F473261

General Info

Members Datasets Scaffolds Average Seq Length
659 297 657 329

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0087050|Ga0373937_0087050_421_1602
Length 393
Sequence VAADRVPLDRTAQPRTPVFEWACCSARRRGAGAPGGVFSYCLLSTTCGVQPAATTAQKEEYMMSKISSFFAFAAIAILLSAPADAQVTMRASHQFPGGKGDVRDDMVQMIAKDVGAANVGLTIQVYPGASLFKPNDQWNAIVNGQLDITLFPLDYASGKVPVFSATLMPGLIRSQDRAKRINNSPFMTDVRAEIEKHGAIVLSDAWFAGGVAAKGGCIVHPSDMKGRKLRAAGPTFAAMWESAGASIVSPPSNEIYNAFQSGVVNGTDTSLGTFQSMRLYEVTDCLTAPGNNALWFMYEPVLMSKKSFDKLNKAQQDAIIAAGKKAQAYYEGKADEVNKEAIKAFEDHKVKVVSLSDADYQAWLEVARKSSYAKFAQDVPNGQKLIDEALAVK

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
13 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 3.34
Rhizosphere 95.3
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214911869 2209111006 Bacteria 6786
2 ARcpr5oldR_c000029 3300000041 Bacteria 29077
3 ARSoilYngRDRAFT_c00072 3300000042 Bacteria 16897
4 ARcpr5yngRDRAFT_c000051 3300000043 Bacteria 18515
5 ARSoilOldRDRAFT_c000078 3300000044 Bacteria 18538
6 ARCol0oldRDRAFT_c00459 3300000045 Bacteria 3845
7 ARCol0yngRDRAFT_1000056 3300000652 Bacteria 20075
8 JGI24737J22298_10012020 3300001990 Bacteria 2827
9 JGI25405J52794_10017317 3300003911 Bacteria 1430
10 Ga0065717_1002104 3300005276 Bacteria 2915
11 Ga0065716_1002476 3300005277 Bacteria 1756
12 Ga0065704_10083802 3300005289 Bacteria 3415
13 Ga0065715_10106453 3300005293 Bacteria 2829
14 Ga0070658_10012028 3300005327 Bacteria 6951
15 Ga0070658_10089225 3300005327 Bacteria 2539
16 Ga0070658_10147435 3300005327 Bacteria 1968
17 Ga0070676_10147513 3300005328 Bacteria 1503
18 Ga0070683_100029663 3300005329 Bacteria 4957
19 Ga0070683_100035510 3300005329 Bacteria 4556
20 Ga0070683_100096539 3300005329 Bacteria 2780
21 Ga0070680_100029424 3300005336 Bacteria 4413
22 Ga0070680_100069612 3300005336 Bacteria 2889
23 Ga0070680_100290154 3300005336 Bacteria 1387
24 Ga0068868_100074621 3300005338 Bacteria 2709
25 Ga0070660_100007264 3300005339 Bacteria 7714
26 Ga0070660_100144635 3300005339 Bacteria 1909
27 Ga0070691_10041412 3300005341 Bacteria 2178
28 Ga0070661_100000534 3300005344 Bacteria 29159
29 Ga0070661_100013055 3300005344 Bacteria 5825
30 Ga0070692_10010043 3300005345 Bacteria 4294
31 Ga0070692_10070074 3300005345 Bacteria 1866
32 Ga0070669_100028908 3300005353 Bacteria 3994
33 Ga0070675_100039583 3300005354 Bacteria 3847
34 Ga0070688_100016727 3300005365 Bacteria 4199
35 Ga0070688_100135663 3300005365 Bacteria 1666
36 Ga0070659_100094240 3300005366 Bacteria 2404
37 Ga0070667_100021395 3300005367 Bacteria 5371
38 Ga0070667_100142260 3300005367 Bacteria 2102
39 Ga0070703_10009780 3300005406 Bacteria 2703
40 Ga0070709_10008931 3300005434 Bacteria 5517
41 Ga0070709_10144689 3300005434 Bacteria 1636
42 Ga0070714_100004852 3300005435 Bacteria 10210
43 Ga0070714_100071605 3300005435 Bacteria 2998
44 Ga0070714_100075499 3300005435 Bacteria 2924
45 Ga0070714_100245884 3300005435 Bacteria 1653
46 Ga0070713_100015251 3300005436 Bacteria 5734
47 Ga0070713_100035154 3300005436 Bacteria 4031
48 Ga0070713_100043614 3300005436 Bacteria 3668
49 Ga0070713_100165511 3300005436 Bacteria 1977
50 Ga0070713_100233619 3300005436 Bacteria 1672
51 Ga0070710_10043415 3300005437 Bacteria 2490
52 Ga0070710_10257431 3300005437 Bacteria 1124
53 Ga0070711_100021985 3300005439 Bacteria 4130
54 Ga0070711_100046980 3300005439 Bacteria 2944
55 Ga0070711_100048137 3300005439 Bacteria 2913
56 Ga0070694_100102197 3300005444 Bacteria 2029
57 Ga0070663_100069216 3300005455 Bacteria 2563
58 Ga0070681_10004821 3300005458 Bacteria 12928
59 Ga0070681_10060239 3300005458 Bacteria 3774
60 Ga0070681_10066993 3300005458 Bacteria 3559
61 Ga0070681_10104672 3300005458 Bacteria 2772
62 Ga0074259_12105788 3300005507 Bacteria 1310
63 Ga0070699_100015846 3300005518 Bacteria 6470
64 Ga0070679_100011066 3300005530 Bacteria 8583
65 Ga0070679_100016685 3300005530 Bacteria 7093
66 Ga0070679_100017604 3300005530 Bacteria 6917
67 Ga0070679_100065636 3300005530 Bacteria 3617
68 Ga0070679_100111202 3300005530 Bacteria 2726
69 Ga0070679_100186321 3300005530 Bacteria 2046
70 Ga0070684_100008632 3300005535 Bacteria 7983
71 Ga0070684_100022129 3300005535 Bacteria 5299
72 Ga0070684_100076053 3300005535 Bacteria 2963
73 Ga0068853_100004769 3300005539 Bacteria 10539
74 Ga0068853_100010929 3300005539 Bacteria 7359
75 Ga0070672_100073562 3300005543 Bacteria 2724
76 Ga0070672_100342037 3300005543 Bacteria 1274
77 Ga0070686_100034533 3300005544 Bacteria 3117
78 Ga0070695_100002680 3300005545 Bacteria 10305
79 Ga0070696_100001722 3300005546 Bacteria 14339
80 Ga0070696_100027300 3300005546 Bacteria 3888
81 Ga0070696_100094394 3300005546 Bacteria 2135
82 Ga0070704_100019446 3300005549 Bacteria 4363
83 Ga0068855_100007766 3300005563 Bacteria 12955
84 Ga0068855_100008252 3300005563 Bacteria 12590
85 Ga0068855_100069930 3300005563 Bacteria 4084
86 Ga0068855_100073898 3300005563 Bacteria 3960
87 Ga0068855_100192890 3300005563 Bacteria 2297
88 Ga0068855_100217464 3300005563 Bacteria 2144
89 Ga0070664_100001929 3300005564 Bacteria 16665
90 Ga0068857_100001319 3300005577 Bacteria 19521
91 Ga0068857_100115620 3300005577 Bacteria 2413
92 Ga0068857_100117321 3300005577 Bacteria 2395
93 Ga0068857_100254726 3300005577 Bacteria 1610
94 Ga0068854_100016881 3300005578 Bacteria 4875
95 Ga0068854_100050830 3300005578 Bacteria 2968
96 Ga0068854_100170336 3300005578 Bacteria 1694
97 Ga0068856_100003061 3300005614 Bacteria 17098
98 Ga0068856_100138006 3300005614 Bacteria 2444
99 Ga0068856_100177033 3300005614 Bacteria 2146
100 Ga0070702_100025455 3300005615 Bacteria 3171
101 Ga0068852_100000554 3300005616 Bacteria 24527
102 Ga0068852_100002959 3300005616 Bacteria 11801
103 Ga0068852_100004557 3300005616 Bacteria 9813
104 Ga0068852_100083301 3300005616 Bacteria 2844
105 Ga0068852_100086236 3300005616 Bacteria 2798
106 Ga0068852_100233337 3300005616 Bacteria 1755
107 Ga0068859_100291001 3300005617 Bacteria 1726
108 Ga0068861_100019068 3300005719 Bacteria 4897
109 Ga0068851_10008121 3300005834 Bacteria 4844
110 Ga0068863_100301324 3300005841 Bacteria 1555
111 Ga0068858_100024666 3300005842 Bacteria 5600
112 Ga0068858_100140765 3300005842 Bacteria 2265
113 Ga0068860_100034634 3300005843 Bacteria 4844
114 Ga0068862_100016334 3300005844 Bacteria 6178
115 Ga0081455_10010000 3300005937 Bacteria 9697
116 Ga0081540_1003907 3300005983 Bacteria 11608
117 Ga0075365_10025911 3300006038 Bacteria 3716
118 Ga0075364_10148885 3300006051 Bacteria 1577
119 Ga0075432_10055282 3300006058 Bacteria 1406
120 Ga0070715_10118308 3300006163 Bacteria 1260
121 Ga0070712_100014927 3300006175 Bacteria 4994
122 Ga0097621_100040496 3300006237 Bacteria 3746
123 Ga0097621_100097801 3300006237 Bacteria 2465
124 Ga0075370_10038270 3300006353 Bacteria 2699
125 Ga0068871_100009241 3300006358 Bacteria 7130
126 Ga0068871_100028870 3300006358 Bacteria 4353
127 Ga0097620_100291019 3300006931 Bacteria 1726
128 Ga0105240_10002585 3300009093 Bacteria 28988
129 Ga0105240_10007789 3300009093 Bacteria 15482
130 Ga0105240_10026466 3300009093 Bacteria 7611
131 Ga0105240_10053422 3300009093 Bacteria 5070
132 Ga0111539_10007739 3300009094 Bacteria 13721
133 Ga0105245_10102254 3300009098 Bacteria 2654
134 Ga0105247_10013648 3300009101 Bacteria 4873
135 Ga0105247_10047888 3300009101 Bacteria 2626
136 Ga0105243_10009481 3300009148 Bacteria 7411
137 Ga0105241_10013737 3300009174 Bacteria 5931
138 Ga0105241_10033974 3300009174 Bacteria 3831
139 Ga0105242_10003746 3300009176 Bacteria 11815
140 Ga0105248_10008602 3300009177 Bacteria 11211
141 Ga0105237_10162124 3300009545 Bacteria 2235
142 Ga0105238_10005650 3300009551 Bacteria 12365
143 Ga0105238_10009355 3300009551 Bacteria 9813
144 Ga0105238_10018906 3300009551 Bacteria 7017
145 Ga0105238_10156841 3300009551 Bacteria 2251
146 Ga0105238_10198599 3300009551 Bacteria 1981
147 Ga0105238_10266416 3300009551 Bacteria 1693
148 Ga0105249_10006636 3300009553 Bacteria 10070
149 Ga0105246_10014859 3300011119 Bacteria 4904
150 Ga0157315_1000484 3300012508 Bacteria 1851
151 Ga0157373_10091002 3300013100 Bacteria 2148
152 Ga0157373_10119000 3300013100 Bacteria 1856
153 Ga0157371_10019442 3300013102 Bacteria 5010
154 Ga0157371_10041023 3300013102 Bacteria 3304
155 Ga0157371_10102975 3300013102 Bacteria 2026
156 Ga0157370_10001270 3300013104 Bacteria 31545
157 Ga0157370_10003871 3300013104 Bacteria 17431
158 Ga0157370_10009975 3300013104 Bacteria 10050
159 Ga0157370_10020607 3300013104 Bacteria 6582
160 Ga0157370_10061699 3300013104 Bacteria 3558
161 Ga0157370_10136016 3300013104 Bacteria 2291
162 Ga0157370_10160929 3300013104 Bacteria 2089
163 Ga0157370_10238178 3300013104 Bacteria 1684
164 Ga0157369_10000895 3300013105 Bacteria 38049
165 Ga0157369_10002601 3300013105 Bacteria 21597
166 Ga0157369_10113846 3300013105 Bacteria 2873
167 Ga0157369_10196083 3300013105 Bacteria 2121
168 Ga0157369_10399800 3300013105 Bacteria 1425
169 Ga0157374_10081300 3300013296 Bacteria 3075
170 Ga0157374_10154841 3300013296 Bacteria 2230
171 Ga0157378_10302397 3300013297 Bacteria 1548
172 Ga0163162_10021249 3300013306 Bacteria 6388
173 Ga0163162_10056217 3300013306 Bacteria 3964
174 Ga0163162_10114262 3300013306 Bacteria 2799
175 Ga0163162_10241467 3300013306 Bacteria 1937
176 Ga0157372_10004580 3300013307 Bacteria 14701
177 Ga0157372_10022454 3300013307 Bacteria 6829
178 Ga0157372_10027347 3300013307 Bacteria 6210
179 Ga0157372_10034933 3300013307 Bacteria 5532
180 Ga0157372_10126363 3300013307 Bacteria 2940
181 Ga0157372_10232687 3300013307 Bacteria 2136
182 Ga0157375_10015977 3300013308 Bacteria 6733
183 Ga0157375_10154689 3300013308 Bacteria 2431
184 Ga0163163_10000757 3300014325 Bacteria 27476
185 Ga0163163_10001222 3300014325 Bacteria 21707
186 Ga0157380_10038881 3300014326 Bacteria 3696
187 Ga0157377_10030644 3300014745 Bacteria 2916
188 Ga0157377_10169037 3300014745 Bacteria 1366
189 Ga0157379_10134030 3300014968 Bacteria 2231
190 Ga0157379_10245781 3300014968 Bacteria 1623
191 Ga0157376_10041184 3300014969 Bacteria 3781
192 Ga0157376_10247744 3300014969 Bacteria 1663
193 Ga0207666_1000343 3300025271 Bacteria 6396
194 Ga0207697_10007410 3300025315 Bacteria 4897
195 Ga0207656_10088259 3300025321 Bacteria 1404
196 Ga0207692_10004582 3300025898 Bacteria 5481
197 Ga0207688_10004300 3300025901 Bacteria 7767
198 Ga0207680_10266326 3300025903 Bacteria 1187
199 Ga0207647_10047471 3300025904 Bacteria 2671
200 Ga0207699_10052120 3300025906 Bacteria 2421
201 Ga0207645_10040159 3300025907 Bacteria 2997
202 Ga0207705_10016504 3300025909 Bacteria 5290
203 Ga0207705_10019680 3300025909 Bacteria 4827
204 Ga0207705_10060216 3300025909 Bacteria 2742
205 Ga0207705_10102758 3300025909 Bacteria 2104
206 Ga0207654_10023112 3300025911 Bacteria 3326
207 Ga0207654_10023523 3300025911 Bacteria 3301
208 Ga0207654_10128529 3300025911 Bacteria 1601
209 Ga0207707_10011542 3300025912 Bacteria 7692
210 Ga0207707_10028062 3300025912 Bacteria 4920
211 Ga0207707_10194815 3300025912 Bacteria 1768
212 Ga0207707_10264712 3300025912 Bacteria 1491
213 Ga0207707_10457711 3300025912 Bacteria 1091
214 Ga0207695_10004433 3300025913 Bacteria 19160
215 Ga0207695_10017259 3300025913 Bacteria 8404
216 Ga0207695_10032370 3300025913 Bacteria 5722
217 Ga0207695_10096789 3300025913 Bacteria 2953
218 Ga0207695_10130049 3300025913 Bacteria 2476
219 Ga0207671_10060402 3300025914 Bacteria 2812
220 Ga0207693_10026873 3300025915 Bacteria 4552
221 Ga0207663_10108042 3300025916 Bacteria 1883
222 Ga0207660_10047796 3300025917 Bacteria 3027
223 Ga0207660_10195634 3300025917 Bacteria 1577
224 Ga0207660_10223221 3300025917 Bacteria 1479
225 Ga0207662_10208455 3300025918 Bacteria 1268
226 Ga0207657_10009889 3300025919 Bacteria 9548
227 Ga0207657_10133464 3300025919 Bacteria 2033
228 Ga0207657_10262520 3300025919 Bacteria 1374
229 Ga0207649_10002364 3300025920 Bacteria 10572
230 Ga0207649_10019384 3300025920 Bacteria 3887
231 Ga0207649_10032953 3300025920 Bacteria 3092
232 Ga0207652_10008705 3300025921 Bacteria 8168
233 Ga0207652_10041447 3300025921 Bacteria 3914
234 Ga0207652_10062760 3300025921 Bacteria 3211
235 Ga0207652_10070843 3300025921 Bacteria 3028
236 Ga0207652_10092261 3300025921 Bacteria 2664
237 Ga0207646_10077035 3300025922 Bacteria 2980
238 Ga0207681_10066864 3300025923 Bacteria 2489
239 Ga0207681_10319148 3300025923 Bacteria 1235
240 Ga0207694_10002378 3300025924 Bacteria 15389
241 Ga0207694_10014709 3300025924 Bacteria 5900
242 Ga0207694_10035460 3300025924 Bacteria 3827
243 Ga0207694_10058866 3300025924 Bacteria 2988
244 Ga0207694_10085831 3300025924 Bacteria 2478
245 Ga0207659_10065689 3300025926 Bacteria 2630
246 Ga0207687_10022697 3300025927 Bacteria 4179
247 Ga0207687_10233088 3300025927 Bacteria 1455
248 Ga0207700_10137977 3300025928 Bacteria 2000
249 Ga0207700_10212529 3300025928 Bacteria 1636
250 Ga0207664_10003344 3300025929 Bacteria 10662
251 Ga0207664_10007925 3300025929 Bacteria 7381
252 Ga0207664_10023865 3300025929 Bacteria 4589
253 Ga0207690_10094227 3300025932 Bacteria 2124
254 Ga0207690_10107839 3300025932 Bacteria 2001
255 Ga0207690_10136275 3300025932 Bacteria 1803
256 Ga0207706_10007810 3300025933 Bacteria 9874
257 Ga0207686_10017403 3300025934 Bacteria 4050
258 Ga0207686_10064900 3300025934 Bacteria 2326
259 Ga0207686_10241750 3300025934 Bacteria 1314
260 Ga0207709_10092973 3300025935 Bacteria 1976
261 Ga0207665_10242423 3300025939 Bacteria 1329
262 Ga0207711_10067338 3300025941 Bacteria 3099
263 Ga0207711_10116633 3300025941 Bacteria 2381
264 Ga0207661_10081182 3300025944 Bacteria 2678
265 Ga0207661_10259003 3300025944 Bacteria 1549
266 Ga0207667_10001311 3300025949 Bacteria 31212
267 Ga0207667_10018592 3300025949 Bacteria 7788
268 Ga0207667_10038687 3300025949 Bacteria 5090
269 Ga0207667_10048328 3300025949 Bacteria 4499
270 Ga0207667_10065695 3300025949 Bacteria 3783
271 Ga0207667_10070130 3300025949 Bacteria 3648
272 Ga0207667_10142924 3300025949 Bacteria 2464
273 Ga0207667_10152458 3300025949 Bacteria 2378
274 Ga0207668_10140812 3300025972 Bacteria 1855
275 Ga0207640_10042585 3300025981 Bacteria 2896
276 Ga0207640_10154434 3300025981 Bacteria 1690
277 Ga0207658_10011174 3300025986 Bacteria 6116
278 Ga0207658_10112167 3300025986 Bacteria 2158
279 Ga0207703_10047022 3300026035 Bacteria 3478
280 Ga0207703_10108888 3300026035 Bacteria 2360
281 Ga0207703_10390416 3300026035 Bacteria 1289
282 Ga0207639_10016878 3300026041 Bacteria 5173
283 Ga0207639_10132234 3300026041 Bacteria 2067
284 Ga0207639_10225641 3300026041 Bacteria 1621
285 Ga0207678_10012696 3300026067 Bacteria 7399
286 Ga0207708_10004283 3300026075 Bacteria 10507
287 Ga0207702_10002277 3300026078 Bacteria 18412
288 Ga0207702_10105381 3300026078 Bacteria 2497
289 Ga0207641_10193239 3300026088 Bacteria 1872
290 Ga0207674_10000039 3300026116 Bacteria 131096
291 Ga0207674_10092964 3300026116 Bacteria 3005
292 Ga0207674_10146800 3300026116 Bacteria 2317
293 Ga0207675_100015653 3300026118 Bacteria 7073
294 Ga0207698_10003989 3300026142 Bacteria 8953
295 Ga0207698_10011251 3300026142 Bacteria 5792
296 Ga0207698_10019968 3300026142 Bacteria 4601
297 Ga0207698_10405485 3300026142 Bacteria 1304
298 Ga0209966_1002877 3300027695 Bacteria 2886
299 Ga0209998_10000758 3300027717 Bacteria 8460
300 Ga0207428_10014000 3300027907 Bacteria 6986
301 Ga0268264_10069274 3300028381 Bacteria 2983
302 Ga0265338_10033308 3300028800 Bacteria 5002
303 Ga0265338_10098428 3300028800 Bacteria 2393
304 Ga0265325_10000004 3300031241 Bacteria 347347
305 Ga0265325_10034833 3300031241 Bacteria 2676
306 Ga0265325_10043495 3300031241 Bacteria 2343
307 Ga0265325_10048228 3300031241 Bacteria 2202
308 Ga0265325_10086133 3300031241 Bacteria 1555
309 Ga0265340_10025334 3300031247 Bacteria 3004
310 Ga0265339_10010467 3300031249 Bacteria 5761
311 Ga0265316_10066828 3300031344 Bacteria 2781
312 Ga0265313_10009264 3300031595 Bacteria 6412
313 Ga0265313_10048143 3300031595 Bacteria 2059
314 Ga0265314_10016876 3300031711 Bacteria 5752
315 Ga0265342_10000182 3300031712 Bacteria 70252
316 Ga0307405_10072929 3300031731 Bacteria 2215
317 Ga0373930_0000532 3300034816 Bacteria 5242
318 Ga0373948_0000419 3300034817 Bacteria 5248
319 Ga0373950_0000167 3300034818 Bacteria 9380
320 Ga0373958_0002350 3300034819 Bacteria 2638
321 Ga0373938_0000028 3300034957 Bacteria 18996
322 Ga0373928_0000334 3300035084 Bacteria 9420
323 Ga0373929_0001866 3300035085 Bacteria 3948
324 Ga0373934_0001517 3300035086 Bacteria 8514
325 Ga0373934_0005199 3300035086 Bacteria 4815
326 Ga0373934_0012356 3300035086 Bacteria 3224
327 Ga0373934_0013164 3300035086 Bacteria 3124
328 Ga0373949_0001620 3300035090 Bacteria 6293
329 Ga0373951_0000666 3300035091 Bacteria 9448
330 Ga0373952_0000851 3300035092 Bacteria 5544
331 Ga0373923_0024586 3300035111 Bacteria 2378
332 Ga0373923_0049411 3300035111 Bacteria 1759
333 Ga0373932_0000749 3300035112 Bacteria 9676
334 Ga0373936_0005568 3300035113 Bacteria 4751
335 Ga0373939_0001838 3300035114 Bacteria 5105
336 Ga0373939_0016499 3300035114 Bacteria 1948
337 Ga0373941_0000671 3300035115 Bacteria 6933
338 Ga0373941_0005651 3300035115 Bacteria 2960
339 Ga0373945_0053045 3300035116 Bacteria 1496
340 Ga0373945_0097102 3300035116 Bacteria 1149
341 Ga0373953_0008219 3300035117 Bacteria 3533
342 Ga0373953_0012296 3300035117 Bacteria 3027
343 Ga0373953_0019942 3300035117 Bacteria 2501
344 Ga0373954_0000002 3300035118 Bacteria 147478
345 Ga0373954_0003738 3300035118 Bacteria 6489
346 Ga0373954_0006044 3300035118 Bacteria 5266
347 Ga0373954_0007284 3300035118 Bacteria 4836
348 Ga0373954_0014031 3300035118 Bacteria 3571
349 Ga0373956_0000945 3300035119 Bacteria 12079
350 Ga0373956_0002179 3300035119 Bacteria 8087
351 Ga0373956_0019484 3300035119 Bacteria 2877
352 Ga0373956_0107005 3300035119 Bacteria 1300
353 Ga0373957_0000339 3300035120 Bacteria 11828
354 Ga0373957_0002968 3300035120 Bacteria 4921
355 Ga0373957_0003036 3300035120 Bacteria 4882
356 Ga0373957_0024413 3300035120 Bacteria 2171
357 Ga0373960_0000599 3300035121 Bacteria 7394
358 Ga0373955_0001962 3300035172 Bacteria 8862
359 Ga0373955_0014629 3300035172 Bacteria 3822
360 Ga0373955_0028909 3300035172 Bacteria 2878
361 Ga0373955_0034110 3300035172 Bacteria 2684
362 Ga0373955_0064377 3300035172 Bacteria 2032
363 Ga0373955_0081179 3300035172 Bacteria 1833
364 Ga0373942_0005239 3300035207 Bacteria 3003
365 Ga0373961_0000433 3300035241 Bacteria 17272
366 Ga0373962_0000881 3300035242 Bacteria 6853
367 Ga0373924_0004417 3300035410 Bacteria 4909
368 Ga0373924_0025366 3300035410 Bacteria 2344
369 Ga0373924_0057243 3300035410 Bacteria 1625
370 Ga0373924_0117377 3300035410 Bacteria 1153
371 Ga0373935_0026607 3300035692 Bacteria 3572
372 Ga0373935_0057754 3300035692 Bacteria 2476
373 Ga0373935_0157622 3300035692 Bacteria 1545
374 Ga0373935_0296636 3300035692 Bacteria 1141
375 Ga0373927_0003675 3300035695 Bacteria 10916
376 Ga0373927_0093708 3300035695 Bacteria 1951
377 Ga0373927_0288887 3300035695 Bacteria 1079
378 Ga0373933_0000890 3300035724 Bacteria 18271
379 Ga0373933_0001687 3300035724 Bacteria 12853
380 Ga0373933_0001764 3300035724 Bacteria 12529
381 Ga0373933_0002111 3300035724 Bacteria 11412
382 Ga0373933_0005461 3300035724 Bacteria 6922
383 Ga0373933_0011582 3300035724 Bacteria 4865
384 Ga0373933_0041104 3300035724 Bacteria 2728
385 Ga0373933_0042536 3300035724 Bacteria 2685
386 Ga0373947_0063299 3300035725 Bacteria 2253
387 Ga0373947_0100781 3300035725 Bacteria 1815
388 Ga0373947_0115514 3300035725 Bacteria 1701
389 Ga0373947_0195698 3300035725 Unclassified 1321
390 Ga0373947_0203572 3300035725 Bacteria 1296
391 Ga0373937_0001304 3300036401 Bacteria 20884
392 Ga0373937_0001794 3300036401 Bacteria 18033
393 Ga0373937_0004227 3300036401 Bacteria 12173
394 Ga0373937_0005332 3300036401 Bacteria 10992
395 Ga0373937_0006421 3300036401 Bacteria 10147
396 Ga0373937_0007322 3300036401 Bacteria 9554
397 Ga0373937_0009035 3300036401 Bacteria 8651
398 Ga0373937_0027575 3300036401 Bacteria 5136
399 Ga0373937_0035972 3300036401 Bacteria 4510
400 Ga0373937_0087050 3300036401 Bacteria 2891
401 Ga0373937_0197854 3300036401 Bacteria 1889
402 Ga0439465_0047164 3300041413 Bacteria 1404
403 Ga0451853_1695856 3300041512 Bacteria 1978
404 Ga0453684_0140242 3300044712 Bacteria 2888
405 Ga0451576_0065472 3300045051 Bacteria 3784
406 Ga0495617_024276 3300046452 Bacteria 2046
407 Ga0495592_0000589 3300046454 Bacteria 25846
408 Ga0495592_0002245 3300046454 Bacteria 13625
409 Ga0495592_0028842 3300046454 Bacteria 4200
410 Ga0495592_0040216 3300046454 Bacteria 3509
411 Ga0495592_0075908 3300046454 Bacteria 2440
412 Ga0495603_0020971 3300046455 Bacteria 3957
413 Ga0495629_0013396 3300046459 Bacteria 5917
414 Ga0495651_0003925 3300046462 Bacteria 11374
415 Ga0495651_0021054 3300046462 Bacteria 5064
416 Ga0495651_0031350 3300046462 Bacteria 4145
417 Ga0495651_0037541 3300046462 Bacteria 3772
418 Ga0495651_0050023 3300046462 Bacteria 3225
419 Ga0495651_0115579 3300046462 Bacteria 1978
420 Ga0495651_0118498 3300046462 Bacteria 1948
421 Ga0495653_0001655 3300046463 Bacteria 17515
422 Ga0495653_0004752 3300046463 Bacteria 10998
423 Ga0495653_0059041 3300046463 Bacteria 2913
424 Ga0495653_0061026 3300046463 Bacteria 2854
425 Ga0495580_0050116 3300046472 Bacteria 2953
426 Ga0495582_0083300 3300046473 Bacteria 1777
427 Ga0495639_0007311 3300046475 Bacteria 4737
428 Ga0495662_0032507 3300046476 Bacteria 2520
429 Ga0495664_0005496 3300046477 Bacteria 6958
430 Ga0495664_0151611 3300046477 Bacteria 1406
431 Ga0495585_0008414 3300046492 Bacteria 6254
432 Ga0495594_0127852 3300046499 Bacteria 1438
433 Ga0495583_0083296 3300046506 Unclassified 1387
434 Ga0495608_0001793 3300046511 Bacteria 15332
435 Ga0495608_0001817 3300046511 Bacteria 15244
436 Ga0495608_0005922 3300046511 Bacteria 8694
437 Ga0495608_0021073 3300046511 Bacteria 4476
438 Ga0495608_0044062 3300046511 Bacteria 2979
439 Ga0495608_0072761 3300046511 Bacteria 2242
440 Ga0495608_0084732 3300046511 Bacteria 2055
441 Ga0495618_0008159 3300046514 Bacteria 6345
442 Ga0495618_0018196 3300046514 Bacteria 4314
443 Ga0495618_0072351 3300046514 Bacteria 2194
444 Ga0495618_0157805 3300046514 Bacteria 1447
445 Ga0495628_0004889 3300046516 Bacteria 11794
446 Ga0495628_0009824 3300046516 Bacteria 8149
447 Ga0495628_0014727 3300046516 Bacteria 6547
448 Ga0495628_0159097 3300046516 Bacteria 1717
449 Ga0495630_0027998 3300046517 Bacteria 4187
450 Ga0495630_0041594 3300046517 Bacteria 3432
451 Ga0495630_0122574 3300046517 Bacteria 1972
452 Ga0495630_0134107 3300046517 Bacteria 1881
453 Ga0495644_0014794 3300046523 Bacteria 2988
454 Ga0495652_0010464 3300046529 Bacteria 8406
455 Ga0495652_0013953 3300046529 Bacteria 7223
456 Ga0495652_0089741 3300046529 Bacteria 2516
457 Ga0495665_0069040 3300046531 Bacteria 1863
458 Ga0495640_0005362 3300046533 Bacteria 10199
459 Ga0495640_0013444 3300046533 Bacteria 6218
460 Ga0495640_0027536 3300046533 Bacteria 4098
461 Ga0495640_0041299 3300046533 Bacteria 3224
462 Ga0495586_0003545 3300046535 Bacteria 8364
463 Ga0495587_0002845 3300046536 Bacteria 11595
464 Ga0495587_0092504 3300046536 Bacteria 1746
465 Ga0495645_0002386 3300046543 Bacteria 12748
466 Ga0495645_0008213 3300046543 Bacteria 7280
467 Ga0495645_0109269 3300046543 Bacteria 1958
468 Ga0495633_0019628 3300046558 Bacteria 3416
469 Ga0495667_0013127 3300046559 Bacteria 5609
470 Ga0495667_0041422 3300046559 Bacteria 3055
471 Ga0495667_0045655 3300046559 Bacteria 2899
472 Ga0495667_0049843 3300046559 Bacteria 2764
473 Ga0495667_0257424 3300046559 Bacteria 1110
474 Ga0495656_0004034 3300046615 Bacteria 4992
475 Ga0495634_0013078 3300046642 Bacteria 6002
476 Ga0495634_0015313 3300046642 Bacteria 5513
477 Ga0495634_0023688 3300046642 Bacteria 4313
478 Ga0495634_0047376 3300046642 Bacteria 2897
479 Ga0495634_0067106 3300046642 Bacteria 2373
480 Ga0495635_0002748 3300046663 Bacteria 12065
481 Ga0495635_0004972 3300046663 Bacteria 9257
482 Ga0495635_0026001 3300046663 Bacteria 4076
483 Ga0495635_0038825 3300046663 Bacteria 3296
484 Ga0495659_0007696 3300046664 Bacteria 3415
485 Ga0495657_0001218 3300046675 Bacteria 22573
486 Ga0495657_0019008 3300046675 Bacteria 4964
487 Ga0495657_0058481 3300046675 Bacteria 2560
488 Ga0495657_0156584 3300046675 Bacteria 1411
489 Ga0495599_0000531 3300046678 Bacteria 21912
490 Ga0495599_0000970 3300046678 Bacteria 16055
491 Ga0495599_0007730 3300046678 Bacteria 6528
492 Ga0495599_0009604 3300046678 Bacteria 5919
493 Ga0495599_0017496 3300046678 Bacteria 4456
494 Ga0495599_0024588 3300046678 Bacteria 3766
495 Ga0495623_0000758 3300046679 Bacteria 21662
496 Ga0495623_0004324 3300046679 Bacteria 9345
497 Ga0495623_0050543 3300046679 Bacteria 2632
498 Ga0495623_0104799 3300046679 Bacteria 1719
499 Ga0495646_0000300 3300046680 Bacteria 25296
500 Ga0495646_0048164 3300046680 Bacteria 2591
501 Ga0495647_0003976 3300046681 Bacteria 4771
502 Ga0495658_0087110 3300046683 Bacteria 1844
503 Ga0495613_0035336 3300046689 Bacteria 3709
504 Ga0495624_0168486 3300046690 Bacteria 1336
505 Ga0495670_0001321 3300046691 Bacteria 12084
506 Ga0495600_0017662 3300046809 Bacteria 4539
507 Ga0495600_0019250 3300046809 Bacteria 4358
508 Ga0495600_0064413 3300046809 Bacteria 2396
509 Ga0495600_0087418 3300046809 Bacteria 2033
510 Ga0495604_0001425 3300047317 Bacteria 19626
511 Ga0495604_0015363 3300047317 Bacteria 6109
512 Ga0495604_0024413 3300047317 Bacteria 4823
513 Ga0495674_0005874 3300047319 Bacteria 11776
514 Ga0495674_0037354 3300047319 Bacteria 4364
515 Ga0495674_0054172 3300047319 Bacteria 3523
516 Ga0495674_0055682 3300047319 Bacteria 3467
517 Ga0495674_0069114 3300047319 Bacteria 3055
518 Ga0495680_0002651 3300047322 Bacteria 18113
519 Ga0495680_0007953 3300047322 Bacteria 9672
520 Ga0495680_0009557 3300047322 Bacteria 8711
521 Ga0495680_0016011 3300047322 Bacteria 6451
522 Ga0495680_0036732 3300047322 Bacteria 3930
523 Ga0495680_0057461 3300047322 Bacteria 3009
524 Ga0495680_0125557 3300047322 Bacteria 1890
525 Ga0495675_0001056 3300047444 Bacteria 16742
526 Ga0495675_0018474 3300047444 Bacteria 4425
527 Ga0495675_0021903 3300047444 Bacteria 4071
528 Ga0495684_0006100 3300047471 Bacteria 9377
529 Ga0495684_0019131 3300047471 Bacteria 5272
530 Ga0495684_0048498 3300047471 Bacteria 3247
531 Ga0495684_0097874 3300047471 Bacteria 2219
532 Ga0495684_0112796 3300047471 Bacteria 2050
533 Ga0495684_0116479 3300047471 Bacteria 2014
534 Ga0495593_0009724 3300047673 Bacteria 5579
535 Ga0495602_0003273 3300048088 Bacteria 16731
536 Ga0495602_0017308 3300048088 Bacteria 7227
537 Ga0495602_0037956 3300048088 Bacteria 4461
538 Ga0496101_0195827 3300048904 Bacteria 1561
539 Ga0496102_0210499 3300048905 Bacteria 1833
540 Ga0496103_0081016 3300048906 Bacteria 2042
541 Ga0496104_0000515 3300048907 Bacteria 33122
542 Ga0496104_0067549 3300048907 Bacteria 3396
543 Ga0496104_0080380 3300048907 Bacteria 3108
544 Ga0496105_0244461 3300048908 Bacteria 1455
545 Ga0496106_0015310 3300048909 Bacteria 5674
546 Ga0496106_0158605 3300048909 Bacteria 1788
547 Ga0496107_0015088 3300048910 Bacteria 5413
548 Ga0496107_0090827 3300048910 Bacteria 2231
549 Ga0496108_0008991 3300048911 Bacteria 8095
550 Ga0496109_0001064 3300048912 Bacteria 22726
551 Ga0496109_0113508 3300048912 Bacteria 2520
552 Ga0496110_0193022 3300048913 Bacteria 1849
553 Ga0496111_0055737 3300048914 Bacteria 2859
554 Ga0496111_0081328 3300048914 Bacteria 2365
555 Ga0496111_0148541 3300048914 Bacteria 1738
556 Ga0496112_0075018 3300048915 Bacteria 3344
557 Ga0496113_0004800 3300048916 Bacteria 8356
558 Ga0496115_0045598 3300048918 Bacteria 3500
559 Ga0496115_0138609 3300048918 Bacteria 2006
560 Ga0501031_0001427 3300049568 Bacteria 14803
561 Ga0501032_0002436 3300049569 Bacteria 14522
562 Ga0501032_0062303 3300049569 Bacteria 2499
563 Ga0501033_0000244 3300049570 Bacteria 52231
564 Ga0501033_0013241 3300049570 Bacteria 6285
565 Ga0501034_0000159 3300049571 Bacteria 127397
566 Ga0501034_0031979 3300049571 Bacteria 5345
567 Ga0501034_0046375 3300049571 Bacteria 4391
568 Ga0501034_0187526 3300049571 Bacteria 2031
569 Ga0501036_0000039 3300049572 Bacteria 83065
570 Ga0501036_0079493 3300049572 Bacteria 2773
571 Ga0501037_0003835 3300049573 Bacteria 10914
572 Ga0501038_0001751 3300049574 Bacteria 20170
573 Ga0501038_0062161 3300049574 Bacteria 3191
574 Ga0501038_0265310 3300049574 Bacteria 1355
575 Ga0501039_0001324 3300049575 Bacteria 18083
576 Ga0501039_0101558 3300049575 Bacteria 2245
577 Ga0501042_0064050 3300049578 Bacteria 2627
578 Ga0501043_0030468 3300049579 Bacteria 4240
579 Ga0501046_0000185 3300049580 Bacteria 63459
580 Ga0501047_0000385 3300049581 Bacteria 49635
581 Ga0501047_0010053 3300049581 Bacteria 8943
582 Ga0501047_0133021 3300049581 Bacteria 2367
583 Ga0501047_0157297 3300049581 Bacteria 2146
584 Ga0501047_0315416 3300049581 Bacteria 1404
585 Ga0501048_0007283 3300049582 Bacteria 8389
586 Ga0501048_0335808 3300049582 Bacteria 1077
587 Ga0501067_0000513 3300049583 Bacteria 21187
588 Ga0501068_0001337 3300049584 Bacteria 13064
589 Ga0501068_0026119 3300049584 Bacteria 3438
590 Ga0501069_0006089 3300049585 Bacteria 6296
591 Ga0501069_0149490 3300049585 Bacteria 1342
592 Ga0501070_0003256 3300049586 Bacteria 14098
593 Ga0501070_0008612 3300049586 Bacteria 8626
594 Ga0501070_0010383 3300049586 Bacteria 7871
595 Ga0501070_0112369 3300049586 Bacteria 2251
596 Ga0501072_0001656 3300049588 Bacteria 16623
597 Ga0501072_0038222 3300049588 Bacteria 3766
598 Ga0501072_0106012 3300049588 Bacteria 2235
599 Ga0501073_0000374 3300049589 Bacteria 30124
600 Ga0501073_0000702 3300049589 Bacteria 23614
601 Ga0501073_0025314 3300049589 Bacteria 4257
602 Ga0501073_0045790 3300049589 Bacteria 3080
603 Ga0501073_0115244 3300049589 Bacteria 1863
604 Ga0501074_0000125 3300049590 Bacteria 39203
605 Ga0501074_0001567 3300049590 Bacteria 15466
606 Ga0501074_0148255 3300049590 Bacteria 1678
607 Ga0501079_0026149 3300049741 Bacteria 4475
608 Ga0501079_0085132 3300049741 Bacteria 2446
609 Ga0501080_0000380 3300049742 Bacteria 34213
610 Ga0501080_0001529 3300049742 Bacteria 19540
611 Ga0501080_0007162 3300049742 Bacteria 10065
612 Ga0501080_0227275 3300049742 Bacteria 1706
613 Ga0501080_0287175 3300049742 Bacteria 1494
614 Ga0501083_0001646 3300049744 Bacteria 15245
615 Ga0501083_0004058 3300049744 Bacteria 10302
616 Ga0501083_0017169 3300049744 Bacteria 5048
617 Ga0501035_0001985 3300049822 Bacteria 20460
618 Ga0501035_0026028 3300049822 Bacteria 5358
619 Ga0501035_0045442 3300049822 Bacteria 3951
620 Ga0501035_0059100 3300049822 Bacteria 3414
621 Ga0501035_0306211 3300049822 Bacteria 1338
622 Ga0501044_0001993 3300049823 Bacteria 23587
623 Ga0501044_0171954 3300049823 Bacteria 2137
624 Ga0501044_0172377 3300049823 Bacteria 2134
625 Ga0501044_0475538 3300049823 Bacteria 1153
626 nmdc:mga0yw44_56609_c1 3300050492 Bacteria 2390
627 nmdc:mga07m45_24106_c2 3300050496 Bacteria 2611
628 nmdc:mga08y16_14377_c1 3300050511 Bacteria 8332
629 nmdc:mga0n895_41223_c1 3300050512 Bacteria 4487
630 nmdc:mga0a205_65088_c1 3300050515 Bacteria 3521
631 Ga0495601_0000731 3300053077 Bacteria 17670
632 Ga0495601_0001011 3300053077 Bacteria 15401
633 Ga0495601_0005133 3300053077 Bacteria 7610
634 Ga0495601_0006865 3300053077 Bacteria 6668
635 Ga0495601_0010360 3300053077 Bacteria 5545
636 Ga0495601_0011836 3300053077 Bacteria 5232
637 Ga0495601_0012932 3300053077 Bacteria 5011
638 Ga0495612_0006577 3300053078 Bacteria 4768
639 Ga0495612_0007659 3300053078 Bacteria 4411
640 Ga0495595_0000356 3300053084 Bacteria 17378
641 Ga0495595_0001701 3300053084 Bacteria 8618
642 Ga0495595_0001936 3300053084 Bacteria 8032
643 Ga0495595_0002476 3300053084 Bacteria 7225
644 Ga0495619_0001094 3300053085 Bacteria 17821
645 Ga0495619_0010836 3300053085 Bacteria 5737
646 Ga0495619_0013399 3300053085 Bacteria 5167
647 Ga0495619_0030417 3300053085 Bacteria 3496
648 Ga0495619_0034502 3300053085 Bacteria 3289
649 Ga0495619_0105669 3300053085 Bacteria 1920
650 Ga0495619_0243271 3300053085 Bacteria 1247
651 Ga0500652_004490 3300053131 Bacteria 4324
652 Ga0501084_0023641 3300054114 Bacteria 5125
653 Ga0501082_0000570 3300060353 Bacteria 32833
654 Ga0501082_0026405 3300060353 Bacteria 5004
655 Ga0501082_0086600 3300060353 Bacteria 2702
656 Ga0501082_0173828 3300060353 Bacteria 1873
657 Ga0530510_0149019 3300061734 Bacteria 1727

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0315416 Ga0501047_0315416_31_1059 288
2 3300049823 Ga0501044_0001993 Ga0501044_0001993_16281_17309 288
3 3300009101 Ga0105247_10013648 Ga0105247_100136482 290
4 3300011119 Ga0105246_10014859 Ga0105246_100148592 290
5 3300013306 Ga0163162_10056217 Ga0163162_100562174 290
6 3300013308 Ga0157375_10015977 Ga0157375_100159774 290
7 3300014325 Ga0163163_10001222 Ga0163163_1000122215 290
8 3300014745 Ga0157377_10030644 Ga0157377_100306442 290
9 3300035692 Ga0373935_0296636 Ga0373935_0296636_49_1071 292
10 3300046476 Ga0495662_0032507 Ga0495662_0032507_1271_2293 292
11 3300005546 Ga0070696_100094394 Ga0070696_1000943942 297
12 3300005615 Ga0070702_100025455 Ga0070702_1000254554 297
13 3300005543 Ga0070672_100342037 Ga0070672_1003420372 298
14 3300046533 Ga0495640_0041299 Ga0495640_0041299_358_1353 299
15 3300046642 Ga0495634_0047376 Ga0495634_0047376_823_1818 299
16 3300047471 Ga0495684_0097874 Ga0495684_0097874_1102_2097 299
17 3300025944 Ga0207661_10259003 Ga0207661_102590033 300
18 3300031731 Ga0307405_10072929 Ga0307405_100729293 300
19 3300025949 Ga0207667_10070130 Ga0207667_100701303 304
20 3300013104 Ga0157370_10136016 Ga0157370_101360162 306
21 3300047322 Ga0495680_0057461 Ga0495680_0057461_1623_2573 306
22 3300049581 Ga0501047_0157297 Ga0501047_0157297_483_1487 306
23 3300025919 Ga0207657_10262520 Ga0207657_102625202 308
24 3300006237 Ga0097621_100040496 Ga0097621_1000404963 309
25 3300006358 Ga0068871_100028870 Ga0068871_1000288702 309
26 3300009098 Ga0105245_10102254 Ga0105245_101022543 309
27 3300013297 Ga0157378_10302397 Ga0157378_103023971 309
28 3300013306 Ga0163162_10241467 Ga0163162_102414672 309
29 3300014969 Ga0157376_10247744 Ga0157376_102477442 309
30 3300025927 Ga0207687_10022697 Ga0207687_100226974 309
31 3300025934 Ga0207686_10241750 Ga0207686_102417502 309
32 3300005439 Ga0070711_100046980 Ga0070711_1000469802 310
33 3300009174 Ga0105241_10013737 Ga0105241_100137376 310
34 3300009551 Ga0105238_10009355 Ga0105238_100093553 310
35 3300025928 Ga0207700_10212529 Ga0207700_102125292 310
36 3300026116 Ga0207674_10146800 Ga0207674_101468001 311
37 3300041413 Ga0439465_0047164 Ga0439465_0047164_209_1159 311
38 3300005436 Ga0070713_100043614 Ga0070713_1000436142 312
39 3300005563 Ga0068855_100008252 Ga0068855_1000082526 312
40 3300013104 Ga0157370_10001270 Ga0157370_1000127011 312
41 3300025949 Ga0207667_10038687 Ga0207667_100386873 312
42 3300049823 Ga0501044_0475538 Ga0501044_0475538_158_1138 312
43 iso_pu_bacteria 2643221564 2643838558 312
44 3300003911 JGI25405J52794_10017317 JGI25405J52794_100173171 313
45 3300005937 Ga0081455_10010000 Ga0081455_100100004 313
46 3300006038 Ga0075365_10025911 Ga0075365_100259112 313
47 3300006051 Ga0075364_10148885 Ga0075364_101488852 313
48 3300025927 Ga0207687_10233088 Ga0207687_102330882 313
49 3300035172 Ga0373955_0081179 Ga0373955_0081179_311_1303 313
50 3300035724 Ga0373933_0005461 Ga0373933_0005461_2577_3569 313
51 3300036401 Ga0373937_0027575 Ga0373937_0027575_571_1563 313
52 3300049744 Ga0501083_0017169 Ga0501083_0017169_4017_5012 313
53 3300050492 nmdc:mga0yw44_56609_c1 nmdc:mga0yw44_56609_c1_292_1287 313
54 3300053131 Ga0500652_004490 Ga0500652_004490_3304_4293 313
55 iso_pu_bacteria 2643221547 2643754663 313
56 3300005327 Ga0070658_10147435 Ga0070658_101474352 314
57 3300005329 Ga0070683_100035510 Ga0070683_1000355101 314
58 3300005336 Ga0070680_100069612 Ga0070680_1000696122 314
59 3300005338 Ga0068868_100074621 Ga0068868_1000746212 314
60 3300005437 Ga0070710_10043415 Ga0070710_100434152 314
61 3300005530 Ga0070679_100186321 Ga0070679_1001863213 314
62 3300005535 Ga0070684_100076053 Ga0070684_1000760531 314
63 3300005563 Ga0068855_100192890 Ga0068855_1001928902 314
64 3300005616 Ga0068852_100000554 Ga0068852_1000005547 314
65 3300005616 Ga0068852_100004557 Ga0068852_1000045579 314
66 3300005616 Ga0068852_100083301 Ga0068852_1000833012 314
67 3300005842 Ga0068858_100024666 Ga0068858_1000246662 314
68 3300005983 Ga0081540_1003907 Ga0081540_10039073 314
69 3300006175 Ga0070712_100014927 Ga0070712_1000149273 314
70 3300006237 Ga0097621_100097801 Ga0097621_1000978013 314
71 3300006358 Ga0068871_100009241 Ga0068871_1000092414 314
72 3300009176 Ga0105242_10003746 Ga0105242_100037463 314
73 3300009551 Ga0105238_10018906 Ga0105238_100189066 314
74 3300009551 Ga0105238_10198599 Ga0105238_101985992 314
75 3300013104 Ga0157370_10238178 Ga0157370_102381782 314
76 3300013105 Ga0157369_10002601 Ga0157369_100026013 314
77 3300013296 Ga0157374_10154841 Ga0157374_101548413 314
78 3300013306 Ga0163162_10114262 Ga0163162_101142623 314
79 3300013307 Ga0157372_10004580 Ga0157372_1000458010 314
80 3300014968 Ga0157379_10134030 Ga0157379_101340302 314
81 3300025906 Ga0207699_10052120 Ga0207699_100521203 314
82 3300025909 Ga0207705_10060216 Ga0207705_100602162 314
83 3300025909 Ga0207705_10102758 Ga0207705_101027582 314
84 3300025924 Ga0207694_10014709 Ga0207694_100147096 314
85 3300025924 Ga0207694_10085831 Ga0207694_100858312 314
86 3300025934 Ga0207686_10017403 Ga0207686_100174033 314
87 3300025935 Ga0207709_10092973 Ga0207709_100929732 314
88 3300025939 Ga0207665_10242423 Ga0207665_102424231 314
89 3300025941 Ga0207711_10116633 Ga0207711_101166333 314
90 3300025949 Ga0207667_10018592 Ga0207667_100185923 314
91 3300025949 Ga0207667_10152458 Ga0207667_101524581 314
92 3300026035 Ga0207703_10108888 Ga0207703_101088882 314
93 3300026041 Ga0207639_10225641 Ga0207639_102256412 314
94 3300026078 Ga0207702_10105381 Ga0207702_101053813 314
95 3300026142 Ga0207698_10011251 Ga0207698_100112516 314
96 3300026142 Ga0207698_10019968 Ga0207698_100199683 314
97 3300035115 Ga0373941_0005651 Ga0373941_0005651_1294_2286 314
98 3300035120 Ga0373957_0024413 Ga0373957_0024413_1017_2009 314
99 3300035172 Ga0373955_0014629 Ga0373955_0014629_400_1392 314
100 3300035692 Ga0373935_0157622 Ga0373935_0157622_262_1254 314
101 3300035724 Ga0373933_0011582 Ga0373933_0011582_31_1023 314
102 3300036401 Ga0373937_0009035 Ga0373937_0009035_3736_4728 314
103 3300036401 Ga0373937_0035972 Ga0373937_0035972_872_1864 314
104 3300036401 Ga0373937_0197854 Ga0373937_0197854_100_1098 314
105 3300041512 Ga0451853_1695856 Ga0451853_1695856_383_1375 314
106 3300046454 Ga0495592_0075908 Ga0495592_0075908_113_1105 314
107 3300046463 Ga0495653_0061026 Ga0495653_0061026_1500_2492 314
108 3300046511 Ga0495608_0044062 Ga0495608_0044062_1738_2730 314
109 3300046511 Ga0495608_0072761 Ga0495608_0072761_85_1077 314
110 3300046516 Ga0495628_0159097 Ga0495628_0159097_226_1218 314
111 3300046517 Ga0495630_0134107 Ga0495630_0134107_639_1631 314
112 3300046536 Ga0495587_0002845 Ga0495587_0002845_6055_7047 314
113 3300046543 Ga0495645_0002386 Ga0495645_0002386_903_1895 314
114 3300046559 Ga0495667_0045655 Ga0495667_0045655_1463_2455 314
115 3300046559 Ga0495667_0049843 Ga0495667_0049843_453_1445 314
116 3300046559 Ga0495667_0257424 Ga0495667_0257424_27_1025 314
117 3300046678 Ga0495599_0000531 Ga0495599_0000531_2371_3363 314
118 3300046679 Ga0495623_0004324 Ga0495623_0004324_3064_4056 314
119 3300046809 Ga0495600_0064413 Ga0495600_0064413_205_1197 314
120 3300047322 Ga0495680_0036732 Ga0495680_0036732_2613_3605 314
121 3300048907 Ga0496104_0067549 Ga0496104_0067549_377_1369 314
122 3300048908 Ga0496105_0244461 Ga0496105_0244461_166_1158 314
123 3300048913 Ga0496110_0193022 Ga0496110_0193022_254_1246 314
124 3300048914 Ga0496111_0148541 Ga0496111_0148541_599_1591 314
125 3300049568 Ga0501031_0001427 Ga0501031_0001427_5867_6862 314
126 3300049569 Ga0501032_0002436 Ga0501032_0002436_8774_9769 314
127 3300049569 Ga0501032_0062303 Ga0501032_0062303_124_1116 314
128 3300049570 Ga0501033_0000244 Ga0501033_0000244_47590_48585 314
129 3300049570 Ga0501033_0013241 Ga0501033_0013241_3855_4847 314
130 3300049571 Ga0501034_0000159 Ga0501034_0000159_3647_4642 314
131 3300049572 Ga0501036_0000039 Ga0501036_0000039_4680_5675 314
132 3300049572 Ga0501036_0079493 Ga0501036_0079493_365_1357 314
133 3300049573 Ga0501037_0003835 Ga0501037_0003835_7792_8787 314
134 3300049574 Ga0501038_0001751 Ga0501038_0001751_8312_9307 314
135 3300049574 Ga0501038_0265310 Ga0501038_0265310_201_1193 314
136 3300049575 Ga0501039_0001324 Ga0501039_0001324_14108_15103 314
137 3300049578 Ga0501042_0064050 Ga0501042_0064050_421_1416 314
138 3300049579 Ga0501043_0030468 Ga0501043_0030468_2710_3702 314
139 3300049580 Ga0501046_0000185 Ga0501046_0000185_56632_57627 314
140 3300049581 Ga0501047_0000385 Ga0501047_0000385_44994_45989 314
141 3300049582 Ga0501048_0007283 Ga0501048_0007283_5106_6101 314
142 3300049583 Ga0501067_0000513 Ga0501067_0000513_5681_6676 314
143 3300049584 Ga0501068_0001337 Ga0501068_0001337_2859_3851 314
144 3300049584 Ga0501068_0026119 Ga0501068_0026119_2157_3152 314
145 3300049586 Ga0501070_0008612 Ga0501070_0008612_3109_4104 314
146 3300049586 Ga0501070_0010383 Ga0501070_0010383_6708_7700 314
147 3300049588 Ga0501072_0001656 Ga0501072_0001656_1134_2129 314
148 3300049588 Ga0501072_0106012 Ga0501072_0106012_943_1926 314
149 3300049589 Ga0501073_0000702 Ga0501073_0000702_2981_3976 314
150 3300049589 Ga0501073_0025314 Ga0501073_0025314_2133_3125 314
151 3300049590 Ga0501074_0001567 Ga0501074_0001567_2981_3976 314
152 3300049741 Ga0501079_0026149 Ga0501079_0026149_2052_3047 314
153 3300049741 Ga0501079_0085132 Ga0501079_0085132_1322_2314 314
154 3300049742 Ga0501080_0000380 Ga0501080_0000380_30110_31105 314
155 3300049742 Ga0501080_0287175 Ga0501080_0287175_10_1002 314
156 3300049744 Ga0501083_0004058 Ga0501083_0004058_2793_3788 314
157 3300049822 Ga0501035_0001985 Ga0501035_0001985_15164_16159 314
158 3300049822 Ga0501035_0026028 Ga0501035_0026028_2937_3920 314
159 3300049822 Ga0501035_0045442 Ga0501035_0045442_1792_2784 314
160 3300050512 nmdc:mga0n895_41223_c1 nmdc:mga0n895_41223_c1_2343_3302 314
161 3300053077 Ga0495601_0010360 Ga0495601_0010360_891_1883 314
162 3300053085 Ga0495619_0013399 Ga0495619_0013399_171_1163 314
163 3300053085 Ga0495619_0243271 Ga0495619_0243271_199_1194 314
164 3300054114 Ga0501084_0023641 Ga0501084_0023641_3471_4466 314
165 3300060353 Ga0501082_0000570 Ga0501082_0000570_3650_4645 314
166 3300061734 Ga0530510_0149019 Ga0530510_0149019_464_1459 314
167 3300005434 Ga0070709_10144689 Ga0070709_101446892 315
168 3300005435 Ga0070714_100245884 Ga0070714_1002458842 315
169 3300005436 Ga0070713_100165511 Ga0070713_1001655112 315
170 3300009551 Ga0105238_10266416 Ga0105238_102664162 315
171 3300013307 Ga0157372_10126363 Ga0157372_101263633 315
172 3300025918 Ga0207662_10208455 Ga0207662_102084551 315
173 3300025941 Ga0207711_10067338 Ga0207711_100673382 315
174 3300025986 Ga0207658_10011174 Ga0207658_100111744 315
175 3300026035 Ga0207703_10047022 Ga0207703_100470223 315
176 3300026142 Ga0207698_10405485 Ga0207698_104054851 315
177 3300031711 Ga0265314_10016876 Ga0265314_100168761 315
178 3300035086 Ga0373934_0001517 Ga0373934_0001517_3239_4255 315
179 3300035116 Ga0373945_0053045 Ga0373945_0053045_109_1095 315
180 3300035118 Ga0373954_0000002 Ga0373954_0000002_140266_141264 315
181 3300035410 Ga0373924_0117377 Ga0373924_0117377_63_1061 315
182 3300035724 Ga0373933_0001764 Ga0373933_0001764_1555_2553 315
183 3300036401 Ga0373937_0001304 Ga0373937_0001304_12281_13279 315
184 3300036401 Ga0373937_0007322 Ga0373937_0007322_8374_9363 315
185 3300046454 Ga0495592_0028842 Ga0495592_0028842_3129_4127 315
186 3300046472 Ga0495580_0050116 Ga0495580_0050116_825_1823 315
187 3300046475 Ga0495639_0007311 Ga0495639_0007311_3054_4052 315
188 3300046477 Ga0495664_0151611 Ga0495664_0151611_160_1146 315
189 3300046511 Ga0495608_0001817 Ga0495608_0001817_9348_10346 315
190 3300046514 Ga0495618_0018196 Ga0495618_0018196_212_1198 315
191 3300046517 Ga0495630_0122574 Ga0495630_0122574_186_1184 315
192 3300046533 Ga0495640_0027536 Ga0495640_0027536_2364_3350 315
193 3300046535 Ga0495586_0003545 Ga0495586_0003545_1615_2613 315
194 3300046642 Ga0495634_0015313 Ga0495634_0015313_3514_4512 315
195 3300046678 Ga0495599_0007730 Ga0495599_0007730_526_1524 315
196 3300046689 Ga0495613_0035336 Ga0495613_0035336_2454_3452 315
197 3300047317 Ga0495604_0015363 Ga0495604_0015363_2243_3241 315
198 3300047319 Ga0495674_0037354 Ga0495674_0037354_2006_2992 315
199 3300047322 Ga0495680_0007953 Ga0495680_0007953_5933_6931 315
200 3300047471 Ga0495684_0048498 Ga0495684_0048498_1570_2556 315
201 3300049571 Ga0501034_0031979 Ga0501034_0031979_901_1890 315
202 3300049574 Ga0501038_0062161 Ga0501038_0062161_1031_2020 315
203 3300049822 Ga0501035_0059100 Ga0501035_0059100_2170_3159 315
204 3300049823 Ga0501044_0171954 Ga0501044_0171954_1060_2049 315
205 3300053077 Ga0495601_0012932 Ga0495601_0012932_3356_4342 315
206 3300053085 Ga0495619_0030417 Ga0495619_0030417_1861_2847 315
207 3300005327 Ga0070658_10012028 Ga0070658_100120285 316
208 3300005327 Ga0070658_10089225 Ga0070658_100892253 316
209 3300005329 Ga0070683_100029663 Ga0070683_1000296632 316
210 3300005339 Ga0070660_100007264 Ga0070660_1000072645 316
211 3300005344 Ga0070661_100000534 Ga0070661_10000053427 316
212 3300005344 Ga0070661_100013055 Ga0070661_1000130553 316
213 3300005366 Ga0070659_100094240 Ga0070659_1000942402 316
214 3300005434 Ga0070709_10008931 Ga0070709_100089312 316
215 3300005435 Ga0070714_100004852 Ga0070714_1000048525 316
216 3300005435 Ga0070714_100071605 Ga0070714_1000716052 316
217 3300005435 Ga0070714_100075499 Ga0070714_1000754993 316
218 3300005436 Ga0070713_100233619 Ga0070713_1002336191 316
219 3300005439 Ga0070711_100021985 Ga0070711_1000219853 316
220 3300005458 Ga0070681_10004821 Ga0070681_100048214 316
221 3300005458 Ga0070681_10060239 Ga0070681_100602392 316
222 3300005458 Ga0070681_10104672 Ga0070681_101046722 316
223 3300005518 Ga0070699_100015846 Ga0070699_1000158462 316
224 3300005530 Ga0070679_100016685 Ga0070679_1000166857 316
225 3300005530 Ga0070679_100111202 Ga0070679_1001112022 316
226 3300005535 Ga0070684_100008632 Ga0070684_1000086323 316
227 3300005539 Ga0068853_100004769 Ga0068853_1000047694 316
228 3300005546 Ga0070696_100001722 Ga0070696_1000017222 316
229 3300005563 Ga0068855_100007766 Ga0068855_1000077664 316
230 3300005563 Ga0068855_100069930 Ga0068855_1000699302 316
231 3300005563 Ga0068855_100073898 Ga0068855_1000738983 316
232 3300005563 Ga0068855_100217464 Ga0068855_1002174642 316
233 3300005564 Ga0070664_100001929 Ga0070664_1000019291 316
234 3300005577 Ga0068857_100001319 Ga0068857_10000131910 316
235 3300005577 Ga0068857_100117321 Ga0068857_1001173213 316
236 3300005577 Ga0068857_100254726 Ga0068857_1002547261 316
237 3300005578 Ga0068854_100016881 Ga0068854_1000168813 316
238 3300005578 Ga0068854_100170336 Ga0068854_1001703361 316
239 3300005614 Ga0068856_100003061 Ga0068856_1000030612 316
240 3300005614 Ga0068856_100138006 Ga0068856_1001380063 316
241 3300005614 Ga0068856_100177033 Ga0068856_1001770332 316
242 3300005616 Ga0068852_100002959 Ga0068852_1000029594 316
243 3300005616 Ga0068852_100086236 Ga0068852_1000862362 316
244 3300005616 Ga0068852_100233337 Ga0068852_1002333372 316
245 3300005834 Ga0068851_10008121 Ga0068851_100081212 316
246 3300009093 Ga0105240_10002585 Ga0105240_1000258526 316
247 3300009093 Ga0105240_10007789 Ga0105240_1000778911 316
248 3300009093 Ga0105240_10026466 Ga0105240_100264663 316
249 3300009174 Ga0105241_10033974 Ga0105241_100339743 316
250 3300009545 Ga0105237_10162124 Ga0105237_101621242 316
251 3300009551 Ga0105238_10005650 Ga0105238_100056503 316
252 3300009551 Ga0105238_10156841 Ga0105238_101568413 316
253 3300013100 Ga0157373_10119000 Ga0157373_101190001 316
254 3300013102 Ga0157371_10019442 Ga0157371_100194423 316
255 3300013102 Ga0157371_10041023 Ga0157371_100410233 316
256 3300013104 Ga0157370_10003871 Ga0157370_100038712 316
257 3300013104 Ga0157370_10009975 Ga0157370_100099757 316
258 3300013104 Ga0157370_10020607 Ga0157370_100206076 316
259 3300013105 Ga0157369_10000895 Ga0157369_1000089520 316
260 3300013105 Ga0157369_10196083 Ga0157369_101960833 316
261 3300013105 Ga0157369_10399800 Ga0157369_103998001 316
262 3300013296 Ga0157374_10081300 Ga0157374_100813002 316
263 3300013307 Ga0157372_10022454 Ga0157372_100224543 316
264 3300013307 Ga0157372_10027347 Ga0157372_100273473 316
265 3300013307 Ga0157372_10034933 Ga0157372_100349334 316
266 3300025321 Ga0207656_10088259 Ga0207656_100882592 316
267 3300025898 Ga0207692_10004582 Ga0207692_100045824 316
268 3300025909 Ga0207705_10016504 Ga0207705_100165042 316
269 3300025909 Ga0207705_10019680 Ga0207705_100196805 316
270 3300025911 Ga0207654_10023112 Ga0207654_100231123 316
271 3300025911 Ga0207654_10023523 Ga0207654_100235232 316
272 3300025912 Ga0207707_10028062 Ga0207707_100280625 316
273 3300025912 Ga0207707_10194815 Ga0207707_101948153 316
274 3300025912 Ga0207707_10457711 Ga0207707_104577111 316
275 3300025913 Ga0207695_10004433 Ga0207695_100044333 316
276 3300025913 Ga0207695_10017259 Ga0207695_100172593 316
277 3300025913 Ga0207695_10032370 Ga0207695_100323703 316
278 3300025913 Ga0207695_10130049 Ga0207695_101300493 316
279 3300025914 Ga0207671_10060402 Ga0207671_100604022 316
280 3300025917 Ga0207660_10195634 Ga0207660_101956342 316
281 3300025917 Ga0207660_10223221 Ga0207660_102232211 316
282 3300025919 Ga0207657_10009889 Ga0207657_100098893 316
283 3300025920 Ga0207649_10002364 Ga0207649_100023643 316
284 3300025920 Ga0207649_10019384 Ga0207649_100193843 316
285 3300025920 Ga0207649_10032953 Ga0207649_100329533 316
286 3300025921 Ga0207652_10008705 Ga0207652_100087057 316
287 3300025921 Ga0207652_10041447 Ga0207652_100414473 316
288 3300025922 Ga0207646_10077035 Ga0207646_100770353 316
289 3300025924 Ga0207694_10002378 Ga0207694_1000237812 316
290 3300025924 Ga0207694_10035460 Ga0207694_100354603 316
291 3300025924 Ga0207694_10058866 Ga0207694_100588663 316
292 3300025928 Ga0207700_10137977 Ga0207700_101379773 316
293 3300025929 Ga0207664_10003344 Ga0207664_100033447 316
294 3300025929 Ga0207664_10007925 Ga0207664_100079252 316
295 3300025929 Ga0207664_10023865 Ga0207664_100238654 316
296 3300025932 Ga0207690_10094227 Ga0207690_100942272 316
297 3300025932 Ga0207690_10107839 Ga0207690_101078391 316
298 3300025944 Ga0207661_10081182 Ga0207661_100811822 316
299 3300025949 Ga0207667_10001311 Ga0207667_100013113 316
300 3300025949 Ga0207667_10048328 Ga0207667_100483282 316
301 3300025949 Ga0207667_10142924 Ga0207667_101429242 316
302 3300025981 Ga0207640_10042585 Ga0207640_100425851 316
303 3300025981 Ga0207640_10154434 Ga0207640_101544342 316
304 3300026041 Ga0207639_10016878 Ga0207639_100168782 316
305 3300026078 Ga0207702_10002277 Ga0207702_100022774 316
306 3300026116 Ga0207674_10000039 Ga0207674_1000003968 316
307 3300026116 Ga0207674_10092964 Ga0207674_100929643 316
308 3300026142 Ga0207698_10003989 Ga0207698_100039898 316
309 3300028800 Ga0265338_10033308 Ga0265338_100333086 316
310 3300028800 Ga0265338_10098428 Ga0265338_100984282 316
311 3300031241 Ga0265325_10034833 Ga0265325_100348333 316
312 3300031241 Ga0265325_10086133 Ga0265325_100861332 316
313 3300031247 Ga0265340_10025334 Ga0265340_100253343 316
314 3300031712 Ga0265342_10000182 Ga0265342_1000018250 316
315 3300035086 Ga0373934_0012356 Ga0373934_0012356_1973_2944 316
316 3300035086 Ga0373934_0013164 Ga0373934_0013164_563_1564 316
317 3300035111 Ga0373923_0024586 Ga0373923_0024586_330_1331 316
318 3300035113 Ga0373936_0005568 Ga0373936_0005568_687_1688 316
319 3300035117 Ga0373953_0012296 Ga0373953_0012296_1620_2621 316
320 3300035117 Ga0373953_0019942 Ga0373953_0019942_821_1792 316
321 3300035118 Ga0373954_0003738 Ga0373954_0003738_67_1068 316
322 3300035118 Ga0373954_0006044 Ga0373954_0006044_3256_4227 316
323 3300035119 Ga0373956_0002179 Ga0373956_0002179_4985_5956 316
324 3300035119 Ga0373956_0019484 Ga0373956_0019484_1329_2330 316
325 3300035119 Ga0373956_0107005 Ga0373956_0107005_225_1235 316
326 3300035120 Ga0373957_0002968 Ga0373957_0002968_3246_4247 316
327 3300035172 Ga0373955_0028909 Ga0373955_0028909_900_1871 316
328 3300035172 Ga0373955_0034110 Ga0373955_0034110_409_1410 316
329 3300035410 Ga0373924_0004417 Ga0373924_0004417_1381_2382 316
330 3300035692 Ga0373935_0057754 Ga0373935_0057754_1154_2149 316
331 3300035695 Ga0373927_0288887 Ga0373927_0288887_73_1068 316
332 3300035724 Ga0373933_0002111 Ga0373933_0002111_6585_7556 316
333 3300035724 Ga0373933_0042536 Ga0373933_0042536_16_1017 316
334 3300035725 Ga0373947_0063299 Ga0373947_0063299_897_1892 316
335 3300035725 Ga0373947_0100781 Ga0373947_0100781_769_1764 316
336 3300035725 Ga0373947_0195698 Ga0373947_0195698_151_1146 316
337 3300035725 Ga0373947_0203572 Ga0373947_0203572_137_1132 316
338 3300036401 Ga0373937_0005332 Ga0373937_0005332_3739_4710 316
339 3300046452 Ga0495617_024276 Ga0495617_024276_454_1449 316
340 3300046455 Ga0495603_0020971 Ga0495603_0020971_2454_3449 316
341 3300046462 Ga0495651_0021054 Ga0495651_0021054_1967_2968 316
342 3300046462 Ga0495651_0037541 Ga0495651_0037541_2690_3661 316
343 3300046462 Ga0495651_0118498 Ga0495651_0118498_232_1227 316
344 3300046463 Ga0495653_0059041 Ga0495653_0059041_1067_2068 316
345 3300046473 Ga0495582_0083300 Ga0495582_0083300_314_1315 316
346 3300046492 Ga0495585_0008414 Ga0495585_0008414_227_1222 316
347 3300046499 Ga0495594_0127852 Ga0495594_0127852_83_1078 316
348 3300046506 Ga0495583_0083296 Ga0495583_0083296_241_1236 316
349 3300046511 Ga0495608_0021073 Ga0495608_0021073_2928_3929 316
350 3300046511 Ga0495608_0084732 Ga0495608_0084732_1001_1972 316
351 3300046514 Ga0495618_0157805 Ga0495618_0157805_38_1033 316
352 3300046516 Ga0495628_0014727 Ga0495628_0014727_5243_6244 316
353 3300046517 Ga0495630_0041594 Ga0495630_0041594_1568_2569 316
354 3300046523 Ga0495644_0014794 Ga0495644_0014794_1796_2791 316
355 3300046529 Ga0495652_0089741 Ga0495652_0089741_1065_2060 316
356 3300046531 Ga0495665_0069040 Ga0495665_0069040_564_1565 316
357 3300046536 Ga0495587_0092504 Ga0495587_0092504_418_1419 316
358 3300046543 Ga0495645_0109269 Ga0495645_0109269_754_1755 316
359 3300046558 Ga0495633_0019628 Ga0495633_0019628_2234_3229 316
360 3300046559 Ga0495667_0041422 Ga0495667_0041422_460_1455 316
361 3300046615 Ga0495656_0004034 Ga0495656_0004034_1932_2927 316
362 3300046642 Ga0495634_0067106 Ga0495634_0067106_434_1435 316
363 3300046663 Ga0495635_0026001 Ga0495635_0026001_2300_3301 316
364 3300046664 Ga0495659_0007696 Ga0495659_0007696_790_1785 316
365 3300046675 Ga0495657_0019008 Ga0495657_0019008_462_1433 316
366 3300046675 Ga0495657_0156584 Ga0495657_0156584_217_1218 316
367 3300046678 Ga0495599_0024588 Ga0495599_0024588_259_1260 316
368 3300046681 Ga0495647_0003976 Ga0495647_0003976_564_1565 316
369 3300046683 Ga0495658_0087110 Ga0495658_0087110_426_1421 316
370 3300046690 Ga0495624_0168486 Ga0495624_0168486_290_1291 316
371 3300046691 Ga0495670_0001321 Ga0495670_0001321_5037_6032 316
372 3300046809 Ga0495600_0019250 Ga0495600_0019250_87_1082 316
373 3300047317 Ga0495604_0024413 Ga0495604_0024413_1869_2864 316
374 3300047319 Ga0495674_0054172 Ga0495674_0054172_955_1956 316
375 3300047319 Ga0495674_0055682 Ga0495674_0055682_874_1869 316
376 3300047322 Ga0495680_0016011 Ga0495680_0016011_1423_2418 316
377 3300047322 Ga0495680_0125557 Ga0495680_0125557_276_1277 316
378 3300047444 Ga0495675_0021903 Ga0495675_0021903_2658_3659 316
379 3300047471 Ga0495684_0112796 Ga0495684_0112796_731_1726 316
380 3300047471 Ga0495684_0116479 Ga0495684_0116479_866_1867 316
381 3300048088 Ga0495602_0037956 Ga0495602_0037956_3416_4387 316
382 3300049581 Ga0501047_0133021 Ga0501047_0133021_1311_2327 316
383 3300049582 Ga0501048_0335808 Ga0501048_0335808_72_1064 316
384 3300049586 Ga0501070_0112369 Ga0501070_0112369_1070_2086 316
385 3300049588 Ga0501072_0038222 Ga0501072_0038222_924_1940 316
386 3300049589 Ga0501073_0045790 Ga0501073_0045790_909_1925 316
387 3300049742 Ga0501080_0007162 Ga0501080_0007162_3821_4837 316
388 3300049742 Ga0501080_0227275 Ga0501080_0227275_311_1327 316
389 3300053077 Ga0495601_0005133 Ga0495601_0005133_2456_3451 316
390 3300053077 Ga0495601_0006865 Ga0495601_0006865_4190_5161 316
391 3300053078 Ga0495612_0006577 Ga0495612_0006577_2300_3271 316
392 3300053084 Ga0495595_0000356 Ga0495595_0000356_15392_16387 316
393 3300053084 Ga0495595_0001936 Ga0495595_0001936_3257_4228 316
394 3300053085 Ga0495619_0001094 Ga0495619_0001094_16516_17511 316
395 3300053085 Ga0495619_0034502 Ga0495619_0034502_387_1358 316
396 3300053085 Ga0495619_0105669 Ga0495619_0105669_521_1516 316
397 3300060353 Ga0501082_0086600 Ga0501082_0086600_665_1681 316
398 2209111006 2214911869 2213970493 317
399 3300000041 ARcpr5oldR_c000029 ARcpr5oldR_0000296 317
400 3300000042 ARSoilYngRDRAFT_c00072 ARSoilYngRDRAFT_0007214 317
401 3300000043 ARcpr5yngRDRAFT_c000051 ARcpr5yngRDRAFT_0000517 317
402 3300000044 ARSoilOldRDRAFT_c000078 ARSoilOldRDRAFT_00007814 317
403 3300000045 ARCol0oldRDRAFT_c00459 ARCol0oldRDRAFT_004593 317
404 3300000652 ARCol0yngRDRAFT_1000056 ARCol0yngRDRAFT_10000567 317
405 3300001990 JGI24737J22298_10012020 JGI24737J22298_100120203 317
406 3300005276 Ga0065717_1002104 Ga0065717_10021042 317
407 3300005277 Ga0065716_1002476 Ga0065716_10024762 317
408 3300005289 Ga0065704_10083802 Ga0065704_100838022 317
409 3300005293 Ga0065715_10106453 Ga0065715_101064532 317
410 3300005328 Ga0070676_10147513 Ga0070676_101475132 317
411 3300005329 Ga0070683_100096539 Ga0070683_1000965393 317
412 3300005336 Ga0070680_100029424 Ga0070680_1000294243 317
413 3300005336 Ga0070680_100290154 Ga0070680_1002901542 317
414 3300005339 Ga0070660_100144635 Ga0070660_1001446352 317
415 3300005341 Ga0070691_10041412 Ga0070691_100414122 317
416 3300005345 Ga0070692_10010043 Ga0070692_100100432 317
417 3300005345 Ga0070692_10070074 Ga0070692_100700742 317
418 3300005353 Ga0070669_100028908 Ga0070669_1000289081 317
419 3300005354 Ga0070675_100039583 Ga0070675_1000395834 317
420 3300005365 Ga0070688_100016727 Ga0070688_1000167275 317
421 3300005365 Ga0070688_100135663 Ga0070688_1001356632 317
422 3300005367 Ga0070667_100021395 Ga0070667_1000213954 317
423 3300005367 Ga0070667_100142260 Ga0070667_1001422603 317
424 3300005406 Ga0070703_10009780 Ga0070703_100097803 317
425 3300005436 Ga0070713_100015251 Ga0070713_1000152511 317
426 3300005436 Ga0070713_100035154 Ga0070713_1000351544 317
427 3300005437 Ga0070710_10257431 Ga0070710_102574311 317
428 3300005439 Ga0070711_100048137 Ga0070711_1000481371 317
429 3300005444 Ga0070694_100102197 Ga0070694_1001021972 317
430 3300005455 Ga0070663_100069216 Ga0070663_1000692162 317
431 3300005458 Ga0070681_10066993 Ga0070681_100669933 317
432 3300005507 Ga0074259_12105788 Ga0074259_121057881 317
433 3300005530 Ga0070679_100011066 Ga0070679_1000110668 317
434 3300005530 Ga0070679_100017604 Ga0070679_1000176046 317
435 3300005530 Ga0070679_100065636 Ga0070679_1000656362 317
436 3300005535 Ga0070684_100022129 Ga0070684_1000221292 317
437 3300005539 Ga0068853_100010929 Ga0068853_1000109294 317
438 3300005543 Ga0070672_100073562 Ga0070672_1000735623 317
439 3300005544 Ga0070686_100034533 Ga0070686_1000345331 317
440 3300005545 Ga0070695_100002680 Ga0070695_1000026804 317
441 3300005546 Ga0070696_100027300 Ga0070696_1000273002 317
442 3300005549 Ga0070704_100019446 Ga0070704_1000194462 317
443 3300005577 Ga0068857_100115620 Ga0068857_1001156202 317
444 3300005578 Ga0068854_100050830 Ga0068854_1000508304 317
445 3300005617 Ga0068859_100291001 Ga0068859_1002910012 317
446 3300005719 Ga0068861_100019068 Ga0068861_1000190682 317
447 3300005841 Ga0068863_100301324 Ga0068863_1003013242 317
448 3300005842 Ga0068858_100140765 Ga0068858_1001407651 317
449 3300005843 Ga0068860_100034634 Ga0068860_1000346342 317
450 3300005844 Ga0068862_100016334 Ga0068862_1000163342 317
451 3300006058 Ga0075432_10055282 Ga0075432_100552822 317
452 3300006163 Ga0070715_10118308 Ga0070715_101183081 317
453 3300006353 Ga0075370_10038270 Ga0075370_100382703 317
454 3300006931 Ga0097620_100291019 Ga0097620_1002910192 317
455 3300009093 Ga0105240_10053422 Ga0105240_100534223 317
456 3300009094 Ga0111539_10007739 Ga0111539_100077397 317
457 3300009101 Ga0105247_10047888 Ga0105247_100478883 317
458 3300009148 Ga0105243_10009481 Ga0105243_100094814 317
459 3300009177 Ga0105248_10008602 Ga0105248_100086026 317
460 3300009553 Ga0105249_10006636 Ga0105249_100066365 317
461 3300012508 Ga0157315_1000484 Ga0157315_10004842 317
462 3300013100 Ga0157373_10091002 Ga0157373_100910022 317
463 3300013102 Ga0157371_10102975 Ga0157371_101029751 317
464 3300013104 Ga0157370_10061699 Ga0157370_100616994 317
465 3300013104 Ga0157370_10160929 Ga0157370_101609292 317
466 3300013105 Ga0157369_10113846 Ga0157369_101138462 317
467 3300013306 Ga0163162_10021249 Ga0163162_100212491 317
468 3300013307 Ga0157372_10232687 Ga0157372_102326872 317
469 3300013308 Ga0157375_10154689 Ga0157375_101546891 317
470 3300014325 Ga0163163_10000757 Ga0163163_100007579 317
471 3300014326 Ga0157380_10038881 Ga0157380_100388812 317
472 3300014745 Ga0157377_10169037 Ga0157377_101690371 317
473 3300014968 Ga0157379_10245781 Ga0157379_102457812 317
474 3300014969 Ga0157376_10041184 Ga0157376_100411844 317
475 3300025271 Ga0207666_1000343 Ga0207666_10003434 317
476 3300025315 Ga0207697_10007410 Ga0207697_100074104 317
477 3300025901 Ga0207688_10004300 Ga0207688_100043003 317
478 3300025903 Ga0207680_10266326 Ga0207680_102663261 317
479 3300025904 Ga0207647_10047471 Ga0207647_100474713 317
480 3300025907 Ga0207645_10040159 Ga0207645_100401592 317
481 3300025911 Ga0207654_10128529 Ga0207654_101285292 317
482 3300025912 Ga0207707_10011542 Ga0207707_100115426 317
483 3300025912 Ga0207707_10264712 Ga0207707_102647121 317
484 3300025913 Ga0207695_10096789 Ga0207695_100967894 317
485 3300025915 Ga0207693_10026873 Ga0207693_100268733 317
486 3300025916 Ga0207663_10108042 Ga0207663_101080422 317
487 3300025917 Ga0207660_10047796 Ga0207660_100477963 317
488 3300025919 Ga0207657_10133464 Ga0207657_101334642 317
489 3300025921 Ga0207652_10062760 Ga0207652_100627603 317
490 3300025921 Ga0207652_10070843 Ga0207652_100708434 317
491 3300025921 Ga0207652_10092261 Ga0207652_100922612 317
492 3300025923 Ga0207681_10066864 Ga0207681_100668643 317
493 3300025923 Ga0207681_10319148 Ga0207681_103191481 317
494 3300025926 Ga0207659_10065689 Ga0207659_100656891 317
495 3300025932 Ga0207690_10136275 Ga0207690_101362751 317
496 3300025933 Ga0207706_10007810 Ga0207706_100078106 317
497 3300025934 Ga0207686_10064900 Ga0207686_100649001 317
498 3300025949 Ga0207667_10065695 Ga0207667_100656953 317
499 3300025972 Ga0207668_10140812 Ga0207668_101408122 317
500 3300025986 Ga0207658_10112167 Ga0207658_101121671 317
501 3300026035 Ga0207703_10390416 Ga0207703_103904161 317
502 3300026041 Ga0207639_10132234 Ga0207639_101322341 317
503 3300026067 Ga0207678_10012696 Ga0207678_100126964 317
504 3300026075 Ga0207708_10004283 Ga0207708_100042839 317
505 3300026088 Ga0207641_10193239 Ga0207641_101932392 317
506 3300026118 Ga0207675_100015653 Ga0207675_1000156533 317
507 3300027695 Ga0209966_1002877 Ga0209966_10028772 317
508 3300027717 Ga0209998_10000758 Ga0209998_100007584 317
509 3300027907 Ga0207428_10014000 Ga0207428_100140003 317
510 3300028381 Ga0268264_10069274 Ga0268264_100692743 317
511 3300031241 Ga0265325_10000004 Ga0265325_10000004195 317
512 3300031241 Ga0265325_10043495 Ga0265325_100434951 317
513 3300031241 Ga0265325_10048228 Ga0265325_100482283 317
514 3300031249 Ga0265339_10010467 Ga0265339_100104673 317
515 3300031344 Ga0265316_10066828 Ga0265316_100668281 317
516 3300031595 Ga0265313_10009264 Ga0265313_100092645 317
517 3300031595 Ga0265313_10048143 Ga0265313_100481431 317
518 3300034816 Ga0373930_0000532 Ga0373930_0000532_2228_3238 317
519 3300034817 Ga0373948_0000419 Ga0373948_0000419_2591_3601 317
520 3300034818 Ga0373950_0000167 Ga0373950_0000167_828_1838 317
521 3300034819 Ga0373958_0002350 Ga0373958_0002350_915_1925 317
522 3300034957 Ga0373938_0000028 Ga0373938_0000028_12695_13705 317
523 3300035084 Ga0373928_0000334 Ga0373928_0000334_5415_6425 317
524 3300035085 Ga0373929_0001866 Ga0373929_0001866_157_1167 317
525 3300035086 Ga0373934_0005199 Ga0373934_0005199_1287_2348 317
526 3300035090 Ga0373949_0001620 Ga0373949_0001620_3042_4052 317
527 3300035091 Ga0373951_0000666 Ga0373951_0000666_4239_5249 317
528 3300035092 Ga0373952_0000851 Ga0373952_0000851_3015_4025 317
529 3300035111 Ga0373923_0049411 Ga0373923_0049411_588_1583 317
530 3300035112 Ga0373932_0000749 Ga0373932_0000749_5652_6662 317
531 3300035114 Ga0373939_0001838 Ga0373939_0001838_2133_3143 317
532 3300035114 Ga0373939_0016499 Ga0373939_0016499_119_1114 317
533 3300035115 Ga0373941_0000671 Ga0373941_0000671_3368_4378 317
534 3300035116 Ga0373945_0097102 Ga0373945_0097102_42_1037 317
535 3300035117 Ga0373953_0008219 Ga0373953_0008219_252_1247 317
536 3300035118 Ga0373954_0007284 Ga0373954_0007284_883_1944 317
537 3300035118 Ga0373954_0014031 Ga0373954_0014031_600_1595 317
538 3300035119 Ga0373956_0000945 Ga0373956_0000945_8968_9963 317
539 3300035120 Ga0373957_0000339 Ga0373957_0000339_1361_2356 317
540 3300035120 Ga0373957_0003036 Ga0373957_0003036_2275_3291 317
541 3300035121 Ga0373960_0000599 Ga0373960_0000599_4022_5032 317
542 3300035172 Ga0373955_0001962 Ga0373955_0001962_3865_4926 317
543 3300035172 Ga0373955_0064377 Ga0373955_0064377_786_1781 317
544 3300035207 Ga0373942_0005239 Ga0373942_0005239_17_1027 317
545 3300035241 Ga0373961_0000433 Ga0373961_0000433_3089_4099 317
546 3300035242 Ga0373962_0000881 Ga0373962_0000881_4494_5504 317
547 3300035410 Ga0373924_0025366 Ga0373924_0025366_467_1552 317
548 3300035410 Ga0373924_0057243 Ga0373924_0057243_280_1341 317
549 3300035692 Ga0373935_0026607 Ga0373935_0026607_1688_2749 317
550 3300035695 Ga0373927_0003675 Ga0373927_0003675_5348_6367 317
551 3300035695 Ga0373927_0093708 Ga0373927_0093708_516_1511 317
552 3300035724 Ga0373933_0000890 Ga0373933_0000890_4447_5463 317
553 3300035724 Ga0373933_0001687 Ga0373933_0001687_1503_2498 317
554 3300035724 Ga0373933_0041104 Ga0373933_0041104_793_1878 317
555 3300035725 Ga0373947_0115514 Ga0373947_0115514_632_1642 317
556 3300036401 Ga0373937_0001794 Ga0373937_0001794_7030_8091 317
557 3300036401 Ga0373937_0004227 Ga0373937_0004227_1131_2147 317
558 3300036401 Ga0373937_0006421 Ga0373937_0006421_1362_2357 317
559 3300036401 Ga0373937_0087050 Ga0373937_0087050_421_1602 317
560 3300044712 Ga0453684_0140242 Ga0453684_0140242_1190_2200 317
561 3300045051 Ga0451576_0065472 Ga0451576_0065472_1038_2048 317
562 3300046454 Ga0495592_0000589 Ga0495592_0000589_3953_5014 317
563 3300046454 Ga0495592_0002245 Ga0495592_0002245_778_1773 317
564 3300046454 Ga0495592_0040216 Ga0495592_0040216_1311_2396 317
565 3300046459 Ga0495629_0013396 Ga0495629_0013396_252_1247 317
566 3300046462 Ga0495651_0003925 Ga0495651_0003925_6391_7407 317
567 3300046462 Ga0495651_0031350 Ga0495651_0031350_3094_4104 317
568 3300046462 Ga0495651_0050023 Ga0495651_0050023_1503_2498 317
569 3300046462 Ga0495651_0115579 Ga0495651_0115579_883_1968 317
570 3300046463 Ga0495653_0001655 Ga0495653_0001655_12471_13466 317
571 3300046463 Ga0495653_0004752 Ga0495653_0004752_6345_7406 317
572 3300046477 Ga0495664_0005496 Ga0495664_0005496_2288_3349 317
573 3300046511 Ga0495608_0001793 Ga0495608_0001793_253_1248 317
574 3300046511 Ga0495608_0005922 Ga0495608_0005922_546_1607 317
575 3300046514 Ga0495618_0008159 Ga0495618_0008159_3874_4935 317
576 3300046514 Ga0495618_0072351 Ga0495618_0072351_409_1404 317
577 3300046516 Ga0495628_0004889 Ga0495628_0004889_3432_4493 317
578 3300046516 Ga0495628_0009824 Ga0495628_0009824_705_1700 317
579 3300046517 Ga0495630_0027998 Ga0495630_0027998_546_1607 317
580 3300046529 Ga0495652_0010464 Ga0495652_0010464_183_1268 317
581 3300046529 Ga0495652_0013953 Ga0495652_0013953_1496_2557 317
582 3300046533 Ga0495640_0005362 Ga0495640_0005362_4151_5212 317
583 3300046533 Ga0495640_0013444 Ga0495640_0013444_4562_5557 317
584 3300046543 Ga0495645_0008213 Ga0495645_0008213_2288_3349 317
585 3300046559 Ga0495667_0013127 Ga0495667_0013127_2288_3349 317
586 3300046642 Ga0495634_0013078 Ga0495634_0013078_2381_3442 317
587 3300046642 Ga0495634_0023688 Ga0495634_0023688_518_1513 317
588 3300046663 Ga0495635_0002748 Ga0495635_0002748_44_1039 317
589 3300046663 Ga0495635_0004972 Ga0495635_0004972_469_1530 317
590 3300046663 Ga0495635_0038825 Ga0495635_0038825_1289_2374 317
591 3300046675 Ga0495657_0001218 Ga0495657_0001218_11174_12235 317
592 3300046675 Ga0495657_0058481 Ga0495657_0058481_861_1946 317
593 3300046678 Ga0495599_0000970 Ga0495599_0000970_8534_9595 317
594 3300046678 Ga0495599_0009604 Ga0495599_0009604_3422_4417 317
595 3300046678 Ga0495599_0017496 Ga0495599_0017496_3164_4249 317
596 3300046679 Ga0495623_0000758 Ga0495623_0000758_5843_6904 317
597 3300046679 Ga0495623_0050543 Ga0495623_0050543_1318_2403 317
598 3300046679 Ga0495623_0104799 Ga0495623_0104799_125_1120 317
599 3300046680 Ga0495646_0000300 Ga0495646_0000300_15343_16404 317
600 3300046680 Ga0495646_0048164 Ga0495646_0048164_1407_2492 317
601 3300046809 Ga0495600_0017662 Ga0495600_0017662_905_1990 317
602 3300046809 Ga0495600_0087418 Ga0495600_0087418_786_1781 317
603 3300047317 Ga0495604_0001425 Ga0495604_0001425_11478_12539 317
604 3300047319 Ga0495674_0005874 Ga0495674_0005874_2261_3322 317
605 3300047319 Ga0495674_0069114 Ga0495674_0069114_496_1491 317
606 3300047322 Ga0495680_0002651 Ga0495680_0002651_1503_2498 317
607 3300047322 Ga0495680_0009557 Ga0495680_0009557_5363_6424 317
608 3300047444 Ga0495675_0001056 Ga0495675_0001056_2261_3322 317
609 3300047444 Ga0495675_0018474 Ga0495675_0018474_3306_4301 317
610 3300047471 Ga0495684_0006100 Ga0495684_0006100_1475_2470 317
611 3300047471 Ga0495684_0019131 Ga0495684_0019131_3949_5010 317
612 3300047673 Ga0495593_0009724 Ga0495593_0009724_3228_4223 317
613 3300048088 Ga0495602_0003273 Ga0495602_0003273_11739_12800 317
614 3300048088 Ga0495602_0017308 Ga0495602_0017308_189_1274 317
615 3300048904 Ga0496101_0195827 Ga0496101_0195827_326_1387 317
616 3300048905 Ga0496102_0210499 Ga0496102_0210499_348_1358 317
617 3300048906 Ga0496103_0081016 Ga0496103_0081016_303_1313 317
618 3300048907 Ga0496104_0000515 Ga0496104_0000515_17603_18613 317
619 3300048907 Ga0496104_0080380 Ga0496104_0080380_1696_2727 317
620 3300048909 Ga0496106_0015310 Ga0496106_0015310_2092_3102 317
621 3300048909 Ga0496106_0158605 Ga0496106_0158605_507_1538 317
622 3300048910 Ga0496107_0015088 Ga0496107_0015088_1405_2436 317
623 3300048910 Ga0496107_0090827 Ga0496107_0090827_747_1757 317
624 3300048911 Ga0496108_0008991 Ga0496108_0008991_2874_3905 317
625 3300048912 Ga0496109_0001064 Ga0496109_0001064_4577_5608 317
626 3300048912 Ga0496109_0113508 Ga0496109_0113508_628_1638 317
627 3300048914 Ga0496111_0055737 Ga0496111_0055737_1536_2567 317
628 3300048914 Ga0496111_0081328 Ga0496111_0081328_623_1633 317
629 3300048915 Ga0496112_0075018 Ga0496112_0075018_1558_2589 317
630 3300048916 Ga0496113_0004800 Ga0496113_0004800_1199_2230 317
631 3300048918 Ga0496115_0045598 Ga0496115_0045598_2126_3187 317
632 3300048918 Ga0496115_0138609 Ga0496115_0138609_968_1978 317
633 3300049571 Ga0501034_0046375 Ga0501034_0046375_38_1033 317
634 3300049571 Ga0501034_0187526 Ga0501034_0187526_941_1951 317
635 3300049575 Ga0501039_0101558 Ga0501039_0101558_141_1136 317
636 3300049581 Ga0501047_0010053 Ga0501047_0010053_795_1790 317
637 3300049585 Ga0501069_0006089 Ga0501069_0006089_2395_3396 317
638 3300049585 Ga0501069_0149490 Ga0501069_0149490_258_1253 317
639 3300049586 Ga0501070_0003256 Ga0501070_0003256_12294_13295 317
640 3300049589 Ga0501073_0000374 Ga0501073_0000374_85_1086 317
641 3300049589 Ga0501073_0115244 Ga0501073_0115244_666_1664 317
642 3300049590 Ga0501074_0000125 Ga0501074_0000125_4017_5018 317
643 3300049590 Ga0501074_0148255 Ga0501074_0148255_85_1083 317
644 3300049742 Ga0501080_0001529 Ga0501080_0001529_4644_5645 317
645 3300049744 Ga0501083_0001646 Ga0501083_0001646_10228_11229 317
646 3300049822 Ga0501035_0306211 Ga0501035_0306211_271_1269 317
647 3300049823 Ga0501044_0172377 Ga0501044_0172377_326_1327 317
648 3300050496 nmdc:mga07m45_24106_c2 nmdc:mga07m45_24106_c2_1557_2588 317
649 3300050511 nmdc:mga08y16_14377_c1 nmdc:mga08y16_14377_c1_1520_2530 317
650 3300050515 nmdc:mga0a205_65088_c1 nmdc:mga0a205_65088_c1_1730_2740 317
651 3300053077 Ga0495601_0000731 Ga0495601_0000731_11808_12893 317
652 3300053077 Ga0495601_0001011 Ga0495601_0001011_9254_10315 317
653 3300053077 Ga0495601_0011836 Ga0495601_0011836_2801_3796 317
654 3300053078 Ga0495612_0007659 Ga0495612_0007659_1063_2124 317
655 3300053084 Ga0495595_0001701 Ga0495595_0001701_3498_4559 317
656 3300053084 Ga0495595_0002476 Ga0495595_0002476_5284_6369 317
657 3300053085 Ga0495619_0010836 Ga0495619_0010836_4131_5192 317
658 3300060353 Ga0501082_0026405 Ga0501082_0026405_831_1826 317
659 3300060353 Ga0501082_0173828 Ga0501082_0173828_811_1812 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

100

378

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p47-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from ochrobactrum anthropi (oant_4429), target efi-510151, c-termius bound in ligand binding pocket 0.9177 8 315
4mev-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 0.9139 11 317
4mev-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate, space group i422 0.9001 11 317
3gyy-assembly1.cif.gz_A the ectoine binding protein of the teaabc trap transporter teaa in the apo-state 0.8913 12 315
4pf8-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. nas-14.1 (target efi-510299) with bound beta-d-galacturonate 0.8893 13 314
ID Description Score Start End Superfamily
4p47A00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9177 8 315 3.40.190.170
4mevA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9139 11 317 3.40.190.170
4mevA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9001 11 317 3.40.190.170
3gyyA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8913 12 315 3.40.190.170
4p1eA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.8834 11 317 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A6N6T2D2-F1-model_v4 C4-dicarboxylate ABC transporter 0.9291 1 314 GO:0015740
GO:0055085
AF-A0A7S7SU36-F1-model_v4 TRAP transporter substrate-binding protein DctP 0.918 9 313 GO:0015740
GO:0055085
AF-A0A6N6T2D2-F1-model_v4 C4-dicarboxylate ABC transporter 0.9179 1 314 GO:0015740
GO:0055085
AF-A0A850MZ18-F1-model_v4 deleted 0.9157 10 317
AF-A0A8A7T859-F1-model_v4 deleted 0.9114 10 314

Feature Viewer

pLDDT pTM Quality
93.22 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map