0373954_0000002 | 3300035118 | Bacteria | 147478 |
| 345 | Ga0373954_0003738 | 3300035118 | Bacteria | 6489 |
| 346 | Ga0373954_0006044 | 3300035118 | Bacteria | 5266 |
| 347 | Ga0373954_0007284 | 3300035118 | Bacteria | 4836 |
| 348 | Ga0373954_0014031 | 3300035118 | Bacteria | 3571 |
| 349 | Ga0373956_0000945 | 3300035119 | Bacteria | 12079 |
| 350 | Ga0373956_0002179 | 3300035119 | Bacteria | 8087 |
| 351 | Ga0373956_0019484 | 3300035119 | Bacteria | 2877 |
| 352 | Ga0373956_0107005 | 3300035119 | Bacteria | 1300 |
| 353 | Ga0373957_0000339 | 3300035120 | Bacteria | 11828 |
| 354 | Ga0373957_0002968 | 3300035120 | Bacteria | 4921 |
| 355 | Ga0373957_0003036 | 3300035120 | Bacteria | 4882 |
| 356 | Ga0373957_0024413 | 3300035120 | Bacteria | 2171 |
| 357 | Ga0373960_0000599 | 3300035121 | Bacteria | 7394 |
| 358 | Ga0373955_0001962 | 3300035172 | Bacteria | 8862 |
| 359 | Ga0373955_0014629 | 3300035172 | Bacteria | 3822 |
| 360 | Ga0373955_0028909 | 3300035172 | Bacteria | 2878 |
| 361 | Ga0373955_0034110 | 3300035172 | Bacteria | 2684 |
| 362 | Ga0373955_0064377 | 3300035172 | Bacteria | 2032 |
| 363 | Ga0373955_0081179 | 3300035172 | Bacteria | 1833 |
| 364 | Ga0373942_0005239 | 3300035207 | Bacteria | 3003 |
| 365 | Ga0373961_0000433 | 3300035241 | Bacteria | 17272 |
| 366 | Ga0373962_0000881 | 3300035242 | Bacteria | 6853 |
| 367 | Ga0373924_0004417 | 3300035410 | Bacteria | 4909 |
| 368 | Ga0373924_0025366 | 3300035410 | Bacteria | 2344 |
| 369 | Ga0373924_0057243 | 3300035410 | Bacteria | 1625 |
| 370 | Ga0373924_0117377 | 3300035410 | Bacteria | 1153 |
| 371 | Ga0373935_0026607 | 3300035692 | Bacteria | 3572 |
| 372 | Ga0373935_0057754 | 3300035692 | Bacteria | 2476 |
| 373 | Ga0373935_0157622 | 3300035692 | Bacteria | 1545 |
| 374 | Ga0373935_0296636 | 3300035692 | Bacteria | 1141 |
| 375 | Ga0373927_0003675 | 3300035695 | Bacteria | 10916 |
| 376 | Ga0373927_0093708 | 3300035695 | Bacteria | 1951 |
| 377 | Ga0373927_0288887 | 3300035695 | Bacteria | 1079 |
| 378 | Ga0373933_0000890 | 3300035724 | Bacteria | 18271 |
| 379 | Ga0373933_0001687 | 3300035724 | Bacteria | 12853 |
| 380 | Ga0373933_0001764 | 3300035724 | Bacteria | 12529 |
| 381 | Ga0373933_0002111 | 3300035724 | Bacteria | 11412 |
| 382 | Ga0373933_0005461 | 3300035724 | Bacteria | 6922 |
| 383 | Ga0373933_0011582 | 3300035724 | Bacteria | 4865 |
| 384 | Ga0373933_0041104 | 3300035724 | Bacteria | 2728 |
| 385 | Ga0373933_0042536 | 3300035724 | Bacteria | 2685 |
| 386 | Ga0373947_0063299 | 3300035725 | Bacteria | 2253 |
| 387 | Ga0373947_0100781 | 3300035725 | Bacteria | 1815 |
| 388 | Ga0373947_0115514 | 3300035725 | Bacteria | 1701 |
| 389 | Ga0373947_0195698 | 3300035725 | Unclassified | 1321 |
| 390 | Ga0373947_0203572 | 3300035725 | Bacteria | 1296 |
| 391 | Ga0373937_0001304 | 3300036401 | Bacteria | 20884 |
| 392 | Ga0373937_0001794 | 3300036401 | Bacteria | 18033 |
| 393 | Ga0373937_0004227 | 3300036401 | Bacteria | 12173 |
| 394 | Ga0373937_0005332 | 3300036401 | Bacteria | 10992 |
| 395 | Ga0373937_0006421 | 3300036401 | Bacteria | 10147 |
| 396 | Ga0373937_0007322 | 3300036401 | Bacteria | 9554 |
| 397 | Ga0373937_0009035 | 3300036401 | Bacteria | 8651 |
| 398 | Ga0373937_0027575 | 3300036401 | Bacteria | 5136 |
| 399 | Ga0373937_0035972 | 3300036401 | Bacteria | 4510 |
| 400 | Ga0373937_0087050 | 3300036401 | Bacteria | 2891 |
| 401 | Ga0373937_0197854 | 3300036401 | Bacteria | 1889 |
| 402 | Ga0439465_0047164 | 3300041413 | Bacteria | 1404 |
| 403 | Ga0451853_1695856 | 3300041512 | Bacteria | 1978 |
| 404 | Ga0453684_0140242 | 3300044712 | Bacteria | 2888 |
| 405 | Ga0451576_0065472 | 3300045051 | Bacteria | 3784 |
| 406 | Ga0495617_024276 | 3300046452 | Bacteria | 2046 |
| 407 | Ga0495592_0000589 | 3300046454 | Bacteria | 25846 |
| 408 | Ga0495592_0002245 | 3300046454 | Bacteria | 13625 |
| 409 | Ga0495592_0028842 | 3300046454 | Bacteria | 4200 |
| 410 | Ga0495592_0040216 | 3300046454 | Bacteria | 3509 |
| 411 | Ga0495592_0075908 | 3300046454 | Bacteria | 2440 |
| 412 | Ga0495603_0020971 | 3300046455 | Bacteria | 3957 |
| 413 | Ga0495629_0013396 | 3300046459 | Bacteria | 5917 |
| 414 | Ga0495651_0003925 | 3300046462 | Bacteria | 11374 |
| 415 | Ga0495651_0021054 | 3300046462 | Bacteria | 5064 |
| 416 | Ga0495651_0031350 | 3300046462 | Bacteria | 4145 |
| 417 | Ga0495651_0037541 | 3300046462 | Bacteria | 3772 |
| 418 | Ga0495651_0050023 | 3300046462 | Bacteria | 3225 |
| 419 | Ga0495651_0115579 | 3300046462 | Bacteria | 1978 |
| 420 | Ga0495651_0118498 | 3300046462 | Bacteria | 1948 |
| 421 | Ga0495653_0001655 | 3300046463 | Bacteria | 17515 |
| 422 | Ga0495653_0004752 | 3300046463 | Bacteria | 10998 |
| 423 | Ga0495653_0059041 | 3300046463 | Bacteria | 2913 |
| 424 | Ga0495653_0061026 | 3300046463 | Bacteria | 2854 |
| 425 | Ga0495580_0050116 | 3300046472 | Bacteria | 2953 |
| 426 | Ga0495582_0083300 | 3300046473 | Bacteria | 1777 |
| 427 | Ga0495639_0007311 | 3300046475 | Bacteria | 4737 |
| 428 | Ga0495662_0032507 | 3300046476 | Bacteria | 2520 |
| 429 | Ga0495664_0005496 | 3300046477 | Bacteria | 6958 |
| 430 | Ga0495664_0151611 | 3300046477 | Bacteria | 1406 |
| 431 | Ga0495585_0008414 | 3300046492 | Bacteria | 6254 |
| 432 | Ga0495594_0127852 | 3300046499 | Bacteria | 1438 |
| 433 | Ga0495583_0083296 | 3300046506 | Unclassified | 1387 |
| 434 | Ga0495608_0001793 | 3300046511 | Bacteria | 15332 |
| 435 | Ga0495608_0001817 | 3300046511 | Bacteria | 15244 |
| 436 | Ga0495608_0005922 | 3300046511 | Bacteria | 8694 |
| 437 | Ga0495608_0021073 | 3300046511 | Bacteria | 4476 |
| 438 | Ga0495608_0044062 | 3300046511 | Bacteria | 2979 |
| 439 | Ga0495608_0072761 | 3300046511 | Bacteria | 2242 |
| 440 | Ga0495608_0084732 | 3300046511 | Bacteria | 2055 |
| 441 | Ga0495618_0008159 | 3300046514 | Bacteria | 6345 |
| 442 | Ga0495618_0018196 | 3300046514 | Bacteria | 4314 |
| 443 | Ga0495618_0072351 | 3300046514 | Bacteria | 2194 |
| 444 | Ga0495618_0157805 | 3300046514 | Bacteria | 1447 |
| 445 | Ga0495628_0004889 | 3300046516 | Bacteria | 11794 |
| 446 | Ga0495628_0009824 | 3300046516 | Bacteria | 8149 |
| 447 | Ga0495628_0014727 | 3300046516 | Bacteria | 6547 |
| 448 | Ga0495628_0159097 | 3300046516 | Bacteria | 1717 |
| 449 | Ga0495630_0027998 | 3300046517 | Bacteria | 4187 |
| 450 | Ga0495630_0041594 | 3300046517 | Bacteria | 3432 |
| 451 | Ga0495630_0122574 | 3300046517 | Bacteria | 1972 |
| 452 | Ga0495630_0134107 | 3300046517 | Bacteria | 1881 |
| 453 | Ga0495644_0014794 | 3300046523 | Bacteria | 2988 |
| 454 | Ga0495652_0010464 | 3300046529 | Bacteria | 8406 |
| 455 | Ga0495652_0013953 | 3300046529 | Bacteria | 7223 |
| 456 | Ga0495652_0089741 | 3300046529 | Bacteria | 2516 |
| 457 | Ga0495665_0069040 | 3300046531 | Bacteria | 1863 |
| 458 | Ga0495640_0005362 | 3300046533 | Bacteria | 10199 |
| 459 | Ga0495640_0013444 | 3300046533 | Bacteria | 6218 |
| 460 | Ga0495640_0027536 | 3300046533 | Bacteria | 4098 |
| 461 | Ga0495640_0041299 | 3300046533 | Bacteria | 3224 |
| 462 | Ga0495586_0003545 | 3300046535 | Bacteria | 8364 |
| 463 | Ga0495587_0002845 | 3300046536 | Bacteria | 11595 |
| 464 | Ga0495587_0092504 | 3300046536 | Bacteria | 1746 |
| 465 | Ga0495645_0002386 | 3300046543 | Bacteria | 12748 |
| 466 | Ga0495645_0008213 | 3300046543 | Bacteria | 7280 |
| 467 | Ga0495645_0109269 | 3300046543 | Bacteria | 1958 |
| 468 | Ga0495633_0019628 | 3300046558 | Bacteria | 3416 |
| 469 | Ga0495667_0013127 | 3300046559 | Bacteria | 5609 |
| 470 | Ga0495667_0041422 | 3300046559 | Bacteria | 3055 |
| 471 | Ga0495667_0045655 | 3300046559 | Bacteria | 2899 |
| 472 | Ga0495667_0049843 | 3300046559 | Bacteria | 2764 |
| 473 | Ga0495667_0257424 | 3300046559 | Bacteria | 1110 |
| 474 | Ga0495656_0004034 | 3300046615 | Bacteria | 4992 |
| 475 | Ga0495634_0013078 | 3300046642 | Bacteria | 6002 |
| 476 | Ga0495634_0015313 | 3300046642 | Bacteria | 5513 |
| 477 | Ga0495634_0023688 | 3300046642 | Bacteria | 4313 |
| 478 | Ga0495634_0047376 | 3300046642 | Bacteria | 2897 |
| 479 | Ga0495634_0067106 | 3300046642 | Bacteria | 2373 |
| 480 | Ga0495635_0002748 | 3300046663 | Bacteria | 12065 |
| 481 | Ga0495635_0004972 | 3300046663 | Bacteria | 9257 |
| 482 | Ga0495635_0026001 | 3300046663 | Bacteria | 4076 |
| 483 | Ga0495635_0038825 | 3300046663 | Bacteria | 3296 |
| 484 | Ga0495659_0007696 | 3300046664 | Bacteria | 3415 |
| 485 | Ga0495657_0001218 | 3300046675 | Bacteria | 22573 |
| 486 | Ga0495657_0019008 | 3300046675 | Bacteria | 4964 |
| 487 | Ga0495657_0058481 | 3300046675 | Bacteria | 2560 |
| 488 | Ga0495657_0156584 | 3300046675 | Bacteria | 1411 |
| 489 | Ga0495599_0000531 | 3300046678 | Bacteria | 21912 |
| 490 | Ga0495599_0000970 | 3300046678 | Bacteria | 16055 |
| 491 | Ga0495599_0007730 | 3300046678 | Bacteria | 6528 |
| 492 | Ga0495599_0009604 | 3300046678 | Bacteria | 5919 |
| 493 | Ga0495599_0017496 | 3300046678 | Bacteria | 4456 |
| 494 | Ga0495599_0024588 | 3300046678 | Bacteria | 3766 |
| 495 | Ga0495623_0000758 | 3300046679 | Bacteria | 21662 |
| 496 | Ga0495623_0004324 | 3300046679 | Bacteria | 9345 |
| 497 | Ga0495623_0050543 | 3300046679 | Bacteria | 2632 |
| 498 | Ga0495623_0104799 | 3300046679 | Bacteria | 1719 |
| 499 | Ga0495646_0000300 | 3300046680 | Bacteria | 25296 |
| 500 | Ga0495646_0048164 | 3300046680 | Bacteria | 2591 |
| 501 | Ga0495647_0003976 | 3300046681 | Bacteria | 4771 |
| 502 | Ga0495658_0087110 | 3300046683 | Bacteria | 1844 |
| 503 | Ga0495613_0035336 | 3300046689 | Bacteria | 3709 |
| 504 | Ga0495624_0168486 | 3300046690 | Bacteria | 1336 |
| 505 | Ga0495670_0001321 | 3300046691 | Bacteria | 12084 |
| 506 | Ga0495600_0017662 | 3300046809 | Bacteria | 4539 |
| 507 | Ga0495600_0019250 | 3300046809 | Bacteria | 4358 |
| 508 | Ga0495600_0064413 | 3300046809 | Bacteria | 2396 |
| 509 | Ga0495600_0087418 | 3300046809 | Bacteria | 2033 |
| 510 | Ga0495604_0001425 | 3300047317 | Bacteria | 19626 |
| 511 | Ga0495604_0015363 | 3300047317 | Bacteria | 6109 |
| 512 | Ga0495604_0024413 | 3300047317 | Bacteria | 4823 |
| 513 | Ga0495674_0005874 | 3300047319 | Bacteria | 11776 |
| 514 | Ga0495674_0037354 | 3300047319 | Bacteria | 4364 |
| 515 | Ga0495674_0054172 | 3300047319 | Bacteria | 3523 |
| 516 | Ga0495674_0055682 | 3300047319 | Bacteria | 3467 |
| 517 | Ga0495674_0069114 | 3300047319 | Bacteria | 3055 |
| 518 | Ga0495680_0002651 | 3300047322 | Bacteria | 18113 |
| 519 | Ga0495680_0007953 | 3300047322 | Bacteria | 9672 |
| 520 | Ga0495680_0009557 | 3300047322 | Bacteria | 8711 |
| 521 | Ga0495680_0016011 | 3300047322 | Bacteria | 6451 |
| 522 | Ga0495680_0036732 | 3300047322 | Bacteria | 3930 |
| 523 | Ga0495680_0057461 | 3300047322 | Bacteria | 3009 |
| 524 | Ga0495680_0125557 | 3300047322 | Bacteria | 1890 |
| 525 | Ga0495675_0001056 | 3300047444 | Bacteria | 16742 |
| 526 | Ga0495675_0018474 | 3300047444 | Bacteria | 4425 |
| 527 | Ga0495675_0021903 | 3300047444 | Bacteria | 4071 |
| 528 | Ga0495684_0006100 | 3300047471 | Bacteria | 9377 |
| 529 | Ga0495684_0019131 | 3300047471 | Bacteria | 5272 |
| 530 | Ga0495684_0048498 | 3300047471 | Bacteria | 3247 |
| 531 | Ga0495684_0097874 | 3300047471 | Bacteria | 2219 |
| 532 | Ga0495684_0112796 | 3300047471 | Bacteria | 2050 |
| 533 | Ga0495684_0116479 | 3300047471 | Bacteria | 2014 |
| 534 | Ga0495593_0009724 | 3300047673 | Bacteria | 5579 |
| 535 | Ga0495602_0003273 | 3300048088 | Bacteria | 16731 |
| 536 | Ga0495602_0017308 | 3300048088 | Bacteria | 7227 |
| 537 | Ga0495602_0037956 | 3300048088 | Bacteria | 4461 |
| 538 | Ga0496101_0195827 | 3300048904 | Bacteria | 1561 |
| 539 | Ga0496102_0210499 | 3300048905 | Bacteria | 1833 |
| 540 | Ga0496103_0081016 | 3300048906 | Bacteria | 2042 |
| 541 | Ga0496104_0000515 | 3300048907 | Bacteria | 33122 |
| 542 | Ga0496104_0067549 | 3300048907 | Bacteria | 3396 |
| 543 | Ga0496104_0080380 | 3300048907 | Bacteria | 3108 |
| 544 | Ga0496105_0244461 | 3300048908 | Bacteria | 1455 |
| 545 | Ga0496106_0015310 | 3300048909 | Bacteria | 5674 |
| 546 | Ga0496106_0158605 | 3300048909 | Bacteria | 1788 |
| 547 | Ga0496107_0015088 | 3300048910 | Bacteria | 5413 |
| 548 | Ga0496107_0090827 | 3300048910 | Bacteria | 2231 |
| 549 | Ga0496108_0008991 | 3300048911 | Bacteria | 8095 |
| 550 | Ga0496109_0001064 | 3300048912 | Bacteria | 22726 |
| 551 | Ga0496109_0113508 | 3300048912 | Bacteria | 2520 |
| 552 | Ga0496110_0193022 | 3300048913 | Bacteria | 1849 |
| 553 | Ga0496111_0055737 | 3300048914 | Bacteria | 2859 |
| 554 | Ga0496111_0081328 | 3300048914 | Bacteria | 2365 |
| 555 | Ga0496111_0148541 | 3300048914 | Bacteria | 1738 |
| 556 | Ga0496112_0075018 | 3300048915 | Bacteria | 3344 |
| 557 | Ga0496113_0004800 | 3300048916 | Bacteria | 8356 |
| 558 | Ga0496115_0045598 | 3300048918 | Bacteria | 3500 |
| 559 | Ga0496115_0138609 | 3300048918 | Bacteria | 2006 |
| 560 | Ga0501031_0001427 | 3300049568 | Bacteria | 14803 |
| 561 | Ga0501032_0002436 | 3300049569 | Bacteria | 14522 |
| 562 | Ga0501032_0062303 | 3300049569 | Bacteria | 2499 |
| 563 | Ga0501033_0000244 | 3300049570 | Bacteria | 52231 |
| 564 | Ga0501033_0013241 | 3300049570 | Bacteria | 6285 |
| 565 | Ga0501034_0000159 | 3300049571 | Bacteria | 127397 |
| 566 | Ga0501034_0031979 | 3300049571 | Bacteria | 5345 |
| 567 | Ga0501034_0046375 | 3300049571 | Bacteria | 4391 |
| 568 | Ga0501034_0187526 | 3300049571 | Bacteria | 2031 |
| 569 | Ga0501036_0000039 | 3300049572 | Bacteria | 83065 |
| 570 | Ga0501036_0079493 | 3300049572 | Bacteria | 2773 |
| 571 | Ga0501037_0003835 | 3300049573 | Bacteria | 10914 |
| 572 | Ga0501038_0001751 | 3300049574 | Bacteria | 20170 |
| 573 | Ga0501038_0062161 | 3300049574 | Bacteria | 3191 |
| 574 | Ga0501038_0265310 | 3300049574 | Bacteria | 1355 |
| 575 | Ga0501039_0001324 | 3300049575 | Bacteria | 18083 |
| 576 | Ga0501039_0101558 | 3300049575 | Bacteria | 2245 |
| 577 | Ga0501042_0064050 | 3300049578 | Bacteria | 2627 |
| 578 | Ga0501043_0030468 | 3300049579 | Bacteria | 4240 |
| 579 | Ga0501046_0000185 | 3300049580 | Bacteria | 63459 |
| 580 | Ga0501047_0000385 | 3300049581 | Bacteria | 49635 |
| 581 | Ga0501047_0010053 | 3300049581 | Bacteria | 8943 |
| 582 | Ga0501047_0133021 | 3300049581 | Bacteria | 2367 |
| 583 | Ga0501047_0157297 | 3300049581 | Bacteria | 2146 |
| 584 | Ga0501047_0315416 | 3300049581 | Bacteria | 1404 |
| 585 | Ga0501048_0007283 | 3300049582 | Bacteria | 8389 |
| 586 | Ga0501048_0335808 | 3300049582 | Bacteria | 1077 |
| 587 | Ga0501067_0000513 | 3300049583 | Bacteria | 21187 |
| 588 | Ga0501068_0001337 | 3300049584 | Bacteria | 13064 |
| 589 | Ga0501068_0026119 | 3300049584 | Bacteria | 3438 |
| 590 | Ga0501069_0006089 | 3300049585 | Bacteria | 6296 |
| 591 | Ga0501069_0149490 | 3300049585 | Bacteria | 1342 |
| 592 | Ga0501070_0003256 | 3300049586 | Bacteria | 14098 |
| 593 | Ga0501070_0008612 | 3300049586 | Bacteria | 8626 |
| 594 | Ga0501070_0010383 | 3300049586 | Bacteria | 7871 |
| 595 | Ga0501070_0112369 | 3300049586 | Bacteria | 2251 |
| 596 | Ga0501072_0001656 | 3300049588 | Bacteria | 16623 |
| 597 | Ga0501072_0038222 | 3300049588 | Bacteria | 3766 |
| 598 | Ga0501072_0106012 | 3300049588 | Bacteria | 2235 |
| 599 | Ga0501073_0000374 | 3300049589 | Bacteria | 30124 |
| 600 | Ga0501073_0000702 | 3300049589 | Bacteria | 23614 |
| 601 | Ga0501073_0025314 | 3300049589 | Bacteria | 4257 |
| 602 | Ga0501073_0045790 | 3300049589 | Bacteria | 3080 |
| 603 | Ga0501073_0115244 | 3300049589 | Bacteria | 1863 |
| 604 | Ga0501074_0000125 | 3300049590 | Bacteria | 39203 |
| 605 | Ga0501074_0001567 | 3300049590 | Bacteria | 15466 |
| 606 | Ga0501074_0148255 | 3300049590 | Bacteria | 1678 |
| 607 | Ga0501079_0026149 | 3300049741 | Bacteria | 4475 |
| 608 | Ga0501079_0085132 | 3300049741 | Bacteria | 2446 |
| 609 | Ga0501080_0000380 | 3300049742 | Bacteria | 34213 |
| 610 | Ga0501080_0001529 | 3300049742 | Bacteria | 19540 |
| 611 | Ga0501080_0007162 | 3300049742 | Bacteria | 10065 |
| 612 | Ga0501080_0227275 | 3300049742 | Bacteria | 1706 |
| 613 | Ga0501080_0287175 | 3300049742 | Bacteria | 1494 |
| 614 | Ga0501083_0001646 | 3300049744 | Bacteria | 15245 |
| 615 | Ga0501083_0004058 | 3300049744 | Bacteria | 10302 |
| 616 | Ga0501083_0017169 | 3300049744 | Bacteria | 5048 |
| 617 | Ga0501035_0001985 | 3300049822 | Bacteria | 20460 |
| 618 | Ga0501035_0026028 | 3300049822 | Bacteria | 5358 |
| 619 | Ga0501035_0045442 | 3300049822 | Bacteria | 3951 |
| 620 | Ga0501035_0059100 | 3300049822 | Bacteria | 3414 |
| 621 | Ga0501035_0306211 | 3300049822 | Bacteria | 1338 |
| 622 | Ga0501044_0001993 | 3300049823 | Bacteria | 23587 |
| 623 | Ga0501044_0171954 | 3300049823 | Bacteria | 2137 |
| 624 | Ga0501044_0172377 | 3300049823 | Bacteria | 2134 |
| 625 | Ga0501044_0475538 | 3300049823 | Bacteria | 1153 |
| 626 | nmdc:mga0yw44_56609_c1 | 3300050492 | Bacteria | 2390 |
| 627 | nmdc:mga07m45_24106_c2 | 3300050496 | Bacteria | 2611 |
| 628 | nmdc:mga08y16_14377_c1 | 3300050511 | Bacteria | 8332 |
| 629 | nmdc:mga0n895_41223_c1 | 3300050512 | Bacteria | 4487 |
| 630 | nmdc:mga0a205_65088_c1 | 3300050515 | Bacteria | 3521 |
| 631 | Ga0495601_0000731 | 3300053077 | Bacteria | 17670 |
| 632 | Ga0495601_0001011 | 3300053077 | Bacteria | 15401 |
| 633 | Ga0495601_0005133 | 3300053077 | Bacteria | 7610 |
| 634 | Ga0495601_0006865 | 3300053077 | Bacteria | 6668 |
| 635 | Ga0495601_0010360 | 3300053077 | Bacteria | 5545 |
| 636 | Ga0495601_0011836 | 3300053077 | Bacteria | 5232 |
| 637 | Ga0495601_0012932 | 3300053077 | Bacteria | 5011 |
| 638 | Ga0495612_0006577 | 3300053078 | Bacteria | 4768 |
| 639 | Ga0495612_0007659 | 3300053078 | Bacteria | 4411 |
| 640 | Ga0495595_0000356 | 3300053084 | Bacteria | 17378 |
| 641 | Ga0495595_0001701 | 3300053084 | Bacteria | 8618 |
| 642 | Ga0495595_0001936 | 3300053084 | Bacteria | 8032 |
| 643 | Ga0495595_0002476 | 3300053084 | Bacteria | 7225 |
| 644 | Ga0495619_0001094 | 3300053085 | Bacteria | 17821 |
| 645 | Ga0495619_0010836 | 3300053085 | Bacteria | 5737 |
| 646 | Ga0495619_0013399 | 3300053085 | Bacteria | 5167 |
| 647 | Ga0495619_0030417 | 3300053085 | Bacteria | 3496 |
| 648 | Ga0495619_0034502 | 3300053085 | Bacteria | 3289 |
| 649 | Ga0495619_0105669 | 3300053085 | Bacteria | 1920 |
| 650 | Ga0495619_0243271 | 3300053085 | Bacteria | 1247 |
| 651 | Ga0500652_004490 | 3300053131 | Bacteria | 4324 |
| 652 | Ga0501084_0023641 | 3300054114 | Bacteria | 5125 |
| 653 | Ga0501082_0000570 | 3300060353 | Bacteria | 32833 |
| 654 | Ga0501082_0026405 | 3300060353 | Bacteria | 5004 |
| 655 | Ga0501082_0086600 | 3300060353 | Bacteria | 2702 |
| 656 | Ga0501082_0173828 | 3300060353 | Bacteria | 1873 |
| 657 | Ga0530510_0149019 | 3300061734 | Bacteria | 1727 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0315416 | Ga0501047_0315416_31_1059 | 288 |
| 2 | 3300049823 | Ga0501044_0001993 | Ga0501044_0001993_16281_17309 | 288 |
| 3 | 3300009101 | Ga0105247_10013648 | Ga0105247_100136482 | 290 |
| 4 | 3300011119 | Ga0105246_10014859 | Ga0105246_100148592 | 290 |
| 5 | 3300013306 | Ga0163162_10056217 | Ga0163162_100562174 | 290 |
| 6 | 3300013308 | Ga0157375_10015977 | Ga0157375_100159774 | 290 |
| 7 | 3300014325 | Ga0163163_10001222 | Ga0163163_1000122215 | 290 |
| 8 | 3300014745 | Ga0157377_10030644 | Ga0157377_100306442 | 290 |
| 9 | 3300035692 | Ga0373935_0296636 | Ga0373935_0296636_49_1071 | 292 |
| 10 | 3300046476 | Ga0495662_0032507 | Ga0495662_0032507_1271_2293 | 292 |
| 11 | 3300005546 | Ga0070696_100094394 | Ga0070696_1000943942 | 297 |
| 12 | 3300005615 | Ga0070702_100025455 | Ga0070702_1000254554 | 297 |
| 13 | 3300005543 | Ga0070672_100342037 | Ga0070672_1003420372 | 298 |
| 14 | 3300046533 | Ga0495640_0041299 | Ga0495640_0041299_358_1353 | 299 |
| 15 | 3300046642 | Ga0495634_0047376 | Ga0495634_0047376_823_1818 | 299 |
| 16 | 3300047471 | Ga0495684_0097874 | Ga0495684_0097874_1102_2097 | 299 |
| 17 | 3300025944 | Ga0207661_10259003 | Ga0207661_102590033 | 300 |
| 18 | 3300031731 | Ga0307405_10072929 | Ga0307405_100729293 | 300 |
| 19 | 3300025949 | Ga0207667_10070130 | Ga0207667_100701303 | 304 |
| 20 | 3300013104 | Ga0157370_10136016 | Ga0157370_101360162 | 306 |
| 21 | 3300047322 | Ga0495680_0057461 | Ga0495680_0057461_1623_2573 | 306 |
| 22 | 3300049581 | Ga0501047_0157297 | Ga0501047_0157297_483_1487 | 306 |
| 23 | 3300025919 | Ga0207657_10262520 | Ga0207657_102625202 | 308 |
| 24 | 3300006237 | Ga0097621_100040496 | Ga0097621_1000404963 | 309 |
| 25 | 3300006358 | Ga0068871_100028870 | Ga0068871_1000288702 | 309 |
| 26 | 3300009098 | Ga0105245_10102254 | Ga0105245_101022543 | 309 |
| 27 | 3300013297 | Ga0157378_10302397 | Ga0157378_103023971 | 309 |
| 28 | 3300013306 | Ga0163162_10241467 | Ga0163162_102414672 | 309 |
| 29 | 3300014969 | Ga0157376_10247744 | Ga0157376_102477442 | 309 |
| 30 | 3300025927 | Ga0207687_10022697 | Ga0207687_100226974 | 309 |
| 31 | 3300025934 | Ga0207686_10241750 | Ga0207686_102417502 | 309 |
| 32 | 3300005439 | Ga0070711_100046980 | Ga0070711_1000469802 | 310 |
| 33 | 3300009174 | Ga0105241_10013737 | Ga0105241_100137376 | 310 |
| 34 | 3300009551 | Ga0105238_10009355 | Ga0105238_100093553 | 310 |
| 35 | 3300025928 | Ga0207700_10212529 | Ga0207700_102125292 | 310 |
| 36 | 3300026116 | Ga0207674_10146800 | Ga0207674_101468001 | 311 |
| 37 | 3300041413 | Ga0439465_0047164 | Ga0439465_0047164_209_1159 | 311 |
| 38 | 3300005436 | Ga0070713_100043614 | Ga0070713_1000436142 | 312 |
| 39 | 3300005563 | Ga0068855_100008252 | Ga0068855_1000082526 | 312 |
| 40 | 3300013104 | Ga0157370_10001270 | Ga0157370_1000127011 | 312 |
| 41 | 3300025949 | Ga0207667_10038687 | Ga0207667_100386873 | 312 |
| 42 | 3300049823 | Ga0501044_0475538 | Ga0501044_0475538_158_1138 | 312 |
| 43 | iso_pu_bacteria | 2643221564 | 2643838558 | 312 |
| 44 | 3300003911 | JGI25405J52794_10017317 | JGI25405J52794_100173171 | 313 |
| 45 | 3300005937 | Ga0081455_10010000 | Ga0081455_100100004 | 313 |
| 46 | 3300006038 | Ga0075365_10025911 | Ga0075365_100259112 | 313 |
| 47 | 3300006051 | Ga0075364_10148885 | Ga0075364_101488852 | 313 |
| 48 | 3300025927 | Ga0207687_10233088 | Ga0207687_102330882 | 313 |
| 49 | 3300035172 | Ga0373955_0081179 | Ga0373955_0081179_311_1303 | 313 |
| 50 | 3300035724 | Ga0373933_0005461 | Ga0373933_0005461_2577_3569 | 313 |
| 51 | 3300036401 | Ga0373937_0027575 | Ga0373937_0027575_571_1563 | 313 |
| 52 | 3300049744 | Ga0501083_0017169 | Ga0501083_0017169_4017_5012 | 313 |
| 53 | 3300050492 | nmdc:mga0yw44_56609_c1 | nmdc:mga0yw44_56609_c1_292_1287 | 313 |
| 54 | 3300053131 | Ga0500652_004490 | Ga0500652_004490_3304_4293 | 313 |
| 55 | iso_pu_bacteria | 2643221547 | 2643754663 | 313 |
| 56 | 3300005327 | Ga0070658_10147435 | Ga0070658_101474352 | 314 |
| 57 | 3300005329 | Ga0070683_100035510 | Ga0070683_1000355101 | 314 |
| 58 | 3300005336 | Ga0070680_100069612 | Ga0070680_1000696122 | 314 |
| 59 | 3300005338 | Ga0068868_100074621 | Ga0068868_1000746212 | 314 |
| 60 | 3300005437 | Ga0070710_10043415 | Ga0070710_100434152 | 314 |
| 61 | 3300005530 | Ga0070679_100186321 | Ga0070679_1001863213 | 314 |
| 62 | 3300005535 | Ga0070684_100076053 | Ga0070684_1000760531 | 314 |
| 63 | 3300005563 | Ga0068855_100192890 | Ga0068855_1001928902 | 314 |
| 64 | 3300005616 | Ga0068852_100000554 | Ga0068852_1000005547 | 314 |
| 65 | 3300005616 | Ga0068852_100004557 | Ga0068852_1000045579 | 314 |
| 66 | 3300005616 | Ga0068852_100083301 | Ga0068852_1000833012 | 314 |
| 67 | 3300005842 | Ga0068858_100024666 | Ga0068858_1000246662 | 314 |
| 68 | 3300005983 | Ga0081540_1003907 | Ga0081540_10039073 | 314 |
| 69 | 3300006175 | Ga0070712_100014927 | Ga0070712_1000149273 | 314 |
| 70 | 3300006237 | Ga0097621_100097801 | Ga0097621_1000978013 | 314 |
| 71 | 3300006358 | Ga0068871_100009241 | Ga0068871_1000092414 | 314 |
| 72 | 3300009176 | Ga0105242_10003746 | Ga0105242_100037463 | 314 |
| 73 | 3300009551 | Ga0105238_10018906 | Ga0105238_100189066 | 314 |
| 74 | 3300009551 | Ga0105238_10198599 | Ga0105238_101985992 | 314 |
| 75 | 3300013104 | Ga0157370_10238178 | Ga0157370_102381782 | 314 |
| 76 | 3300013105 | Ga0157369_10002601 | Ga0157369_100026013 | 314 |
| 77 | 3300013296 | Ga0157374_10154841 | Ga0157374_101548413 | 314 |
| 78 | 3300013306 | Ga0163162_10114262 | Ga0163162_101142623 | 314 |
| 79 | 3300013307 | Ga0157372_10004580 | Ga0157372_1000458010 | 314 |
| 80 | 3300014968 | Ga0157379_10134030 | Ga0157379_101340302 | 314 |
| 81 | 3300025906 | Ga0207699_10052120 | Ga0207699_100521203 | 314 |
| 82 | 3300025909 | Ga0207705_10060216 | Ga0207705_100602162 | 314 |
| 83 | 3300025909 | Ga0207705_10102758 | Ga0207705_101027582 | 314 |
| 84 | 3300025924 | Ga0207694_10014709 | Ga0207694_100147096 | 314 |
| 85 | 3300025924 | Ga0207694_10085831 | Ga0207694_100858312 | 314 |
| 86 | 3300025934 | Ga0207686_10017403 | Ga0207686_100174033 | 314 |
| 87 | 3300025935 | Ga0207709_10092973 | Ga0207709_100929732 | 314 |
| 88 | 3300025939 | Ga0207665_10242423 | Ga0207665_102424231 | 314 |
| 89 | 3300025941 | Ga0207711_10116633 | Ga0207711_101166333 | 314 |
| 90 | 3300025949 | Ga0207667_10018592 | Ga0207667_100185923 | 314 |
| 91 | 3300025949 | Ga0207667_10152458 | Ga0207667_101524581 | 314 |
| 92 | 3300026035 | Ga0207703_10108888 | Ga0207703_101088882 | 314 |
| 93 | 3300026041 | Ga0207639_10225641 | Ga0207639_102256412 | 314 |
| 94 | 3300026078 | Ga0207702_10105381 | Ga0207702_101053813 | 314 |
| 95 | 3300026142 | Ga0207698_10011251 | Ga0207698_100112516 | 314 |
| 96 | 3300026142 | Ga0207698_10019968 | Ga0207698_100199683 | 314 |
| 97 | 3300035115 | Ga0373941_0005651 | Ga0373941_0005651_1294_2286 | 314 |
| 98 | 3300035120 | Ga0373957_0024413 | Ga0373957_0024413_1017_2009 | 314 |
| 99 | 3300035172 | Ga0373955_0014629 | Ga0373955_0014629_400_1392 | 314 |
| 100 | 3300035692 | Ga0373935_0157622 | Ga0373935_0157622_262_1254 | 314 |
| 101 | 3300035724 | Ga0373933_0011582 | Ga0373933_0011582_31_1023 | 314 |
| 102 | 3300036401 | Ga0373937_0009035 | Ga0373937_0009035_3736_4728 | 314 |
| 103 | 3300036401 | Ga0373937_0035972 | Ga0373937_0035972_872_1864 | 314 |
| 104 | 3300036401 | Ga0373937_0197854 | Ga0373937_0197854_100_1098 | 314 |
| 105 | 3300041512 | Ga0451853_1695856 | Ga0451853_1695856_383_1375 | 314 |
| 106 | 3300046454 | Ga0495592_0075908 | Ga0495592_0075908_113_1105 | 314 |
| 107 | 3300046463 | Ga0495653_0061026 | Ga0495653_0061026_1500_2492 | 314 |
| 108 | 3300046511 | Ga0495608_0044062 | Ga0495608_0044062_1738_2730 | 314 |
| 109 | 3300046511 | Ga0495608_0072761 | Ga0495608_0072761_85_1077 | 314 |
| 110 | 3300046516 | Ga0495628_0159097 | Ga0495628_0159097_226_1218 | 314 |
| 111 | 3300046517 | Ga0495630_0134107 | Ga0495630_0134107_639_1631 | 314 |
| 112 | 3300046536 | Ga0495587_0002845 | Ga0495587_0002845_6055_7047 | 314 |
| 113 | 3300046543 | Ga0495645_0002386 | Ga0495645_0002386_903_1895 | 314 |
| 114 | 3300046559 | Ga0495667_0045655 | Ga0495667_0045655_1463_2455 | 314 |
| 115 | 3300046559 | Ga0495667_0049843 | Ga0495667_0049843_453_1445 | 314 |
| 116 | 3300046559 | Ga0495667_0257424 | Ga0495667_0257424_27_1025 | 314 |
| 117 | 3300046678 | Ga0495599_0000531 | Ga0495599_0000531_2371_3363 | 314 |
| 118 | 3300046679 | Ga0495623_0004324 | Ga0495623_0004324_3064_4056 | 314 |
| 119 | 3300046809 | Ga0495600_0064413 | Ga0495600_0064413_205_1197 | 314 |
| 120 | 3300047322 | Ga0495680_0036732 | Ga0495680_0036732_2613_3605 | 314 |
| 121 | 3300048907 | Ga0496104_0067549 | Ga0496104_0067549_377_1369 | 314 |
| 122 | 3300048908 | Ga0496105_0244461 | Ga0496105_0244461_166_1158 | 314 |
| 123 | 3300048913 | Ga0496110_0193022 | Ga0496110_0193022_254_1246 | 314 |
| 124 | 3300048914 | Ga0496111_0148541 | Ga0496111_0148541_599_1591 | 314 |
| 125 | 3300049568 | Ga0501031_0001427 | Ga0501031_0001427_5867_6862 | 314 |
| 126 | 3300049569 | Ga0501032_0002436 | Ga0501032_0002436_8774_9769 | 314 |
| 127 | 3300049569 | Ga0501032_0062303 | Ga0501032_0062303_124_1116 | 314 |
| 128 | 3300049570 | Ga0501033_0000244 | Ga0501033_0000244_47590_48585 | 314 |
| 129 | 3300049570 | Ga0501033_0013241 | Ga0501033_0013241_3855_4847 | 314 |
| 130 | 3300049571 | Ga0501034_0000159 | Ga0501034_0000159_3647_4642 | 314 |
| 131 | 3300049572 | Ga0501036_0000039 | Ga0501036_0000039_4680_5675 | 314 |
| 132 | 3300049572 | Ga0501036_0079493 | Ga0501036_0079493_365_1357 | 314 |
| 133 | 3300049573 | Ga0501037_0003835 | Ga0501037_0003835_7792_8787 | 314 |
| 134 | 3300049574 | Ga0501038_0001751 | Ga0501038_0001751_8312_9307 | 314 |
| 135 | 3300049574 | Ga0501038_0265310 | Ga0501038_0265310_201_1193 | 314 |
| 136 | 3300049575 | Ga0501039_0001324 | Ga0501039_0001324_14108_15103 | 314 |
| 137 | 3300049578 | Ga0501042_0064050 | Ga0501042_0064050_421_1416 | 314 |
| 138 | 3300049579 | Ga0501043_0030468 | Ga0501043_0030468_2710_3702 | 314 |
| 139 | 3300049580 | Ga0501046_0000185 | Ga0501046_0000185_56632_57627 | 314 |
| 140 | 3300049581 | Ga0501047_0000385 | Ga0501047_0000385_44994_45989 | 314 |
| 141 | 3300049582 | Ga0501048_0007283 | Ga0501048_0007283_5106_6101 | 314 |
| 142 | 3300049583 | Ga0501067_0000513 | Ga0501067_0000513_5681_6676 | 314 |
| 143 | 3300049584 | Ga0501068_0001337 | Ga0501068_0001337_2859_3851 | 314 |
| 144 | 3300049584 | Ga0501068_0026119 | Ga0501068_0026119_2157_3152 | 314 |
| 145 | 3300049586 | Ga0501070_0008612 | Ga0501070_0008612_3109_4104 | 314 |
| 146 | 3300049586 | Ga0501070_0010383 | Ga0501070_0010383_6708_7700 | 314 |
| 147 | 3300049588 | Ga0501072_0001656 | Ga0501072_0001656_1134_2129 | 314 |
| 148 | 3300049588 | Ga0501072_0106012 | Ga0501072_0106012_943_1926 | 314 |
| 149 | 3300049589 | Ga0501073_0000702 | Ga0501073_0000702_2981_3976 | 314 |
| 150 | 3300049589 | Ga0501073_0025314 | Ga0501073_0025314_2133_3125 | 314 |
| 151 | 3300049590 | Ga0501074_0001567 | Ga0501074_0001567_2981_3976 | 314 |
| 152 | 3300049741 | Ga0501079_0026149 | Ga0501079_0026149_2052_3047 | 314 |
| 153 | 3300049741 | Ga0501079_0085132 | Ga0501079_0085132_1322_2314 | 314 |
| 154 | 3300049742 | Ga0501080_0000380 | Ga0501080_0000380_30110_31105 | 314 |
| 155 | 3300049742 | Ga0501080_0287175 | Ga0501080_0287175_10_1002 | 314 |
| 156 | 3300049744 | Ga0501083_0004058 | Ga0501083_0004058_2793_3788 | 314 |
| 157 | 3300049822 | Ga0501035_0001985 | Ga0501035_0001985_15164_16159 | 314 |
| 158 | 3300049822 | Ga0501035_0026028 | Ga0501035_0026028_2937_3920 | 314 |
| 159 | 3300049822 | Ga0501035_0045442 | Ga0501035_0045442_1792_2784 | 314 |
| 160 | 3300050512 | nmdc:mga0n895_41223_c1 | nmdc:mga0n895_41223_c1_2343_3302 | 314 |
| 161 | 3300053077 | Ga0495601_0010360 | Ga0495601_0010360_891_1883 | 314 |
| 162 | 3300053085 | Ga0495619_0013399 | Ga0495619_0013399_171_1163 | 314 |
| 163 | 3300053085 | Ga0495619_0243271 | Ga0495619_0243271_199_1194 | 314 |
| 164 | 3300054114 | Ga0501084_0023641 | Ga0501084_0023641_3471_4466 | 314 |
| 165 | 3300060353 | Ga0501082_0000570 | Ga0501082_0000570_3650_4645 | 314 |
| 166 | 3300061734 | Ga0530510_0149019 | Ga0530510_0149019_464_1459 | 314 |
| 167 | 3300005434 | Ga0070709_10144689 | Ga0070709_101446892 | 315 |
| 168 | 3300005435 | Ga0070714_100245884 | Ga0070714_1002458842 | 315 |
| 169 | 3300005436 | Ga0070713_100165511 | Ga0070713_1001655112 | 315 |
| 170 | 3300009551 | Ga0105238_10266416 | Ga0105238_102664162 | 315 |
| 171 | 3300013307 | Ga0157372_10126363 | Ga0157372_101263633 | 315 |
| 172 | 3300025918 | Ga0207662_10208455 | Ga0207662_102084551 | 315 |
| 173 | 3300025941 | Ga0207711_10067338 | Ga0207711_100673382 | 315 |
| 174 | 3300025986 | Ga0207658_10011174 | Ga0207658_100111744 | 315 |
| 175 | 3300026035 | Ga0207703_10047022 | Ga0207703_100470223 | 315 |
| 176 | 3300026142 | Ga0207698_10405485 | Ga0207698_104054851 | 315 |
| 177 | 3300031711 | Ga0265314_10016876 | Ga0265314_100168761 | 315 |
| 178 | 3300035086 | Ga0373934_0001517 | Ga0373934_0001517_3239_4255 | 315 |
| 179 | 3300035116 | Ga0373945_0053045 | Ga0373945_0053045_109_1095 | 315 |
| 180 | 3300035118 | Ga0373954_0000002 | Ga0373954_0000002_140266_141264 | 315 |
| 181 | 3300035410 | Ga0373924_0117377 | Ga0373924_0117377_63_1061 | 315 |
| 182 | 3300035724 | Ga0373933_0001764 | Ga0373933_0001764_1555_2553 | 315 |
| 183 | 3300036401 | Ga0373937_0001304 | Ga0373937_0001304_12281_13279 | 315 |
| 184 | 3300036401 | Ga0373937_0007322 | Ga0373937_0007322_8374_9363 | 315 |
| 185 | 3300046454 | Ga0495592_0028842 | Ga0495592_0028842_3129_4127 | 315 |
| 186 | 3300046472 | Ga0495580_0050116 | Ga0495580_0050116_825_1823 | 315 |
| 187 | 3300046475 | Ga0495639_0007311 | Ga0495639_0007311_3054_4052 | 315 |
| 188 | 3300046477 | Ga0495664_0151611 | Ga0495664_0151611_160_1146 | 315 |
| 189 | 3300046511 | Ga0495608_0001817 | Ga0495608_0001817_9348_10346 | 315 |
| 190 | 3300046514 | Ga0495618_0018196 | Ga0495618_0018196_212_1198 | 315 |
| 191 | 3300046517 | Ga0495630_0122574 | Ga0495630_0122574_186_1184 | 315 |
| 192 | 3300046533 | Ga0495640_0027536 | Ga0495640_0027536_2364_3350 | 315 |
| 193 | 3300046535 | Ga0495586_0003545 | Ga0495586_0003545_1615_2613 | 315 |
| 194 | 3300046642 | Ga0495634_0015313 | Ga0495634_0015313_3514_4512 | 315 |
| 195 | 3300046678 | Ga0495599_0007730 | Ga0495599_0007730_526_1524 | 315 |
| 196 | 3300046689 | Ga0495613_0035336 | Ga0495613_0035336_2454_3452 | 315 |
| 197 | 3300047317 | Ga0495604_0015363 | Ga0495604_0015363_2243_3241 | 315 |
| 198 | 3300047319 | Ga0495674_0037354 | Ga0495674_0037354_2006_2992 | 315 |
| 199 | 3300047322 | Ga0495680_0007953 | Ga0495680_0007953_5933_6931 | 315 |
| 200 | 3300047471 | Ga0495684_0048498 | Ga0495684_0048498_1570_2556 | 315 |
| 201 | 3300049571 | Ga0501034_0031979 | Ga0501034_0031979_901_1890 | 315 |
| 202 | 3300049574 | Ga0501038_0062161 | Ga0501038_0062161_1031_2020 | 315 |
| 203 | 3300049822 | Ga0501035_0059100 | Ga0501035_0059100_2170_3159 | 315 |
| 204 | 3300049823 | Ga0501044_0171954 | Ga0501044_0171954_1060_2049 | 315 |
| 205 | 3300053077 | Ga0495601_0012932 | Ga0495601_0012932_3356_4342 | 315 |
| 206 | 3300053085 | Ga0495619_0030417 | Ga0495619_0030417_1861_2847 | 315 |
| 207 | 3300005327 | Ga0070658_10012028 | Ga0070658_100120285 | 316 |
| 208 | 3300005327 | Ga0070658_10089225 | Ga0070658_100892253 | 316 |
| 209 | 3300005329 | Ga0070683_100029663 | Ga0070683_1000296632 | 316 |
| 210 | 3300005339 | Ga0070660_100007264 | Ga0070660_1000072645 | 316 |
| 211 | 3300005344 | Ga0070661_100000534 | Ga0070661_10000053427 | 316 |
| 212 | 3300005344 | Ga0070661_100013055 | Ga0070661_1000130553 | 316 |
| 213 | 3300005366 | Ga0070659_100094240 | Ga0070659_1000942402 | 316 |
| 214 | 3300005434 | Ga0070709_10008931 | Ga0070709_100089312 | 316 |
| 215 | 3300005435 | Ga0070714_100004852 | Ga0070714_1000048525 | 316 |
| 216 | 3300005435 | Ga0070714_100071605 | Ga0070714_1000716052 | 316 |
| 217 | 3300005435 | Ga0070714_100075499 | Ga0070714_1000754993 | 316 |
| 218 | 3300005436 | Ga0070713_100233619 | Ga0070713_1002336191 | 316 |
| 219 | 3300005439 | Ga0070711_100021985 | Ga0070711_1000219853 | 316 |
| 220 | 3300005458 | Ga0070681_10004821 | Ga0070681_100048214 | 316 |
| 221 | 3300005458 | Ga0070681_10060239 | Ga0070681_100602392 | 316 |
| 222 | 3300005458 | Ga0070681_10104672 | Ga0070681_101046722 | 316 |
| 223 | 3300005518 | Ga0070699_100015846 | Ga0070699_1000158462 | 316 |
| 224 | 3300005530 | Ga0070679_100016685 | Ga0070679_1000166857 | 316 |
| 225 | 3300005530 | Ga0070679_100111202 | Ga0070679_1001112022 | 316 |
| 226 | 3300005535 | Ga0070684_100008632 | Ga0070684_1000086323 | 316 |
| 227 | 3300005539 | Ga0068853_100004769 | Ga0068853_1000047694 | 316 |
| 228 | 3300005546 | Ga0070696_100001722 | Ga0070696_1000017222 | 316 |
| 229 | 3300005563 | Ga0068855_100007766 | Ga0068855_1000077664 | 316 |
| 230 | 3300005563 | Ga0068855_100069930 | Ga0068855_1000699302 | 316 |
| 231 | 3300005563 | Ga0068855_100073898 | Ga0068855_1000738983 | 316 |
| 232 | 3300005563 | Ga0068855_100217464 | Ga0068855_1002174642 | 316 |
| 233 | 3300005564 | Ga0070664_100001929 | Ga0070664_1000019291 | 316 |
| 234 | 3300005577 | Ga0068857_100001319 | Ga0068857_10000131910 | 316 |
| 235 | 3300005577 | Ga0068857_100117321 | Ga0068857_1001173213 | 316 |
| 236 | 3300005577 | Ga0068857_100254726 | Ga0068857_1002547261 | 316 |
| 237 | 3300005578 | Ga0068854_100016881 | Ga0068854_1000168813 | 316 |
| 238 | 3300005578 | Ga0068854_100170336 | Ga0068854_1001703361 | 316 |
| 239 | 3300005614 | Ga0068856_100003061 | Ga0068856_1000030612 | 316 |
| 240 | 3300005614 | Ga0068856_100138006 | Ga0068856_1001380063 | 316 |
| 241 | 3300005614 | Ga0068856_100177033 | Ga0068856_1001770332 | 316 |
| 242 | 3300005616 | Ga0068852_100002959 | Ga0068852_1000029594 | 316 |
| 243 | 3300005616 | Ga0068852_100086236 | Ga0068852_1000862362 | 316 |
| 244 | 3300005616 | Ga0068852_100233337 | Ga0068852_1002333372 | 316 |
| 245 | 3300005834 | Ga0068851_10008121 | Ga0068851_100081212 | 316 |
| 246 | 3300009093 | Ga0105240_10002585 | Ga0105240_1000258526 | 316 |
| 247 | 3300009093 | Ga0105240_10007789 | Ga0105240_1000778911 | 316 |
| 248 | 3300009093 | Ga0105240_10026466 | Ga0105240_100264663 | 316 |
| 249 | 3300009174 | Ga0105241_10033974 | Ga0105241_100339743 | 316 |
| 250 | 3300009545 | Ga0105237_10162124 | Ga0105237_101621242 | 316 |
| 251 | 3300009551 | Ga0105238_10005650 | Ga0105238_100056503 | 316 |
| 252 | 3300009551 | Ga0105238_10156841 | Ga0105238_101568413 | 316 |
| 253 | 3300013100 | Ga0157373_10119000 | Ga0157373_101190001 | 316 |
| 254 | 3300013102 | Ga0157371_10019442 | Ga0157371_100194423 | 316 |
| 255 | 3300013102 | Ga0157371_10041023 | Ga0157371_100410233 | 316 |
| 256 | 3300013104 | Ga0157370_10003871 | Ga0157370_100038712 | 316 |
| 257 | 3300013104 | Ga0157370_10009975 | Ga0157370_100099757 | 316 |
| 258 | 3300013104 | Ga0157370_10020607 | Ga0157370_100206076 | 316 |
| 259 | 3300013105 | Ga0157369_10000895 | Ga0157369_1000089520 | 316 |
| 260 | 3300013105 | Ga0157369_10196083 | Ga0157369_101960833 | 316 |
| 261 | 3300013105 | Ga0157369_10399800 | Ga0157369_103998001 | 316 |
| 262 | 3300013296 | Ga0157374_10081300 | Ga0157374_100813002 | 316 |
| 263 | 3300013307 | Ga0157372_10022454 | Ga0157372_100224543 | 316 |
| 264 | 3300013307 | Ga0157372_10027347 | Ga0157372_100273473 | 316 |
| 265 | 3300013307 | Ga0157372_10034933 | Ga0157372_100349334 | 316 |
| 266 | 3300025321 | Ga0207656_10088259 | Ga0207656_100882592 | 316 |
| 267 | 3300025898 | Ga0207692_10004582 | Ga0207692_100045824 | 316 |
| 268 | 3300025909 | Ga0207705_10016504 | Ga0207705_100165042 | 316 |
| 269 | 3300025909 | Ga0207705_10019680 | Ga0207705_100196805 | 316 |
| 270 | 3300025911 | Ga0207654_10023112 | Ga0207654_100231123 | 316 |
| 271 | 3300025911 | Ga0207654_10023523 | Ga0207654_100235232 | 316 |
| 272 | 3300025912 | Ga0207707_10028062 | Ga0207707_100280625 | 316 |
| 273 | 3300025912 | Ga0207707_10194815 | Ga0207707_101948153 | 316 |
| 274 | 3300025912 | Ga0207707_10457711 | Ga0207707_104577111 | 316 |
| 275 | 3300025913 | Ga0207695_10004433 | Ga0207695_100044333 | 316 |
| 276 | 3300025913 | Ga0207695_10017259 | Ga0207695_100172593 | 316 |
| 277 | 3300025913 | Ga0207695_10032370 | Ga0207695_100323703 | 316 |
| 278 | 3300025913 | Ga0207695_10130049 | Ga0207695_101300493 | 316 |
| 279 | 3300025914 | Ga0207671_10060402 | Ga0207671_100604022 | 316 |
| 280 | 3300025917 | Ga0207660_10195634 | Ga0207660_101956342 | 316 |
| 281 | 3300025917 | Ga0207660_10223221 | Ga0207660_102232211 | 316 |
| 282 | 3300025919 | Ga0207657_10009889 | Ga0207657_100098893 | 316 |
| 283 | 3300025920 | Ga0207649_10002364 | Ga0207649_100023643 | 316 |
| 284 | 3300025920 | Ga0207649_10019384 | Ga0207649_100193843 | 316 |
| 285 | 3300025920 | Ga0207649_10032953 | Ga0207649_100329533 | 316 |
| 286 | 3300025921 | Ga0207652_10008705 | Ga0207652_100087057 | 316 |
| 287 | 3300025921 | Ga0207652_10041447 | Ga0207652_100414473 | 316 |
| 288 | 3300025922 | Ga0207646_10077035 | Ga0207646_100770353 | 316 |
| 289 | 3300025924 | Ga0207694_10002378 | Ga0207694_1000237812 | 316 |
| 290 | 3300025924 | Ga0207694_10035460 | Ga0207694_100354603 | 316 |
| 291 | 3300025924 | Ga0207694_10058866 | Ga0207694_100588663 | 316 |
| 292 | 3300025928 | Ga0207700_10137977 | Ga0207700_101379773 | 316 |
| 293 | 3300025929 | Ga0207664_10003344 | Ga0207664_100033447 | 316 |
| 294 | 3300025929 | Ga0207664_10007925 | Ga0207664_100079252 | 316 |
| 295 | 3300025929 | Ga0207664_10023865 | Ga0207664_100238654 | 316 |
| 296 | 3300025932 | Ga0207690_10094227 | Ga0207690_100942272 | 316 |
| 297 | 3300025932 | Ga0207690_10107839 | Ga0207690_101078391 | 316 |
| 298 | 3300025944 | Ga0207661_10081182 | Ga0207661_100811822 | 316 |
| 299 | 3300025949 | Ga0207667_10001311 | Ga0207667_100013113 | 316 |
| 300 | 3300025949 | Ga0207667_10048328 | Ga0207667_100483282 | 316 |
| 301 | 3300025949 | Ga0207667_10142924 | Ga0207667_101429242 | 316 |
| 302 | 3300025981 | Ga0207640_10042585 | Ga0207640_100425851 | 316 |
| 303 | 3300025981 | Ga0207640_10154434 | Ga0207640_101544342 | 316 |
| 304 | 3300026041 | Ga0207639_10016878 | Ga0207639_100168782 | 316 |
| 305 | 3300026078 | Ga0207702_10002277 | Ga0207702_100022774 | 316 |
| 306 | 3300026116 | Ga0207674_10000039 | Ga0207674_1000003968 | 316 |
| 307 | 3300026116 | Ga0207674_10092964 | Ga0207674_100929643 | 316 |
| 308 | 3300026142 | Ga0207698_10003989 | Ga0207698_100039898 | 316 |
| 309 | 3300028800 | Ga0265338_10033308 | Ga0265338_100333086 | 316 |
| 310 | 3300028800 | Ga0265338_10098428 | Ga0265338_100984282 | 316 |
| 311 | 3300031241 | Ga0265325_10034833 | Ga0265325_100348333 | 316 |
| 312 | 3300031241 | Ga0265325_10086133 | Ga0265325_100861332 | 316 |
| 313 | 3300031247 | Ga0265340_10025334 | Ga0265340_100253343 | 316 |
| 314 | 3300031712 | Ga0265342_10000182 | Ga0265342_1000018250 | 316 |
| 315 | 3300035086 | Ga0373934_0012356 | Ga0373934_0012356_1973_2944 | 316 |
| 316 | 3300035086 | Ga0373934_0013164 | Ga0373934_0013164_563_1564 | 316 |
| 317 | 3300035111 | Ga0373923_0024586 | Ga0373923_0024586_330_1331 | 316 |
| 318 | 3300035113 | Ga0373936_0005568 | Ga0373936_0005568_687_1688 | 316 |
| 319 | 3300035117 | Ga0373953_0012296 | Ga0373953_0012296_1620_2621 | 316 |
| 320 | 3300035117 | Ga0373953_0019942 | Ga0373953_0019942_821_1792 | 316 |
| 321 | 3300035118 | Ga0373954_0003738 | Ga0373954_0003738_67_1068 | 316 |
| 322 | 3300035118 | Ga0373954_0006044 | Ga0373954_0006044_3256_4227 | 316 |
| 323 | 3300035119 | Ga0373956_0002179 | Ga0373956_0002179_4985_5956 | 316 |
| 324 | 3300035119 | Ga0373956_0019484 | Ga0373956_0019484_1329_2330 | 316 |
| 325 | 3300035119 | Ga0373956_0107005 | Ga0373956_0107005_225_1235 | 316 |
| 326 | 3300035120 | Ga0373957_0002968 | Ga0373957_0002968_3246_4247 | 316 |
| 327 | 3300035172 | Ga0373955_0028909 | Ga0373955_0028909_900_1871 | 316 |
| 328 | 3300035172 | Ga0373955_0034110 | Ga0373955_0034110_409_1410 | 316 |
| 329 | 3300035410 | Ga0373924_0004417 | Ga0373924_0004417_1381_2382 | 316 |
| 330 | 3300035692 | Ga0373935_0057754 | Ga0373935_0057754_1154_2149 | 316 |
| 331 | 3300035695 | Ga0373927_0288887 | Ga0373927_0288887_73_1068 | 316 |
| 332 | 3300035724 | Ga0373933_0002111 | Ga0373933_0002111_6585_7556 | 316 |
| 333 | 3300035724 | Ga0373933_0042536 | Ga0373933_0042536_16_1017 | 316 |
| 334 | 3300035725 | Ga0373947_0063299 | Ga0373947_0063299_897_1892 | 316 |
| 335 | 3300035725 | Ga0373947_0100781 | Ga0373947_0100781_769_1764 | 316 |
| 336 | 3300035725 | Ga0373947_0195698 | Ga0373947_0195698_151_1146 | 316 |
| 337 | 3300035725 | Ga0373947_0203572 | Ga0373947_0203572_137_1132 | 316 |
| 338 | 3300036401 | Ga0373937_0005332 | Ga0373937_0005332_3739_4710 | 316 |
| 339 | 3300046452 | Ga0495617_024276 | Ga0495617_024276_454_1449 | 316 |
| 340 | 3300046455 | Ga0495603_0020971 | Ga0495603_0020971_2454_3449 | 316 |
| 341 | 3300046462 | Ga0495651_0021054 | Ga0495651_0021054_1967_2968 | 316 |
| 342 | 3300046462 | Ga0495651_0037541 | Ga0495651_0037541_2690_3661 | 316 |
| 343 | 3300046462 | Ga0495651_0118498 | Ga0495651_0118498_232_1227 | 316 |
| 344 | 3300046463 | Ga0495653_0059041 | Ga0495653_0059041_1067_2068 | 316 |
| 345 | 3300046473 | Ga0495582_0083300 | Ga0495582_0083300_314_1315 | 316 |
| 346 | 3300046492 | Ga0495585_0008414 | Ga0495585_0008414_227_1222 | 316 |
| 347 | 3300046499 | Ga0495594_0127852 | Ga0495594_0127852_83_1078 | 316 |
| 348 | 3300046506 | Ga0495583_0083296 | Ga0495583_0083296_241_1236 | 316 |
| 349 | 3300046511 | Ga0495608_0021073 | Ga0495608_0021073_2928_3929 | 316 |
| 350 | 3300046511 | Ga0495608_0084732 | Ga0495608_0084732_1001_1972 | 316 |
| 351 | 3300046514 | Ga0495618_0157805 | Ga0495618_0157805_38_1033 | 316 |
| 352 | 3300046516 | Ga0495628_0014727 | Ga0495628_0014727_5243_6244 | 316 |
| 353 | 3300046517 | Ga0495630_0041594 | Ga0495630_0041594_1568_2569 | 316 |
| 354 | 3300046523 | Ga0495644_0014794 | Ga0495644_0014794_1796_2791 | 316 |
| 355 | 3300046529 | Ga0495652_0089741 | Ga0495652_0089741_1065_2060 | 316 |
| 356 | 3300046531 | Ga0495665_0069040 | Ga0495665_0069040_564_1565 | 316 |
| 357 | 3300046536 | Ga0495587_0092504 | Ga0495587_0092504_418_1419 | 316 |
| 358 | 3300046543 | Ga0495645_0109269 | Ga0495645_0109269_754_1755 | 316 |
| 359 | 3300046558 | Ga0495633_0019628 | Ga0495633_0019628_2234_3229 | 316 |
| 360 | 3300046559 | Ga0495667_0041422 | Ga0495667_0041422_460_1455 | 316 |
| 361 | 3300046615 | Ga0495656_0004034 | Ga0495656_0004034_1932_2927 | 316 |
| 362 | 3300046642 | Ga0495634_0067106 | Ga0495634_0067106_434_1435 | 316 |
| 363 | 3300046663 | Ga0495635_0026001 | Ga0495635_0026001_2300_3301 | 316 |
| 364 | 3300046664 | Ga0495659_0007696 | Ga0495659_0007696_790_1785 | 316 |
| 365 | 3300046675 | Ga0495657_0019008 | Ga0495657_0019008_462_1433 | 316 |
| 366 | 3300046675 | Ga0495657_0156584 | Ga0495657_0156584_217_1218 | 316 |
| 367 | 3300046678 | Ga0495599_0024588 | Ga0495599_0024588_259_1260 | 316 |
| 368 | 3300046681 | Ga0495647_0003976 | Ga0495647_0003976_564_1565 | 316 |
| 369 | 3300046683 | Ga0495658_0087110 | Ga0495658_0087110_426_1421 | 316 |
| 370 | 3300046690 | Ga0495624_0168486 | Ga0495624_0168486_290_1291 | 316 |
| 371 | 3300046691 | Ga0495670_0001321 | Ga0495670_0001321_5037_6032 | 316 |
| 372 | 3300046809 | Ga0495600_0019250 | Ga0495600_0019250_87_1082 | 316 |
| 373 | 3300047317 | Ga0495604_0024413 | Ga0495604_0024413_1869_2864 | 316 |
| 374 | 3300047319 | Ga0495674_0054172 | Ga0495674_0054172_955_1956 | 316 |
| 375 | 3300047319 | Ga0495674_0055682 | Ga0495674_0055682_874_1869 | 316 |
| 376 | 3300047322 | Ga0495680_0016011 | Ga0495680_0016011_1423_2418 | 316 |
| 377 | 3300047322 | Ga0495680_0125557 | Ga0495680_0125557_276_1277 | 316 |
| 378 | 3300047444 | Ga0495675_0021903 | Ga0495675_0021903_2658_3659 | 316 |
| 379 | 3300047471 | Ga0495684_0112796 | Ga0495684_0112796_731_1726 | 316 |
| 380 | 3300047471 | Ga0495684_0116479 | Ga0495684_0116479_866_1867 | 316 |
| 381 | 3300048088 | Ga0495602_0037956 | Ga0495602_0037956_3416_4387 | 316 |
| 382 | 3300049581 | Ga0501047_0133021 | Ga0501047_0133021_1311_2327 | 316 |
| 383 | 3300049582 | Ga0501048_0335808 | Ga0501048_0335808_72_1064 | 316 |
| 384 | 3300049586 | Ga0501070_0112369 | Ga0501070_0112369_1070_2086 | 316 |
| 385 | 3300049588 | Ga0501072_0038222 | Ga0501072_0038222_924_1940 | 316 |
| 386 | 3300049589 | Ga0501073_0045790 | Ga0501073_0045790_909_1925 | 316 |
| 387 | 3300049742 | Ga0501080_0007162 | Ga0501080_0007162_3821_4837 | 316 |
| 388 | 3300049742 | Ga0501080_0227275 | Ga0501080_0227275_311_1327 | 316 |
| 389 | 3300053077 | Ga0495601_0005133 | Ga0495601_0005133_2456_3451 | 316 |
| 390 | 3300053077 | Ga0495601_0006865 | Ga0495601_0006865_4190_5161 | 316 |
| 391 | 3300053078 | Ga0495612_0006577 | Ga0495612_0006577_2300_3271 | 316 |
| 392 | 3300053084 | Ga0495595_0000356 | Ga0495595_0000356_15392_16387 | 316 |
| 393 | 3300053084 | Ga0495595_0001936 | Ga0495595_0001936_3257_4228 | 316 |
| 394 | 3300053085 | Ga0495619_0001094 | Ga0495619_0001094_16516_17511 | 316 |
| 395 | 3300053085 | Ga0495619_0034502 | Ga0495619_0034502_387_1358 | 316 |
| 396 | 3300053085 | Ga0495619_0105669 | Ga0495619_0105669_521_1516 | 316 |
| 397 | 3300060353 | Ga0501082_0086600 | Ga0501082_0086600_665_1681 | 316 |
| 398 | 2209111006 | 2214911869 | 2213970493 | 317 |
| 399 | 3300000041 | ARcpr5oldR_c000029 | ARcpr5oldR_0000296 | 317 |
| 400 | 3300000042 | ARSoilYngRDRAFT_c00072 | ARSoilYngRDRAFT_0007214 | 317 |
| 401 | 3300000043 | ARcpr5yngRDRAFT_c000051 | ARcpr5yngRDRAFT_0000517 | 317 |
| 402 | 3300000044 | ARSoilOldRDRAFT_c000078 | ARSoilOldRDRAFT_00007814 | 317 |
| 403 | 3300000045 | ARCol0oldRDRAFT_c00459 | ARCol0oldRDRAFT_004593 | 317 |
| 404 | 3300000652 | ARCol0yngRDRAFT_1000056 | ARCol0yngRDRAFT_10000567 | 317 |
| 405 | 3300001990 | JGI24737J22298_10012020 | JGI24737J22298_100120203 | 317 |
| 406 | 3300005276 | Ga0065717_1002104 | Ga0065717_10021042 | 317 |
| 407 | 3300005277 | Ga0065716_1002476 | Ga0065716_10024762 | 317 |
| 408 | 3300005289 | Ga0065704_10083802 | Ga0065704_100838022 | 317 |
| 409 | 3300005293 | Ga0065715_10106453 | Ga0065715_101064532 | 317 |
| 410 | 3300005328 | Ga0070676_10147513 | Ga0070676_101475132 | 317 |
| 411 | 3300005329 | Ga0070683_100096539 | Ga0070683_1000965393 | 317 |
| 412 | 3300005336 | Ga0070680_100029424 | Ga0070680_1000294243 | 317 |
| 413 | 3300005336 | Ga0070680_100290154 | Ga0070680_1002901542 | 317 |
| 414 | 3300005339 | Ga0070660_100144635 | Ga0070660_1001446352 | 317 |
| 415 | 3300005341 | Ga0070691_10041412 | Ga0070691_100414122 | 317 |
| 416 | 3300005345 | Ga0070692_10010043 | Ga0070692_100100432 | 317 |
| 417 | 3300005345 | Ga0070692_10070074 | Ga0070692_100700742 | 317 |
| 418 | 3300005353 | Ga0070669_100028908 | Ga0070669_1000289081 | 317 |
| 419 | 3300005354 | Ga0070675_100039583 | Ga0070675_1000395834 | 317 |
| 420 | 3300005365 | Ga0070688_100016727 | Ga0070688_1000167275 | 317 |
| 421 | 3300005365 | Ga0070688_100135663 | Ga0070688_1001356632 | 317 |
| 422 | 3300005367 | Ga0070667_100021395 | Ga0070667_1000213954 | 317 |
| 423 | 3300005367 | Ga0070667_100142260 | Ga0070667_1001422603 | 317 |
| 424 | 3300005406 | Ga0070703_10009780 | Ga0070703_100097803 | 317 |
| 425 | 3300005436 | Ga0070713_100015251 | Ga0070713_1000152511 | 317 |
| 426 | 3300005436 | Ga0070713_100035154 | Ga0070713_1000351544 | 317 |
| 427 | 3300005437 | Ga0070710_10257431 | Ga0070710_102574311 | 317 |
| 428 | 3300005439 | Ga0070711_100048137 | Ga0070711_1000481371 | 317 |
| 429 | 3300005444 | Ga0070694_100102197 | Ga0070694_1001021972 | 317 |
| 430 | 3300005455 | Ga0070663_100069216 | Ga0070663_1000692162 | 317 |
| 431 | 3300005458 | Ga0070681_10066993 | Ga0070681_100669933 | 317 |
| 432 | 3300005507 | Ga0074259_12105788 | Ga0074259_121057881 | 317 |
| 433 | 3300005530 | Ga0070679_100011066 | Ga0070679_1000110668 | 317 |
| 434 | 3300005530 | Ga0070679_100017604 | Ga0070679_1000176046 | 317 |
| 435 | 3300005530 | Ga0070679_100065636 | Ga0070679_1000656362 | 317 |
| 436 | 3300005535 | Ga0070684_100022129 | Ga0070684_1000221292 | 317 |
| 437 | 3300005539 | Ga0068853_100010929 | Ga0068853_1000109294 | 317 |
| 438 | 3300005543 | Ga0070672_100073562 | Ga0070672_1000735623 | 317 |
| 439 | 3300005544 | Ga0070686_100034533 | Ga0070686_1000345331 | 317 |
| 440 | 3300005545 | Ga0070695_100002680 | Ga0070695_1000026804 | 317 |
| 441 | 3300005546 | Ga0070696_100027300 | Ga0070696_1000273002 | 317 |
| 442 | 3300005549 | Ga0070704_100019446 | Ga0070704_1000194462 | 317 |
| 443 | 3300005577 | Ga0068857_100115620 | Ga0068857_1001156202 | 317 |
| 444 | 3300005578 | Ga0068854_100050830 | Ga0068854_1000508304 | 317 |
| 445 | 3300005617 | Ga0068859_100291001 | Ga0068859_1002910012 | 317 |
| 446 | 3300005719 | Ga0068861_100019068 | Ga0068861_1000190682 | 317 |
| 447 | 3300005841 | Ga0068863_100301324 | Ga0068863_1003013242 | 317 |
| 448 | 3300005842 | Ga0068858_100140765 | Ga0068858_1001407651 | 317 |
| 449 | 3300005843 | Ga0068860_100034634 | Ga0068860_1000346342 | 317 |
| 450 | 3300005844 | Ga0068862_100016334 | Ga0068862_1000163342 | 317 |
| 451 | 3300006058 | Ga0075432_10055282 | Ga0075432_100552822 | 317 |
| 452 | 3300006163 | Ga0070715_10118308 | Ga0070715_101183081 | 317 |
| 453 | 3300006353 | Ga0075370_10038270 | Ga0075370_100382703 | 317 |
| 454 | 3300006931 | Ga0097620_100291019 | Ga0097620_1002910192 | 317 |
| 455 | 3300009093 | Ga0105240_10053422 | Ga0105240_100534223 | 317 |
| 456 | 3300009094 | Ga0111539_10007739 | Ga0111539_100077397 | 317 |
| 457 | 3300009101 | Ga0105247_10047888 | Ga0105247_100478883 | 317 |
| 458 | 3300009148 | Ga0105243_10009481 | Ga0105243_100094814 | 317 |
| 459 | 3300009177 | Ga0105248_10008602 | Ga0105248_100086026 | 317 |
| 460 | 3300009553 | Ga0105249_10006636 | Ga0105249_100066365 | 317 |
| 461 | 3300012508 | Ga0157315_1000484 | Ga0157315_10004842 | 317 |
| 462 | 3300013100 | Ga0157373_10091002 | Ga0157373_100910022 | 317 |
| 463 | 3300013102 | Ga0157371_10102975 | Ga0157371_101029751 | 317 |
| 464 | 3300013104 | Ga0157370_10061699 | Ga0157370_100616994 | 317 |
| 465 | 3300013104 | Ga0157370_10160929 | Ga0157370_101609292 | 317 |
| 466 | 3300013105 | Ga0157369_10113846 | Ga0157369_101138462 | 317 |
| 467 | 3300013306 | Ga0163162_10021249 | Ga0163162_100212491 | 317 |
| 468 | 3300013307 | Ga0157372_10232687 | Ga0157372_102326872 | 317 |
| 469 | 3300013308 | Ga0157375_10154689 | Ga0157375_101546891 | 317 |
| 470 | 3300014325 | Ga0163163_10000757 | Ga0163163_100007579 | 317 |
| 471 | 3300014326 | Ga0157380_10038881 | Ga0157380_100388812 | 317 |
| 472 | 3300014745 | Ga0157377_10169037 | Ga0157377_101690371 | 317 |
| 473 | 3300014968 | Ga0157379_10245781 | Ga0157379_102457812 | 317 |
| 474 | 3300014969 | Ga0157376_10041184 | Ga0157376_100411844 | 317 |
| 475 | 3300025271 | Ga0207666_1000343 | Ga0207666_10003434 | 317 |
| 476 | 3300025315 | Ga0207697_10007410 | Ga0207697_100074104 | 317 |
| 477 | 3300025901 | Ga0207688_10004300 | Ga0207688_100043003 | 317 |
| 478 | 3300025903 | Ga0207680_10266326 | Ga0207680_102663261 | 317 |
| 479 | 3300025904 | Ga0207647_10047471 | Ga0207647_100474713 | 317 |
| 480 | 3300025907 | Ga0207645_10040159 | Ga0207645_100401592 | 317 |
| 481 | 3300025911 | Ga0207654_10128529 | Ga0207654_101285292 | 317 |
| 482 | 3300025912 | Ga0207707_10011542 | Ga0207707_100115426 | 317 |
| 483 | 3300025912 | Ga0207707_10264712 | Ga0207707_102647121 | 317 |
| 484 | 3300025913 | Ga0207695_10096789 | Ga0207695_100967894 | 317 |
| 485 | 3300025915 | Ga0207693_10026873 | Ga0207693_100268733 | 317 |
| 486 | 3300025916 | Ga0207663_10108042 | Ga0207663_101080422 | 317 |
| 487 | 3300025917 | Ga0207660_10047796 | Ga0207660_100477963 | 317 |
| 488 | 3300025919 | Ga0207657_10133464 | Ga0207657_101334642 | 317 |
| 489 | 3300025921 | Ga0207652_10062760 | Ga0207652_100627603 | 317 |
| 490 | 3300025921 | Ga0207652_10070843 | Ga0207652_100708434 | 317 |
| 491 | 3300025921 | Ga0207652_10092261 | Ga0207652_100922612 | 317 |
| 492 | 3300025923 | Ga0207681_10066864 | Ga0207681_100668643 | 317 |
| 493 | 3300025923 | Ga0207681_10319148 | Ga0207681_103191481 | 317 |
| 494 | 3300025926 | Ga0207659_10065689 | Ga0207659_100656891 | 317 |
| 495 | 3300025932 | Ga0207690_10136275 | Ga0207690_101362751 | 317 |
| 496 | 3300025933 | Ga0207706_10007810 | Ga0207706_100078106 | 317 |
| 497 | 3300025934 | Ga0207686_10064900 | Ga0207686_100649001 | 317 |
| 498 | 3300025949 | Ga0207667_10065695 | Ga0207667_100656953 | 317 |
| 499 | 3300025972 | Ga0207668_10140812 | Ga0207668_101408122 | 317 |
| 500 | 3300025986 | Ga0207658_10112167 | Ga0207658_101121671 | 317 |
| 501 | 3300026035 | Ga0207703_10390416 | Ga0207703_103904161 | 317 |
| 502 | 3300026041 | Ga0207639_10132234 | Ga0207639_101322341 | 317 |
| 503 | 3300026067 | Ga0207678_10012696 | Ga0207678_100126964 | 317 |
| 504 | 3300026075 | Ga0207708_10004283 | Ga0207708_100042839 | 317 |
| 505 | 3300026088 | Ga0207641_10193239 | Ga0207641_101932392 | 317 |
| 506 | 3300026118 | Ga0207675_100015653 | Ga0207675_1000156533 | 317 |
| 507 | 3300027695 | Ga0209966_1002877 | Ga0209966_10028772 | 317 |
| 508 | 3300027717 | Ga0209998_10000758 | Ga0209998_100007584 | 317 |
| 509 | 3300027907 | Ga0207428_10014000 | Ga0207428_100140003 | 317 |
| 510 | 3300028381 | Ga0268264_10069274 | Ga0268264_100692743 | 317 |
| 511 | 3300031241 | Ga0265325_10000004 | Ga0265325_10000004195 | 317 |
| 512 | 3300031241 | Ga0265325_10043495 | Ga0265325_100434951 | 317 |
| 513 | 3300031241 | Ga0265325_10048228 | Ga0265325_100482283 | 317 |
| 514 | 3300031249 | Ga0265339_10010467 | Ga0265339_100104673 | 317 |
| 515 | 3300031344 | Ga0265316_10066828 | Ga0265316_100668281 | 317 |
| 516 | 3300031595 | Ga0265313_10009264 | Ga0265313_100092645 | 317 |
| 517 | 3300031595 | Ga0265313_10048143 | Ga0265313_100481431 | 317 |
| 518 | 3300034816 | Ga0373930_0000532 | Ga0373930_0000532_2228_3238 | 317 |
| 519 | 3300034817 | Ga0373948_0000419 | Ga0373948_0000419_2591_3601 | 317 |
| 520 | 3300034818 | Ga0373950_0000167 | Ga0373950_0000167_828_1838 | 317 |
| 521 | 3300034819 | Ga0373958_0002350 | Ga0373958_0002350_915_1925 | 317 |
| 522 | 3300034957 | Ga0373938_0000028 | Ga0373938_0000028_12695_13705 | 317 |
| 523 | 3300035084 | Ga0373928_0000334 | Ga0373928_0000334_5415_6425 | 317 |
| 524 | 3300035085 | Ga0373929_0001866 | Ga0373929_0001866_157_1167 | 317 |
| 525 | 3300035086 | Ga0373934_0005199 | Ga0373934_0005199_1287_2348 | 317 |
| 526 | 3300035090 | Ga0373949_0001620 | Ga0373949_0001620_3042_4052 | 317 |
| 527 | 3300035091 | Ga0373951_0000666 | Ga0373951_0000666_4239_5249 | 317 |
| 528 | 3300035092 | Ga0373952_0000851 | Ga0373952_0000851_3015_4025 | 317 |
| 529 | 3300035111 | Ga0373923_0049411 | Ga0373923_0049411_588_1583 | 317 |
| 530 | 3300035112 | Ga0373932_0000749 | Ga0373932_0000749_5652_6662 | 317 |
| 531 | 3300035114 | Ga0373939_0001838 | Ga0373939_0001838_2133_3143 | 317 |
| 532 | 3300035114 | Ga0373939_0016499 | Ga0373939_0016499_119_1114 | 317 |
| 533 | 3300035115 | Ga0373941_0000671 | Ga0373941_0000671_3368_4378 | 317 |
| 534 | 3300035116 | Ga0373945_0097102 | Ga0373945_0097102_42_1037 | 317 |
| 535 | 3300035117 | Ga0373953_0008219 | Ga0373953_0008219_252_1247 | 317 |
| 536 | 3300035118 | Ga0373954_0007284 | Ga0373954_0007284_883_1944 | 317 |
| 537 | 3300035118 | Ga0373954_0014031 | Ga0373954_0014031_600_1595 | 317 |
| 538 | 3300035119 | Ga0373956_0000945 | Ga0373956_0000945_8968_9963 | 317 |
| 539 | 3300035120 | Ga0373957_0000339 | Ga0373957_0000339_1361_2356 | 317 |
| 540 | 3300035120 | Ga0373957_0003036 | Ga0373957_0003036_2275_3291 | 317 |
| 541 | 3300035121 | Ga0373960_0000599 | Ga0373960_0000599_4022_5032 | 317 |
| 542 | 3300035172 | Ga0373955_0001962 | Ga0373955_0001962_3865_4926 | 317 |
| 543 | 3300035172 | Ga0373955_0064377 | Ga0373955_0064377_786_1781 | 317 |
| 544 | 3300035207 | Ga0373942_0005239 | Ga0373942_0005239_17_1027 | 317 |
| 545 | 3300035241 | Ga0373961_0000433 | Ga0373961_0000433_3089_4099 | 317 |
| 546 | 3300035242 | Ga0373962_0000881 | Ga0373962_0000881_4494_5504 | 317 |
| 547 | 3300035410 | Ga0373924_0025366 | Ga0373924_0025366_467_1552 | 317 |
| 548 | 3300035410 | Ga0373924_0057243 | Ga0373924_0057243_280_1341 | 317 |
| 549 | 3300035692 | Ga0373935_0026607 | Ga0373935_0026607_1688_2749 | 317 |
| 550 | 3300035695 | Ga0373927_0003675 | Ga0373927_0003675_5348_6367 | 317 |
| 551 | 3300035695 | Ga0373927_0093708 | Ga0373927_0093708_516_1511 | 317 |
| 552 | 3300035724 | Ga0373933_0000890 | Ga0373933_0000890_4447_5463 | 317 |
| 553 | 3300035724 | Ga0373933_0001687 | Ga0373933_0001687_1503_2498 | 317 |
| 554 | 3300035724 | Ga0373933_0041104 | Ga0373933_0041104_793_1878 | 317 |
| 555 | 3300035725 | Ga0373947_0115514 | Ga0373947_0115514_632_1642 | 317 |
| 556 | 3300036401 | Ga0373937_0001794 | Ga0373937_0001794_7030_8091 | 317 |
| 557 | 3300036401 | Ga0373937_0004227 | Ga0373937_0004227_1131_2147 | 317 |
| 558 | 3300036401 | Ga0373937_0006421 | Ga0373937_0006421_1362_2357 | 317 |
| 559 | 3300036401 | Ga0373937_0087050 | Ga0373937_0087050_421_1602 | 317 |
| 560 | 3300044712 | Ga0453684_0140242 | Ga0453684_0140242_1190_2200 | 317 |
| 561 | 3300045051 | Ga0451576_0065472 | Ga0451576_0065472_1038_2048 | 317 |
| 562 | 3300046454 | Ga0495592_0000589 | Ga0495592_0000589_3953_5014 | 317 |
| 563 | 3300046454 | Ga0495592_0002245 | Ga0495592_0002245_778_1773 | 317 |
| 564 | 3300046454 | Ga0495592_0040216 | Ga0495592_0040216_1311_2396 | 317 |
| 565 | 3300046459 | Ga0495629_0013396 | Ga0495629_0013396_252_1247 | 317 |
| 566 | 3300046462 | Ga0495651_0003925 | Ga0495651_0003925_6391_7407 | 317 |
| 567 | 3300046462 | Ga0495651_0031350 | Ga0495651_0031350_3094_4104 | 317 |
| 568 | 3300046462 | Ga0495651_0050023 | Ga0495651_0050023_1503_2498 | 317 |
| 569 | 3300046462 | Ga0495651_0115579 | Ga0495651_0115579_883_1968 | 317 |
| 570 | 3300046463 | Ga0495653_0001655 | Ga0495653_0001655_12471_13466 | 317 |
| 571 | 3300046463 | Ga0495653_0004752 | Ga0495653_0004752_6345_7406 | 317 |
| 572 | 3300046477 | Ga0495664_0005496 | Ga0495664_0005496_2288_3349 | 317 |
| 573 | 3300046511 | Ga0495608_0001793 | Ga0495608_0001793_253_1248 | 317 |
| 574 | 3300046511 | Ga0495608_0005922 | Ga0495608_0005922_546_1607 | 317 |
| 575 | 3300046514 | Ga0495618_0008159 | Ga0495618_0008159_3874_4935 | 317 |
| 576 | 3300046514 | Ga0495618_0072351 | Ga0495618_0072351_409_1404 | 317 |
| 577 | 3300046516 | Ga0495628_0004889 | Ga0495628_0004889_3432_4493 | 317 |
| 578 | 3300046516 | Ga0495628_0009824 | Ga0495628_0009824_705_1700 | 317 |
| 579 | 3300046517 | Ga0495630_0027998 | Ga0495630_0027998_546_1607 | 317 |
| 580 | 3300046529 | Ga0495652_0010464 | Ga0495652_0010464_183_1268 | 317 |
| 581 | 3300046529 | Ga0495652_0013953 | Ga0495652_0013953_1496_2557 | 317 |
| 582 | 3300046533 | Ga0495640_0005362 | Ga0495640_0005362_4151_5212 | 317 |
| 583 | 3300046533 | Ga0495640_0013444 | Ga0495640_0013444_4562_5557 | 317 |
| 584 | 3300046543 | Ga0495645_0008213 | Ga0495645_0008213_2288_3349 | 317 |
| 585 | 3300046559 | Ga0495667_0013127 | Ga0495667_0013127_2288_3349 | 317 |
| 586 | 3300046642 | Ga0495634_0013078 | Ga0495634_0013078_2381_3442 | 317 |
| 587 | 3300046642 | Ga0495634_0023688 | Ga0495634_0023688_518_1513 | 317 |
| 588 | 3300046663 | Ga0495635_0002748 | Ga0495635_0002748_44_1039 | 317 |
| 589 | 3300046663 | Ga0495635_0004972 | Ga0495635_0004972_469_1530 | 317 |
| 590 | 3300046663 | Ga0495635_0038825 | Ga0495635_0038825_1289_2374 | 317 |
| 591 | 3300046675 | Ga0495657_0001218 | Ga0495657_0001218_11174_12235 | 317 |
| 592 | 3300046675 | Ga0495657_0058481 | Ga0495657_0058481_861_1946 | 317 |
| 593 | 3300046678 | Ga0495599_0000970 | Ga0495599_0000970_8534_9595 | 317 |
| 594 | 3300046678 | Ga0495599_0009604 | Ga0495599_0009604_3422_4417 | 317 |
| 595 | 3300046678 | Ga0495599_0017496 | Ga0495599_0017496_3164_4249 | 317 |
| 596 | 3300046679 | Ga0495623_0000758 | Ga0495623_0000758_5843_6904 | 317 |
| 597 | 3300046679 | Ga0495623_0050543 | Ga0495623_0050543_1318_2403 | 317 |
| 598 | 3300046679 | Ga0495623_0104799 | Ga0495623_0104799_125_1120 | 317 |
| 599 | 3300046680 | Ga0495646_0000300 | Ga0495646_0000300_15343_16404 | 317 |
| 600 | 3300046680 | Ga0495646_0048164 | Ga0495646_0048164_1407_2492 | 317 |
| 601 | 3300046809 | Ga0495600_0017662 | Ga0495600_0017662_905_1990 | 317 |
| 602 | 3300046809 | Ga0495600_0087418 | Ga0495600_0087418_786_1781 | 317 |
| 603 | 3300047317 | Ga0495604_0001425 | Ga0495604_0001425_11478_12539 | 317 |
| 604 | 3300047319 | Ga0495674_0005874 | Ga0495674_0005874_2261_3322 | 317 |
| 605 | 3300047319 | Ga0495674_0069114 | Ga0495674_0069114_496_1491 | 317 |
| 606 | 3300047322 | Ga0495680_0002651 | Ga0495680_0002651_1503_2498 | 317 |
| 607 | 3300047322 | Ga0495680_0009557 | Ga0495680_0009557_5363_6424 | 317 |
| 608 | 3300047444 | Ga0495675_0001056 | Ga0495675_0001056_2261_3322 | 317 |
| 609 | 3300047444 | Ga0495675_0018474 | Ga0495675_0018474_3306_4301 | 317 |
| 610 | 3300047471 | Ga0495684_0006100 | Ga0495684_0006100_1475_2470 | 317 |
| 611 | 3300047471 | Ga0495684_0019131 | Ga0495684_0019131_3949_5010 | 317 |
| 612 | 3300047673 | Ga0495593_0009724 | Ga0495593_0009724_3228_4223 | 317 |
| 613 | 3300048088 | Ga0495602_0003273 | Ga0495602_0003273_11739_12800 | 317 |
| 614 | 3300048088 | Ga0495602_0017308 | Ga0495602_0017308_189_1274 | 317 |
| 615 | 3300048904 | Ga0496101_0195827 | Ga0496101_0195827_326_1387 | 317 |
| 616 | 3300048905 | Ga0496102_0210499 | Ga0496102_0210499_348_1358 | 317 |
| 617 | 3300048906 | Ga0496103_0081016 | Ga0496103_0081016_303_1313 | 317 |
| 618 | 3300048907 | Ga0496104_0000515 | Ga0496104_0000515_17603_18613 | 317 |
| 619 | 3300048907 | Ga0496104_0080380 | Ga0496104_0080380_1696_2727 | 317 |
| 620 | 3300048909 | Ga0496106_0015310 | Ga0496106_0015310_2092_3102 | 317 |
| 621 | 3300048909 | Ga0496106_0158605 | Ga0496106_0158605_507_1538 | 317 |
| 622 | 3300048910 | Ga0496107_0015088 | Ga0496107_0015088_1405_2436 | 317 |
| 623 | 3300048910 | Ga0496107_0090827 | Ga0496107_0090827_747_1757 | 317 |
| 624 | 3300048911 | Ga0496108_0008991 | Ga0496108_0008991_2874_3905 | 317 |
| 625 | 3300048912 | Ga0496109_0001064 | Ga0496109_0001064_4577_5608 | 317 |
| 626 | 3300048912 | Ga0496109_0113508 | Ga0496109_0113508_628_1638 | 317 |
| 627 | 3300048914 | Ga0496111_0055737 | Ga0496111_0055737_1536_2567 | 317 |
| 628 | 3300048914 | Ga0496111_0081328 | Ga0496111_0081328_623_1633 | 317 |
| 629 | 3300048915 | Ga0496112_0075018 | Ga0496112_0075018_1558_2589 | 317 |
| 630 | 3300048916 | Ga0496113_0004800 | Ga0496113_0004800_1199_2230 | 317 |
| 631 | 3300048918 | Ga0496115_0045598 | Ga0496115_0045598_2126_3187 | 317 |
| 632 | 3300048918 | Ga0496115_0138609 | Ga0496115_0138609_968_1978 | 317 |
| 633 | 3300049571 | Ga0501034_0046375 | Ga0501034_0046375_38_1033 | 317 |
| 634 | 3300049571 | Ga0501034_0187526 | Ga0501034_0187526_941_1951 | 317 |
| 635 | 3300049575 | Ga0501039_0101558 | Ga0501039_0101558_141_1136 | 317 |
| 636 | 3300049581 | Ga0501047_0010053 | Ga0501047_0010053_795_1790 | 317 |
| 637 | 3300049585 | Ga0501069_0006089 | Ga0501069_0006089_2395_3396 | 317 |
| 638 | 3300049585 | Ga0501069_0149490 | Ga0501069_0149490_258_1253 | 317 |
| 639 | 3300049586 | Ga0501070_0003256 | Ga0501070_0003256_12294_13295 | 317 |
| 640 | 3300049589 | Ga0501073_0000374 | Ga0501073_0000374_85_1086 | 317 |
| 641 | 3300049589 | Ga0501073_0115244 | Ga0501073_0115244_666_1664 | 317 |
| 642 | 3300049590 | Ga0501074_0000125 | Ga0501074_0000125_4017_5018 | 317 |
| 643 | 3300049590 | Ga0501074_0148255 | Ga0501074_0148255_85_1083 | 317 |
| 644 | 3300049742 | Ga0501080_0001529 | Ga0501080_0001529_4644_5645 | 317 |
| 645 | 3300049744 | Ga0501083_0001646 | Ga0501083_0001646_10228_11229 | 317 |
| 646 | 3300049822 | Ga0501035_0306211 | Ga0501035_0306211_271_1269 | 317 |
| 647 | 3300049823 | Ga0501044_0172377 | Ga0501044_0172377_326_1327 | 317 |
| 648 | 3300050496 | nmdc:mga07m45_24106_c2 | nmdc:mga07m45_24106_c2_1557_2588 | 317 |
| 649 | 3300050511 | nmdc:mga08y16_14377_c1 | nmdc:mga08y16_14377_c1_1520_2530 | 317 |
| 650 | 3300050515 | nmdc:mga0a205_65088_c1 | nmdc:mga0a205_65088_c1_1730_2740 | 317 |
| 651 | 3300053077 | Ga0495601_0000731 | Ga0495601_0000731_11808_12893 | 317 |
| 652 | 3300053077 | Ga0495601_0001011 | Ga0495601_0001011_9254_10315 | 317 |
| 653 | 3300053077 | Ga0495601_0011836 | Ga0495601_0011836_2801_3796 | 317 |
| 654 | 3300053078 | Ga0495612_0007659 | Ga0495612_0007659_1063_2124 | 317 |
| 655 | 3300053084 | Ga0495595_0001701 | Ga0495595_0001701_3498_4559 | 317 |
| 656 | 3300053084 | Ga0495595_0002476 | Ga0495595_0002476_5284_6369 | 317 |
| 657 | 3300053085 | Ga0495619_0010836 | Ga0495619_0010836_4131_5192 | 317 |
| 658 | 3300060353 | Ga0501082_0026405 | Ga0501082_0026405_831_1826 | 317 |
| 659 | 3300060353 | Ga0501082_0173828 | Ga0501082_0173828_811_1812 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p47-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket | 0.9177 | 8 | 315 |
| 4mev-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 | 0.9139 | 11 | 317 |
| 4mev-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 | 0.9001 | 11 | 317 |
| 3gyy-assembly1.cif.gz_A | the ectoine binding protein of the teaabc trap transporter teaa in the apo-state | 0.8913 | 12 | 315 |
| 4pf8-assembly1.cif.gz_A | crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d-galacturonate | 0.8893 | 13 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p47A00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9177 | 8 | 315 | 3.40.190.170 |
| 4mevA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9139 | 11 | 317 | 3.40.190.170 |
| 4mevA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9001 | 11 | 317 | 3.40.190.170 |
| 3gyyA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8913 | 12 | 315 | 3.40.190.170 |
| 4p1eA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.8834 | 11 | 317 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6T2D2-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9291 | 1 | 314 |
GO:0015740
GO:0055085 |
| AF-A0A7S7SU36-F1-model_v4 | TRAP transporter substrate-binding protein DctP | 0.918 | 9 | 313 |
GO:0015740
GO:0055085 |
| AF-A0A6N6T2D2-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9179 | 1 | 314 |
GO:0015740
GO:0055085 |
| AF-A0A850MZ18-F1-model_v4 | deleted | 0.9157 | 10 | 317 |
|
| AF-A0A8A7T859-F1-model_v4 | deleted | 0.9114 | 10 | 314 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar