F473282

General Info

Members Datasets Scaffolds Average Seq Length
659 308 1318 469

Family's Representative Sequence

Representative Sequence 3300047470|Ga0495681_0018487|Ga0495681_0018487_1348_2931
Length 527
Sequence MTRRLYGWHGGASHAALPWRATDLAWLAGPHARLSFVRLPAEFIFITETKDHAMMHGVEHTISGNAAAARPASTTTLWLAAAVSALGGLLFGYDWVVIGGAKPFYEAWFQLVEPAQQAWAVSCALIGCLVGAIGSGWISDRLGRRRGLLIAALIFAVSSLGTGWAASFYSFIAWRIIGGVAIGLAAGLSPVYIAEIAPAAIRGRMVCLNQIAIVLGILGAQIVNLLIAEPVPAGATAAGLAASWNGTTGWRWMFAAAAVPAMAFLLGCLLIPESPRWLAGRGRQQDALAALHRLGGADYARDAMHDIGQALGAATGRTLKQVLAEPRFARVLGIGIVLAVLQQWCGINVIFNYAQEIFASAGYAVSDMLFNIVITGVVNCVFALVALATVERWGRRRLMLLGCAGLFVIYVALGACYLAGWQGWPLLLLVVTAIAVYSMTLAPVTWVALSEIFPQEVRGACMAVATTALWAACFLLTYTFPLINAAMGTGMTFWLYAVICLAGFVFVLRQLPETRGKSLEEIEQGWR

Samples

Sample ID Description Type Environment
1 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
218 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
252 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
253 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
256 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
257 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
258 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
259 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
260 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
261 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
262 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
263 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
264 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
265 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
266 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
267 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
268 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
269 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
270 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
271 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
272 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
273 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
274 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
275 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
276 2643221642 Caulobacter sp. Root343 Isolate Unclassified
277 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
278 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
279 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
280 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
281 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
282 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
283 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
284 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
285 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
286 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
287 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
288 2857553236 Duganella sp. R-74557 Isolate Unclassified
289 2884411467 Dyella sp. AD56 Isolate Rhizosphere
290 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
291 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
292 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
293 2919476304 Duganella sp. 3397 Isolate Unclassified
294 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
295 2928963466 Dyella japonica 1073 Isolate Unclassified
296 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
297 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
298 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
299 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
300 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
301 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
302 640753048 Serratia proteamaculans 568 Isolate Endosphere
303 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
304 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
305 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
306 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
307 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
308 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0
Isolates 7.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 1.97
Rhizoplane 3.03
Rhizosphere 79.97
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495681_0018487 3300047470 Bacteria 3839
2 SwRhRL2b_contig_1650735 2162886007 Bacteria 1921
3 JGI24735J21928_10003364 3300002067 Bacteria 5457
4 JGI24735J21928_10013377 3300002067 Bacteria 2582
5 JGI25162J39368_1000751 3300002737 Bacteria 22045
6 JGI25154J39366_1000028 3300002738 Bacteria 195818
7 JGI25157J39369_1001285 3300002741 Bacteria 10091
8 JGI25153J46596_10006976 3300003215 Bacteria 5628
9 JGI25153J46596_10011924 3300003215 Bacteria 3803
10 rootH1_10006496 3300003316 Bacteria 3429
11 rootH1_10039085 3300003316 Bacteria 4064
12 rootH1_10121669 3300003316 Bacteria 2764
13 rootH2_10002124 3300003320 Bacteria 9338
14 rootH2_10011842 3300003320 Bacteria 4956
15 rootH2_10013751 3300003320 Bacteria 43446
16 rootH2_10034304 3300003320 Bacteria 3291
17 rootH2_10049273 3300003320 Bacteria 21502
18 rootH2_10059965 3300003320 Bacteria 2274
19 rootH2_10084100 3300003320 Bacteria 3343
20 rootH2_10133820 3300003320 Bacteria 3311
21 rootL2_10029592 3300003322 Bacteria 11227
22 rootL2_10106337 3300003322 Bacteria 10478
23 rootL2_10251988 3300003322 Bacteria 2088
24 JGI25160J50197_1004507 3300003354 Bacteria 6014
25 Ga0055542_1000230 3300003762 Bacteria 65902
26 Ga0055528_1000029 3300003790 Bacteria 122126
27 Ga0055530_10000551 3300003791 Bacteria 32460
28 Ga0058692_1002427 3300003856 Bacteria 6242
29 Ga0058692_1006407 3300003856 Bacteria 3241
30 Ga0065165_1000052 3300005262 Bacteria 192010
31 Ga0065165_1001448 3300005262 Bacteria 25708
32 Ga0065165_1017901 3300005262 Bacteria 2589
33 Ga0065703_1018781 3300005272 Bacteria 8629
34 Ga0065704_10001610 3300005289 Bacteria 12189
35 Ga0065704_10073199 3300005289 Bacteria 7461
36 Ga0065704_10085567 3300005289 Bacteria 3209
37 Ga0070658_10000006 3300005327 Bacteria 374835
38 Ga0070658_10000355 3300005327 Bacteria 39796
39 Ga0070658_10001785 3300005327 Bacteria 18113
40 Ga0070658_10011799 3300005327 Bacteria 7012
41 Ga0070658_10014817 3300005327 Bacteria 6248
42 Ga0070658_10026725 3300005327 Bacteria 4632
43 Ga0070683_100009887 3300005329 Bacteria 8174
44 Ga0070683_100016329 3300005329 Bacteria 6546
45 Ga0070683_100083473 3300005329 Unclassified 2992
46 Ga0070683_100114300 3300005329 Bacteria 2548
47 Ga0068869_100007051 3300005334 Bacteria 7156
48 Ga0070666_10000013 3300005335 Bacteria 230442
49 Ga0070666_10033504 3300005335 Bacteria 3399
50 Ga0068868_100029026 3300005338 Unclassified 4235
51 Ga0070660_100217318 3300005339 Bacteria 1553
52 Ga0070671_100034239 3300005355 Bacteria 4205
53 Ga0070671_100069878 3300005355 Bacteria 2929
54 Ga0070667_100010129 3300005367 Bacteria 7799
55 Ga0070714_100028908 3300005435 Bacteria 4604
56 Ga0070714_100077324 3300005435 Bacteria 2890
57 Ga0070713_100000709 3300005436 Bacteria 21386
58 Ga0070710_10051836 3300005437 Bacteria 2306
59 Ga0070708_100017849 3300005445 Bacteria 5928
60 Ga0070708_100134765 3300005445 Bacteria 2287
61 Ga0070663_100169741 3300005455 Bacteria 1685
62 Ga0070681_10018105 3300005458 Bacteria 7044
63 Ga0070681_10066757 3300005458 Unclassified 3566
64 Ga0070706_100026495 3300005467 Bacteria 5333
65 Ga0070706_100068757 3300005467 Bacteria 3275
66 Ga0070707_100004902 3300005468 Bacteria 12544
67 Ga0070707_100059641 3300005468 Bacteria 3659
68 Ga0070698_100029627 3300005471 Bacteria 5683
69 Ga0070698_100030913 3300005471 Bacteria 5553
70 Ga0070699_100067891 3300005518 Bacteria 3096
71 Ga0070679_100001816 3300005530 Bacteria 19251
72 Ga0070679_100015518 3300005530 Bacteria 7320
73 Ga0070679_100098274 3300005530 Bacteria 2915
74 Ga0070684_100040889 3300005535 Bacteria 3994
75 Ga0070684_100082046 3300005535 Bacteria 2854
76 Ga0070697_100041878 3300005536 Bacteria 3707
77 Ga0068853_100013405 3300005539 Bacteria 6692
78 Ga0068853_100045938 3300005539 Bacteria 3743
79 Ga0070665_100010184 3300005548 Bacteria 9510
80 Ga0070665_100055410 3300005548 Bacteria 3977
81 Ga0070665_100066905 3300005548 Bacteria 3604
82 Ga0070665_100102037 3300005548 Unclassified 2872
83 Ga0070665_100134621 3300005548 Bacteria 2473
84 Ga0070704_100112764 3300005549 Bacteria 2072
85 Ga0068855_100000148 3300005563 Bacteria 89300
86 Ga0068855_100005929 3300005563 Bacteria 14899
87 Ga0068855_100006646 3300005563 Bacteria 14047
88 Ga0068855_100011888 3300005563 Bacteria 10525
89 Ga0068855_100019045 3300005563 Bacteria 8251
90 Ga0068855_100033705 3300005563 Bacteria 6110
91 Ga0068855_100111364 3300005563 Bacteria 3143
92 Ga0068855_100147403 3300005563 Bacteria 2678
93 Ga0068855_100213171 3300005563 Bacteria 2169
94 Ga0070664_100110284 3300005564 Bacteria 2401
95 Ga0068857_100001579 3300005577 Bacteria 18252
96 Ga0068857_100004216 3300005577 Bacteria 12115
97 Ga0068857_100062339 3300005577 Bacteria 3314
98 Ga0068854_100000054 3300005578 Bacteria 84435
99 Ga0068854_100034084 3300005578 Bacteria 3554
100 Ga0068856_100001773 3300005614 Bacteria 22538
101 Ga0068852_100003810 3300005616 Bacteria 10583
102 Ga0068859_100012271 3300005617 Bacteria 8618
103 Ga0068859_100054448 3300005617 Bacteria 4024
104 Ga0068864_100063293 3300005618 Bacteria 3206
105 Ga0068851_10014782 3300005834 Bacteria 3711
106 Ga0068851_10015576 3300005834 Bacteria 3624
107 Ga0068863_100028902 3300005841 Bacteria 5294
108 Ga0068858_100002682 3300005842 Bacteria 17922
109 Ga0068860_100001987 3300005843 Bacteria 21593
110 Ga0068860_100005502 3300005843 Bacteria 12825
111 Ga0068860_100084604 3300005843 Bacteria 3018
112 Ga0068862_100004867 3300005844 Bacteria 11306
113 Ga0068862_100097952 3300005844 Bacteria 2561
114 Ga0070717_10004293 3300006028 Bacteria 10275
115 Ga0070717_10007004 3300006028 Bacteria 8343
116 Ga0070717_10118800 3300006028 Bacteria 2263
117 Ga0097621_100018922 3300006237 Bacteria 5275
118 Ga0097621_100064327 3300006237 Bacteria 3016
119 Ga0068871_100007526 3300006358 Bacteria 7788
120 Ga0075433_10243530 3300006852 Bacteria 1596
121 Ga0097620_100012271 3300006931 Bacteria 8618
122 Ga0097620_100054450 3300006931 Bacteria 4024
123 Ga0099824_1002532 3300006942 Bacteria 26760
124 Ga0079104_1000201 3300006946 Bacteria 83853
125 Ga0079104_1000365 3300006946 Bacteria 53914
126 Ga0079104_1001078 3300006946 Bacteria 20455
127 Ga0079104_1002451 3300006946 Bacteria 10007
128 Ga0079104_1003548 3300006946 Bacteria 7173
129 Ga0079104_1017543 3300006946 Bacteria 2054
130 Ga0099826_10005490 3300006948 Bacteria 9100
131 Ga0105251_10000556 3300009011 Bacteria 34974
132 Ga0105251_10002699 3300009011 Bacteria 13633
133 Ga0105244_10000007 3300009036 Bacteria 352275
134 Ga0105244_10000075 3300009036 Bacteria 111242
135 Ga0105244_10001065 3300009036 Bacteria 22915
136 Ga0105244_10003093 3300009036 Bacteria 12177
137 Ga0105244_10032945 3300009036 Bacteria 2737
138 Ga0105250_10000492 3300009092 Bacteria 27777
139 Ga0105250_10001277 3300009092 Bacteria 13828
140 Ga0105250_10003227 3300009092 Bacteria 7774
141 Ga0105240_10000594 3300009093 Bacteria 67129
142 Ga0105240_10001347 3300009093 Bacteria 42146
143 Ga0105240_10003557 3300009093 Bacteria 24176
144 Ga0105240_10007025 3300009093 Bacteria 16429
145 Ga0105240_10008652 3300009093 Bacteria 14543
146 Ga0105240_10011955 3300009093 Bacteria 12033
147 Ga0105240_10021450 3300009093 Bacteria 8589
148 Ga0105240_10028599 3300009093 Bacteria 7276
149 Ga0105240_10034646 3300009093 Bacteria 6510
150 Ga0105240_10047255 3300009093 Bacteria 5447
151 Ga0105240_10056838 3300009093 Unclassified 4894
152 Ga0105240_10177519 3300009093 Unclassified 2517
153 Ga0105245_10010013 3300009098 Bacteria 8255
154 Ga0105245_10013828 3300009098 Bacteria 7030
155 Ga0105247_10009610 3300009101 Bacteria 5870
156 Ga0105247_10042366 3300009101 Bacteria 2789
157 Ga0105247_10117117 3300009101 Bacteria 1722
158 Ga0105243_10000003 3300009148 Bacteria 712931
159 Ga0105241_10000006 3300009174 Bacteria 373608
160 Ga0105241_10000082 3300009174 Bacteria 70717
161 Ga0105241_10007395 3300009174 Bacteria 8080
162 Ga0105241_10030547 3300009174 Bacteria 4028
163 Ga0105241_10142380 3300009174 Bacteria 1954
164 Ga0105242_10079151 3300009176 Bacteria 2745
165 Ga0105248_10000004 3300009177 Bacteria 695244
166 Ga0105248_10006857 3300009177 Bacteria 12489
167 Ga0105248_10107745 3300009177 Bacteria 3142
168 Ga0105237_10000245 3300009545 Bacteria 76791
169 Ga0105237_10068011 3300009545 Unclassified 3556
170 Ga0105237_10071675 3300009545 Bacteria 3459
171 Ga0105238_10000098 3300009551 Bacteria 98005
172 Ga0105238_10004480 3300009551 Bacteria 13844
173 Ga0105238_10013476 3300009551 Bacteria 8253
174 Ga0105238_10031788 3300009551 Bacteria 5371
175 Ga0105238_10040480 3300009551 Bacteria 4722
176 Ga0105238_10044434 3300009551 Unclassified 4491
177 Ga0105238_10050752 3300009551 Bacteria 4175
178 Ga0105238_10068275 3300009551 Unclassified 3556
179 Ga0105238_10106064 3300009551 Bacteria 2792
180 Ga0105238_10194689 3300009551 Unclassified 2003
181 Ga0105249_10033978 3300009553 Bacteria 4619
182 Ga0105239_10000569 3300010375 Bacteria 52971
183 Ga0105239_10031957 3300010375 Bacteria 5784
184 Ga0105239_10039229 3300010375 Bacteria 5188
185 Ga0105239_10117574 3300010375 Bacteria 2951
186 Ga0105239_10206092 3300010375 Bacteria 2203
187 Ga0105246_10007351 3300011119 Bacteria 6749
188 Ga0157373_10053635 3300013100 Bacteria 2867
189 Ga0157373_10082762 3300013100 Bacteria 2262
190 Ga0157371_10060811 3300013102 Bacteria 2678
191 Ga0157370_10000195 3300013104 Bacteria 76072
192 Ga0157370_10004397 3300013104 Bacteria 16165
193 Ga0157370_10005642 3300013104 Bacteria 14000
194 Ga0157370_10009996 3300013104 Bacteria 10036
195 Ga0157370_10073257 3300013104 Unclassified 3231
196 Ga0157370_10105532 3300013104 Bacteria 2637
197 Ga0157369_10000711 3300013105 Bacteria 42778
198 Ga0157369_10002489 3300013105 Bacteria 22074
199 Ga0157369_10004540 3300013105 Bacteria 16332
200 Ga0157369_10010663 3300013105 Bacteria 10459
201 Ga0157369_10011538 3300013105 Bacteria 10036
202 Ga0157369_10017521 3300013105 Bacteria 8050
203 Ga0157369_10025541 3300013105 Bacteria 6557
204 Ga0157369_10025596 3300013105 Bacteria 6548
205 Ga0157369_10119639 3300013105 Unclassified 2795
206 Ga0157374_10001735 3300013296 Bacteria 18284
207 Ga0157374_10006894 3300013296 Bacteria 9662
208 Ga0157374_10006930 3300013296 Bacteria 9638
209 Ga0157374_10013101 3300013296 Bacteria 7232
210 Ga0157374_10015187 3300013296 Bacteria 6752
211 Ga0157374_10016088 3300013296 Bacteria 6572
212 Ga0157374_10025430 3300013296 Bacteria 5316
213 Ga0157374_10120865 3300013296 Bacteria 2528
214 Ga0157374_10139496 3300013296 Bacteria 2352
215 Ga0157378_10000036 3300013297 Bacteria 117422
216 Ga0157378_10005409 3300013297 Bacteria 11198
217 Ga0157378_10024465 3300013297 Bacteria 5315
218 Ga0157378_10043623 3300013297 Bacteria 3983
219 Ga0157378_10139238 3300013297 Unclassified 2252
220 Ga0163162_10025780 3300013306 Bacteria 5811
221 Ga0163162_10029109 3300013306 Bacteria 5465
222 Ga0157372_10003822 3300013307 Bacteria 16184
223 Ga0157372_10006837 3300013307 Bacteria 12130
224 Ga0157372_10009966 3300013307 Bacteria 10106
225 Ga0157372_10010289 3300013307 Bacteria 9938
226 Ga0157372_10014580 3300013307 Bacteria 8407
227 Ga0157372_10023922 3300013307 Bacteria 6628
228 Ga0157372_10032773 3300013307 Bacteria 5701
229 Ga0157372_10131629 3300013307 Unclassified 2878
230 Ga0157372_10289977 3300013307 Bacteria 1903
231 Ga0157375_10004276 3300013308 Bacteria 12387
232 Ga0157375_10004846 3300013308 Bacteria 11690
233 Ga0157375_10146282 3300013308 Bacteria 2494
234 Ga0163163_10013483 3300014325 Bacteria 7487
235 Ga0163163_10028724 3300014325 Bacteria 5345
236 Ga0157379_10030932 3300014968 Bacteria 4769
237 Ga0157376_10024663 3300014969 Bacteria 4726
238 Ga0182006_1000455 3300015261 Bacteria 32311
239 Ga0163161_10000122 3300017792 Bacteria 73118
240 Ga0163161_10013240 3300017792 Bacteria 5734
241 Ga0163161_10092079 3300017792 Bacteria 2244
242 Ga0209674_100545 3300025226 Bacteria 15073
243 Ga0209437_100138 3300025233 Bacteria 172839
244 Ga0209437_101652 3300025233 Bacteria 5044
245 Ga0209258_103183 3300025242 Bacteria 3688
246 Ga0209646_1000006 3300025246 Bacteria 694084
247 Ga0209026_1000214 3300025250 Bacteria 80595
248 Ga0209026_1001073 3300025250 Bacteria 13209
249 Ga0209148_1000002 3300025254 Bacteria 2399500
250 Ga0209233_1000705 3300025261 Bacteria 15603
251 Ga0209233_1014351 3300025261 Bacteria 2234
252 Ga0209673_1000187 3300025273 Bacteria 124227
253 Ga0209564_1001813 3300025295 Bacteria 19674
254 Ga0209758_1000392 3300025297 Bacteria 75737
255 Ga0209758_1036283 3300025297 Bacteria 1927
256 Ga0209050_1000259 3300025298 Bacteria 113475
257 Ga0207426_1000209 3300025302 Bacteria 139524
258 Ga0207426_1000678 3300025302 Bacteria 41242
259 Ga0209257_1004199 3300025304 Bacteria 11422
260 Ga0207656_10002511 3300025321 Bacteria 6192
261 Ga0207696_1000259 3300025711 Bacteria 68316
262 Ga0207696_1008441 3300025711 Bacteria 3937
263 Ga0207655_1000025 3300025728 Bacteria 449261
264 Ga0207655_1000196 3300025728 Bacteria 106283
265 Ga0207655_1000199 3300025728 Bacteria 105047
266 Ga0207655_1005152 3300025728 Bacteria 8996
267 Ga0207655_1027244 3300025728 Bacteria 2726
268 Ga0207713_1000052 3300025735 Bacteria 222663
269 Ga0207713_1000139 3300025735 Bacteria 110486
270 Ga0207713_1025113 3300025735 Bacteria 2758
271 Ga0207692_10084596 3300025898 Bacteria 1705
272 Ga0207710_10001857 3300025900 Bacteria 10173
273 Ga0207710_10003932 3300025900 Bacteria 6556
274 Ga0207680_10000001 3300025903 Bacteria 1091453
275 Ga0207647_10014966 3300025904 Bacteria 5332
276 Ga0207647_10015456 3300025904 Bacteria 5231
277 Ga0207647_10017939 3300025904 Bacteria 4800
278 Ga0207705_10000012 3300025909 Bacteria 472336
279 Ga0207705_10001178 3300025909 Bacteria 21244
280 Ga0207705_10009473 3300025909 Bacteria 7085
281 Ga0207705_10026081 3300025909 Unclassified 4170
282 Ga0207684_10003569 3300025910 Bacteria 15137
283 Ga0207654_10000008 3300025911 Bacteria 375871
284 Ga0207654_10000021 3300025911 Bacteria 165620
285 Ga0207654_10036330 3300025911 Bacteria 2751
286 Ga0207707_10083145 3300025912 Unclassified 2795
287 Ga0207695_10000035 3300025913 Bacteria 486590
288 Ga0207695_10000188 3300025913 Bacteria 178721
289 Ga0207695_10002026 3300025913 Bacteria 31122
290 Ga0207695_10003052 3300025913 Bacteria 24001
291 Ga0207695_10007747 3300025913 Bacteria 13607
292 Ga0207695_10022190 3300025913 Bacteria 7218
293 Ga0207695_10037713 3300025913 Bacteria 5213
294 Ga0207695_10048325 3300025913 Bacteria 4494
295 Ga0207695_10052357 3300025913 Unclassified 4278
296 Ga0207695_10123972 3300025913 Unclassified 2549
297 Ga0207695_10127565 3300025913 Bacteria 2505
298 Ga0207695_10139147 3300025913 Unclassified 2378
299 Ga0207671_10000305 3300025914 Bacteria 72354
300 Ga0207671_10004903 3300025914 Bacteria 12573
301 Ga0207671_10029598 3300025914 Bacteria 4089
302 Ga0207693_10050145 3300025915 Bacteria 3278
303 Ga0207693_10058722 3300025915 Bacteria 3013
304 Ga0207693_10083612 3300025915 Bacteria 2501
305 Ga0207663_10113775 3300025916 Bacteria 1841
306 Ga0207660_10056445 3300025917 Bacteria 2810
307 Ga0207660_10130259 3300025917 Bacteria 1914
308 Ga0207657_10079582 3300025919 Bacteria 2757
309 Ga0207652_10001274 3300025921 Bacteria 22442
310 Ga0207652_10016441 3300025921 Bacteria 6042
311 Ga0207652_10062711 3300025921 Bacteria 3212
312 Ga0207646_10002951 3300025922 Bacteria 19693
313 Ga0207694_10000180 3300025924 Bacteria 65444
314 Ga0207694_10002063 3300025924 Bacteria 16607
315 Ga0207694_10008781 3300025924 Bacteria 7625
316 Ga0207694_10030475 3300025924 Bacteria 4120
317 Ga0207694_10049316 3300025924 Bacteria 3259
318 Ga0207687_10047510 3300025927 Bacteria 2976
319 Ga0207700_10010671 3300025928 Bacteria 5811
320 Ga0207664_10095536 3300025929 Unclassified 2445
321 Ga0207644_10028615 3300025931 Bacteria 3860
322 Ga0207709_10000008 3300025935 Bacteria 713099
323 Ga0207691_10052156 3300025940 Bacteria 3736
324 Ga0207711_10000008 3300025941 Bacteria 597686
325 Ga0207711_10000010 3300025941 Bacteria 557970
326 Ga0207711_10008053 3300025941 Bacteria 8821
327 Ga0207661_10008161 3300025944 Bacteria 7473
328 Ga0207661_10019954 3300025944 Bacteria 5003
329 Ga0207661_10087181 3300025944 Bacteria 2592
330 Ga0207679_10066908 3300025945 Bacteria 2694
331 Ga0207679_10077054 3300025945 Bacteria 2535
332 Ga0207667_10000062 3300025949 Bacteria 190422
333 Ga0207667_10003059 3300025949 Bacteria 20741
334 Ga0207667_10018423 3300025949 Bacteria 7829
335 Ga0207667_10023717 3300025949 Bacteria 6756
336 Ga0207667_10064950 3300025949 Bacteria 3808
337 Ga0207667_10071190 3300025949 Bacteria 3617
338 Ga0207667_10095332 3300025949 Bacteria 3072
339 Ga0207712_10054655 3300025961 Bacteria 2805
340 Ga0207712_10125702 3300025961 Bacteria 1946
341 Ga0207640_10000022 3300025981 Bacteria 167526
342 Ga0207658_10004075 3300025986 Bacteria 10204
343 Ga0207658_10038103 3300025986 Bacteria 3461
344 Ga0207677_10001044 3300026023 Bacteria 15218
345 Ga0207677_10004037 3300026023 Bacteria 7834
346 Ga0207703_10001798 3300026035 Bacteria 19132
347 Ga0207639_10016492 3300026041 Bacteria 5229
348 Ga0207639_10046593 3300026041 Unclassified 3272
349 Ga0207639_10150134 3300026041 Bacteria 1951
350 Ga0207678_10002009 3300026067 Bacteria 18512
351 Ga0207678_10002837 3300026067 Bacteria 15710
352 Ga0207678_10053331 3300026067 Bacteria 3485
353 Ga0207678_10174847 3300026067 Bacteria 1833
354 Ga0207702_10000286 3300026078 Bacteria 58533
355 Ga0207702_10020413 3300026078 Bacteria 5488
356 Ga0207641_10106294 3300026088 Bacteria 2480
357 Ga0207676_10136493 3300026095 Bacteria 2093
358 Ga0207674_10000538 3300026116 Bacteria 49663
359 Ga0207674_10035398 3300026116 Bacteria 5210
360 Ga0207698_10000032 3300026142 Bacteria 112742
361 Ga0207698_10014367 3300026142 Bacteria 5261
362 Ga0207698_10052478 3300026142 Unclassified 3124
363 Ga0209281_1000014 3300027111 Bacteria 643021
364 Ga0209281_1000079 3300027111 Bacteria 261444
365 Ga0209281_1000142 3300027111 Bacteria 174280
366 Ga0209281_1000225 3300027111 Bacteria 120218
367 Ga0209281_1000901 3300027111 Bacteria 24924
368 Ga0209371_1006814 3300027312 Bacteria 4136
369 Ga0268266_10000059 3300028379 Bacteria 269485
370 Ga0268266_10001065 3300028379 Bacteria 34389
371 Ga0268266_10004302 3300028379 Bacteria 13710
372 Ga0268266_10032237 3300028379 Bacteria 4452
373 Ga0268266_10066031 3300028379 Bacteria 3128
374 Ga0268265_10012507 3300028380 Bacteria 5751
375 Ga0268264_10006133 3300028381 Bacteria 10156
376 Ga0265326_10010191 3300028558 Bacteria 2794
377 Ga0265319_1009371 3300028563 Bacteria 4177
378 Ga0265318_10006291 3300028577 Bacteria 5487
379 Ga0307515_10015541 3300028794 Bacteria 14012
380 Ga0265338_10000291 3300028800 Bacteria 90081
381 Ga0265324_10011722 3300029957 Bacteria 3333
382 Ga0307511_10000192 3300030521 Bacteria 60792
383 Ga0307511_10012036 3300030521 Bacteria 8511
384 Ga0265320_10029046 3300031240 Bacteria 2865
385 Ga0265327_10000032 3300031251 Bacteria 318763
386 Ga0265327_10026071 3300031251 Bacteria 3393
387 Ga0265316_10014114 3300031344 Bacteria 7048
388 Ga0265316_10116253 3300031344 Bacteria 2022
389 Ga0307513_10009145 3300031456 Bacteria 12551
390 Ga0307513_10079857 3300031456 Bacteria 3377
391 Ga0265313_10010274 3300031595 Bacteria 5949
392 Ga0265313_10031092 3300031595 Bacteria 2739
393 Ga0265314_10000203 3300031711 Bacteria 87485
394 Ga0265314_10005471 3300031711 Bacteria 11453
395 Ga0307510_10000003 3300033180 Bacteria 756654
396 Ga0307510_10000010 3300033180 Bacteria 377457
397 Ga0307510_10000070 3300033180 Bacteria 77054
398 Ga0307510_10047132 3300033180 Bacteria 4623
399 Ga0307510_10118104 3300033180 Bacteria 2366
400 Ga0373933_0019237 3300035724 Bacteria 3854
401 Ga0373937_0021309 3300036401 Bacteria 5817
402 Ga0316584_0189810 3300036712 Bacteria 1519
403 Ga0395899_0000370 3300037312 Bacteria 54053
404 Ga0395899_0027279 3300037312 Bacteria 4306
405 Ga0395898_0018016 3300037466 Bacteria 7205
406 Ga0395898_0036061 3300037466 Unclassified 4914
407 Ga0395898_0115288 3300037466 Bacteria 2574
408 Ga0395905_0010150 3300037471 Bacteria 9177
409 Ga0395905_0130811 3300037471 Bacteria 2360
410 Ga0395901_0027021 3300038443 Bacteria 5894
411 Ga0400483_275741 3300039062 Bacteria 3212
412 Ga0436365_0325190 3300039437 Bacteria 2292
413 Ga0439438_000814 3300041405 Bacteria 13947
414 Ga0439466_0013918 3300041411 Bacteria 2938
415 Ga0439432_005270 3300042006 Bacteria 4666
416 Ga0451577_0000030 3300042876 Bacteria 391423
417 Ga0451577_0000034 3300042876 Bacteria 376183
418 Ga0451577_0003397 3300042876 Bacteria 17787
419 Ga0451577_0005843 3300042876 Bacteria 12451
420 Ga0451577_0010861 3300042876 Bacteria 8651
421 Ga0451577_0013839 3300042876 Bacteria 7536
422 Ga0451577_0026907 3300042876 Bacteria 5207
423 Ga0451577_0033257 3300042876 Bacteria 4648
424 Ga0451577_0055938 3300042876 Bacteria 3519
425 Ga0451577_0087380 3300042876 Unclassified 2782
426 Ga0451577_0123060 3300042876 Bacteria 2324
427 Ga0451577_0159197 3300042876 Bacteria 2033
428 Ga0451577_0193069 3300042876 Bacteria 1837
429 Ga0453683_0000005 3300044673 Bacteria 741657
430 Ga0453683_0000122 3300044673 Bacteria 116184
431 Ga0453683_0000754 3300044673 Bacteria 32636
432 Ga0453683_0001313 3300044673 Bacteria 21932
433 Ga0453683_0021161 3300044673 Bacteria 4152
434 Ga0453683_0025987 3300044673 Bacteria 3717
435 Ga0453683_0037580 3300044673 Bacteria 3046
436 Ga0453683_0039140 3300044673 Bacteria 2980
437 Ga0453683_0061216 3300044673 Unclassified 2354
438 Ga0453683_0068216 3300044673 Bacteria 2223
439 Ga0453683_0098007 3300044673 Bacteria 1840
440 Ga0453683_0099177 3300044673 Bacteria 1829
441 Ga0453684_0000001 3300044712 Bacteria 2623166
442 Ga0453684_0000010 3300044712 Bacteria 1133422
443 Ga0453684_0000098 3300044712 Bacteria 376183
444 Ga0453684_0000260 3300044712 Bacteria 227076
445 Ga0453684_0000557 3300044712 Bacteria 140566
446 Ga0453684_0001093 3300044712 Bacteria 85531
447 Ga0453684_0001226 3300044712 Bacteria 78620
448 Ga0453684_0001814 3300044712 Bacteria 56316
449 Ga0453684_0003020 3300044712 Bacteria 39129
450 Ga0453684_0004244 3300044712 Bacteria 30652
451 Ga0453684_0023515 3300044712 Bacteria 9066
452 Ga0453684_0030146 3300044712 Bacteria 7672
453 Ga0453684_0038963 3300044712 Bacteria 6483
454 Ga0453684_0044064 3300044712 Bacteria 5981
455 Ga0453684_0069386 3300044712 Bacteria 4471
456 Ga0453684_0075348 3300044712 Bacteria 4241
457 Ga0453684_0105599 3300044712 Bacteria 3434
458 Ga0453684_0110210 3300044712 Unclassified 3346
459 Ga0453684_0130461 3300044712 Bacteria 3016
460 Ga0453684_0148379 3300044712 Bacteria 2790
461 Ga0453684_0228653 3300044712 Bacteria 2149
462 Ga0451576_0000036 3300045051 Bacteria 376183
463 Ga0451576_0000103 3300045051 Bacteria 217967
464 Ga0451576_0000948 3300045051 Bacteria 54439
465 Ga0451576_0001706 3300045051 Bacteria 36282
466 Ga0451576_0001972 3300045051 Bacteria 32636
467 Ga0451576_0002281 3300045051 Bacteria 29258
468 Ga0451576_0003128 3300045051 Bacteria 23199
469 Ga0451576_0007861 3300045051 Bacteria 12639
470 Ga0451576_0008105 3300045051 Bacteria 12382
471 Ga0451576_0012394 3300045051 Bacteria 9577
472 Ga0451576_0032699 3300045051 Bacteria 5534
473 Ga0451576_0085689 3300045051 Bacteria 3277
474 Ga0451576_0091252 3300045051 Bacteria 3169
475 Ga0451576_0119971 3300045051 Bacteria 2738
476 Ga0451576_0233965 3300045051 Bacteria 1919
477 Ga0451576_0245941 3300045051 Bacteria 1869
478 Ga0466958_0011133 3300045836 Bacteria 5060
479 Ga0466958_0025823 3300045836 Bacteria 3467
480 Ga0495627_000015 3300046453 Bacteria 320787
481 Ga0495590_0000001 3300046457 Bacteria 762984
482 Ga0495638_0000609 3300046460 Bacteria 40051
483 Ga0495653_0045381 3300046463 Bacteria 3407
484 Ga0495653_0060227 3300046463 Bacteria 2877
485 Ga0495650_0000332 3300046471 Bacteria 84720
486 Ga0495650_0003894 3300046471 Bacteria 10558
487 Ga0495605_0000116 3300046474 Bacteria 103357
488 Ga0495605_0024767 3300046474 Bacteria 3136
489 Ga0495605_0027905 3300046474 Bacteria 2919
490 Ga0495584_0000982 3300046491 Bacteria 17889
491 Ga0495594_0047329 3300046499 Bacteria 2361
492 Ga0495596_0011965 3300046500 Bacteria 3724
493 Ga0495607_0002760 3300046501 Bacteria 14001
494 Ga0495607_0006595 3300046501 Bacteria 8146
495 Ga0495607_0042820 3300046501 Bacteria 2681
496 Ga0495583_0000431 3300046506 Bacteria 63149
497 Ga0495606_0027355 3300046507 Bacteria 4047
498 Ga0495606_0159187 3300046507 Bacteria 1319
499 Ga0495616_0001926 3300046513 Bacteria 13964
500 Ga0495632_0002076 3300046519 Bacteria 15693
501 Ga0495643_0000383 3300046522 Bacteria 58554
502 Ga0495643_0001216 3300046522 Bacteria 24920
503 Ga0495642_0023972 3300046528 Bacteria 2412
504 Ga0495654_0000191 3300046530 Bacteria 59909
505 Ga0495654_0005624 3300046530 Bacteria 7251
506 Ga0495654_0022429 3300046530 Bacteria 3279
507 Ga0495654_0032405 3300046530 Bacteria 2649
508 Ga0495609_0000021 3300046538 Bacteria 281770
509 Ga0495597_0000704 3300046542 Bacteria 26756
510 Ga0495633_0019395 3300046558 Bacteria 3440
511 Ga0495611_0017036 3300046648 Bacteria 3106
512 Ga0495625_0000178 3300046660 Bacteria 98905
513 Ga0495625_0002671 3300046660 Bacteria 18973
514 Ga0495625_0012201 3300046660 Bacteria 6969
515 Ga0495625_0017113 3300046660 Bacteria 5682
516 Ga0495625_0022225 3300046660 Bacteria 4867
517 Ga0495661_0000091 3300046665 Bacteria 110008
518 Ga0495661_0000296 3300046665 Bacteria 56421
519 Ga0495661_0023504 3300046665 Bacteria 4000
520 Ga0495588_0000083 3300046674 Bacteria 197018
521 Ga0495588_0001881 3300046674 Bacteria 8945
522 Ga0495669_0007706 3300046684 Bacteria 4519
523 Ga0495670_0000008 3300046691 Bacteria 219555
524 Ga0495649_0065392 3300046694 Unclassified 1952
525 Ga0495589_0000013 3300046794 Bacteria 248616
526 Ga0495589_0000022 3300046794 Bacteria 196021
527 Ga0495589_0055057 3300046794 Bacteria 1960
528 Ga0495660_0000044 3300046810 Bacteria 150926
529 Ga0495660_0000121 3300046810 Bacteria 85122
530 Ga0495660_0034294 3300046810 Bacteria 2841
531 Ga0495672_0000156 3300047320 Bacteria 98712
532 Ga0495672_0001631 3300047320 Bacteria 21827
533 Ga0495672_0001702 3300047320 Bacteria 21328
534 Ga0495683_0026391 3300047323 Bacteria 2973
535 Ga0495683_0033438 3300047323 Bacteria 2616
536 Ga0495687_000099 3300047443 Bacteria 132139
537 Ga0495687_000151 3300047443 Bacteria 105607
538 Ga0495687_025883 3300047443 Bacteria 2767
539 Ga0495677_0004730 3300047445 Bacteria 5185
540 Ga0495677_0009316 3300047445 Bacteria 3628
541 Ga0495677_0011693 3300047445 Bacteria 3208
542 Ga0495679_000169 3300047446 Bacteria 59122
543 Ga0495679_001444 3300047446 Bacteria 13471
544 Ga0495673_0000343 3300047469 Bacteria 58816
545 Ga0495681_0013827 3300047470 Bacteria 4666
546 Ga0495686_0000018 3300047472 Bacteria 434962
547 Ga0495686_0007246 3300047472 Bacteria 8346
548 Ga0495686_0008641 3300047472 Bacteria 7438
549 Ga0495686_0032453 3300047472 Plasmid 3380
550 Ga0495602_0083056 3300048088 Bacteria 2685
551 Ga0495626_0000021 3300048091 Bacteria 217213
552 Ga0496101_0071141 3300048904 Unclassified 2550
553 Ga0496105_0092371 3300048908 Bacteria 2499
554 Ga0496109_0044819 3300048912 Unclassified 4013
555 Ga0496110_0130710 3300048913 Unclassified 2267
556 Ga0496115_0124642 3300048918 Bacteria 2122
557 Ga0496117_0018705 3300048920 Bacteria 5724
558 Ga0496118_0012888 3300048921 Bacteria 7967
559 Ga0496119_0001662 3300048922 Bacteria 26028
560 Ga0496120_0002669 3300048923 Bacteria 17571
561 Ga0496121_0083402 3300048924 Bacteria 2523
562 Ga0496122_0001639 3300048925 Bacteria 34793
563 Ga0496122_0019663 3300048925 Bacteria 6156
564 Ga0496123_0001205 3300048926 Bacteria 37836
565 Ga0496124_0001923 3300048927 Bacteria 28444
566 Ga0496124_0022135 3300048927 Bacteria 5834
567 Ga0496124_0026932 3300048927 Bacteria 5174
568 Ga0496124_0206134 3300048927 Bacteria 1491
569 Ga0496125_0000405 3300048928 Bacteria 80765
570 Ga0496125_0000509 3300048928 Bacteria 67449
571 Ga0496126_0000042 3300048929 Bacteria 340121
572 Ga0496126_0000074 3300048929 Bacteria 235643
573 Ga0496126_0007416 3300048929 Bacteria 12032
574 Ga0496126_0012853 3300048929 Bacteria 8555
575 Ga0496126_0131622 3300048929 Bacteria 2161
576 Ga0495678_000009 3300049459 Bacteria 373806
577 Ga0495678_002710 3300049459 Bacteria 11676
578 Ga0501033_0163509 3300049570 Bacteria 1601
579 Ga0501034_0079080 3300049571 Bacteria 3292
580 Ga0501037_0064643 3300049573 Bacteria 2666
581 Ga0501039_0041135 3300049575 Bacteria 3569
582 Ga0501043_0028839 3300049579 Bacteria 4357
583 Ga0501043_0062124 3300049579 Bacteria 2933
584 Ga0501043_0125017 3300049579 Unclassified 2016
585 Ga0501047_0009474 3300049581 Bacteria 9200
586 Ga0501047_0037425 3300049581 Bacteria 4692
587 Ga0501047_0049728 3300049581 Bacteria 4047
588 Ga0501047_0146152 3300049581 Bacteria 2241
589 Ga0501070_0008289 3300049586 Bacteria 8784
590 Ga0501080_0178897 3300049742 Bacteria 1953
591 Ga0501035_0011822 3300049822 Bacteria 8084
592 Ga0501035_0016453 3300049822 Bacteria 6821
593 Ga0501035_0031905 3300049822 Bacteria 4797
594 Ga0501035_0034882 3300049822 Bacteria 4570
595 Ga0501035_0189367 3300049822 Bacteria 1769
596 Ga0501044_0003640 3300049823 Bacteria 17346
597 Ga0501044_0004964 3300049823 Bacteria 14878
598 Ga0501044_0008162 3300049823 Bacteria 11487
599 Ga0501044_0046629 3300049823 Bacteria 4486
600 Ga0500646_0018661 3300053090 Bacteria 1829
601 Ga0500583_0030559 3300053092 Bacteria 2361
602 Ga0500595_017845 3300053119 Unclassified 2608
603 Ga0500652_025006 3300053131 Bacteria 2284
604 Ga0500588_0001788 3300053146 Bacteria 4188
605 Ga0500622_0002425 3300053156 Bacteria 13460
606 Ga0500639_012162 3300053163 Bacteria 4516
607 Ga0500584_007517 3300053726 Bacteria 4739
608 Ga0466962_0119329 3300061719 Bacteria 1272
609 2508854186 2508501071 Bacteria 5454741
610 2520882595 2519899754 Bacteria 5336938
611 2555260061 2554235234 Bacteria 5762085
612 2585197866 2582581293 Bacteria 5907401
613 2599412548 2599185169 Bacteria 5441380
614 2601644129 2600255287 Bacteria 5210468
615 2601663954 2600255291 Bacteria 5217298
616 2601696911 2600255298 Bacteria 5215185
617 2601701960 2600255299 Bacteria 5218662
618 2601722360 2600255303 Bacteria 5219315
619 2601743207 2600255307 Bacteria 5439064
620 2601754001 2600255309 Bacteria 5431045
621 2602021095 2600255392 Bacteria 5437392
622 2603662112 2602042052 Bacteria 5215873
623 2603667011 2602042053 Bacteria 5214361
624 2603877823 2602042111 Bacteria 5212080
625 2606071684 2603880184 Bacteria 5217896
626 2644009461 2643221600 Bacteria 5530138
627 2644233858 2643221642 Bacteria 5357871
628 2671587170 2671180115 Bacteria 5353919
629 2676405291 2675903046 Bacteria 5451247
630 2722731082 2721755487 Bacteria 6357185
631 2738734424 2738541279 Bacteria 6149495
632 2738767182 2738541285 Bacteria 6150075
633 2739216005 2738543007 Bacteria 6149845
634 2739790686 2739367756 Bacteria 4553612
635 2791921285 2791354903 Bacteria 4937680
636 2807180144 2806310673 Bacteria 4801221
637 2817416656 2816332280 Bacteria 5109718
638 2830076808 2830075706 Bacteria 3855215
639 2857557036 2857553236 Bacteria 6166726
640 2884414554 2884411467 Bacteria 5246714
641 2891675314 2891670763 Bacteria 4967099
642 2919111186 2919108558 Bacteria 5897419
643 2919194497 2919191525 Bacteria 5765973
644 2919477487 2919476304 Bacteria 5888696
645 2920108727 2920107658 Bacteria 10042636
646 2928966791 2928963466 Bacteria 5165703
647 2929153381 2929150217 Bacteria 5462483
648 2929924798 2929921140 Bacteria 8649150
649 2939575649 2939573065 Bacteria 4926053
650 2939606390 2939602548 Bacteria 4950493
651 2958462461 2958458903 Bacteria 5301041
652 2971822289 2971820967 Bacteria 5823634
653 640939790 640753048 Bacteria 5495657
654 8003156285 8003151029 Bacteria 8187759
655 8054852169 8054849141 Bacteria 5232694
656 8055095698 8055092621 Bacteria 4873875
657 8055100446 8055097453 Bacteria 4865496
658 8055694793 8055693939 Bacteria 4772047
659 8057306554 8057304971 Bacteria 4649742
660 Ga0495681_0018487
661 SwRhRL2b_contig_1650735
662 JGI24735J21928_10003364
663 JGI24735J21928_10013377
664 JGI25162J39368_1000751
665 JGI25154J39366_1000028
666 JGI25157J39369_1001285
667 JGI25153J46596_10006976
668 JGI25153J46596_10011924
669 rootH1_10006496
670 rootH1_10039085
671 rootH1_10121669
672 rootH2_10002124
673 rootH2_10011842
674 rootH2_10013751
675 rootH2_10034304
676 rootH2_10049273
677 rootH2_10059965
678 rootH2_10084100
679 rootH2_10133820
680 rootL2_10029592
681 rootL2_10106337
682 rootL2_10251988
683 JGI25160J50197_1004507
684 Ga0055542_1000230
685 Ga0055528_1000029
686 Ga0055530_10000551
687 Ga0058692_1002427
688 Ga0058692_1006407
689 Ga0065165_1000052
690 Ga0065165_1001448
691 Ga0065165_1017901
692 Ga0065703_1018781
693 Ga0065704_10001610
694 Ga0065704_10073199
695 Ga0065704_10085567
696 Ga0070658_10000006
697 Ga0070658_10000355
698 Ga0070658_10001785
699 Ga0070658_10011799
700 Ga0070658_10014817
701 Ga0070658_10026725
702 Ga0070683_100009887
703 Ga0070683_100016329
704 Ga0070683_100083473
705 Ga0070683_100114300
706 Ga0068869_100007051
707 Ga0070666_10000013
708 Ga0070666_10033504
709 Ga0068868_100029026
710 Ga0070660_100217318
711 Ga0070671_100034239
712 Ga0070671_100069878
713 Ga0070667_100010129
714 Ga0070714_100028908
715 Ga0070714_100077324
716 Ga0070713_100000709
717 Ga0070710_10051836
718 Ga0070708_100017849
719 Ga0070708_100134765
720 Ga0070663_100169741
721 Ga0070681_10018105
722 Ga0070681_10066757
723 Ga0070706_100026495
724 Ga0070706_100068757
725 Ga0070707_100004902
726 Ga0070707_100059641
727 Ga0070698_100029627
728 Ga0070698_100030913
729 Ga0070699_100067891
730 Ga0070679_100001816
731 Ga0070679_100015518
732 Ga0070679_100098274
733 Ga0070684_100040889
734 Ga0070684_100082046
735 Ga0070697_100041878
736 Ga0068853_100013405
737 Ga0068853_100045938
738 Ga0070665_100010184
739 Ga0070665_100055410
740 Ga0070665_100066905
741 Ga0070665_100102037
742 Ga0070665_100134621
743 Ga0070704_100112764
744 Ga0068855_100000148
745 Ga0068855_100005929
746 Ga0068855_100006646
747 Ga0068855_100011888
748 Ga0068855_100019045
749 Ga0068855_100033705
750 Ga0068855_100111364
751 Ga0068855_100147403
752 Ga0068855_100213171
753 Ga0070664_100110284
754 Ga0068857_100001579
755 Ga0068857_100004216
756 Ga0068857_100062339
757 Ga0068854_100000054
758 Ga0068854_100034084
759 Ga0068856_100001773
760 Ga0068852_100003810
761 Ga0068859_100012271
762 Ga0068859_100054448
763 Ga0068864_100063293
764 Ga0068851_10014782
765 Ga0068851_10015576
766 Ga0068863_100028902
767 Ga0068858_100002682
768 Ga0068860_100001987
769 Ga0068860_100005502
770 Ga0068860_100084604
771 Ga0068862_100004867
772 Ga0068862_100097952
773 Ga0070717_10004293
774 Ga0070717_10007004
775 Ga0070717_10118800
776 Ga0097621_100018922
777 Ga0097621_100064327
778 Ga0068871_100007526
779 Ga0075433_10243530
780 Ga0097620_100012271
781 Ga0097620_100054450
782 Ga0099824_1002532
783 Ga0079104_1000201
784 Ga0079104_1000365
785 Ga0079104_1001078
786 Ga0079104_1002451
787 Ga0079104_1003548
788 Ga0079104_1017543
789 Ga0099826_10005490
790 Ga0105251_10000556
791 Ga0105251_10002699
792 Ga0105244_10000007
793 Ga0105244_10000075
794 Ga0105244_10001065
795 Ga0105244_10003093
796 Ga0105244_10032945
797 Ga0105250_10000492
798 Ga0105250_10001277
799 Ga0105250_10003227
800 Ga0105240_10000594
801 Ga0105240_10001347
802 Ga0105240_10003557
803 Ga0105240_10007025
804 Ga0105240_10008652
805 Ga0105240_10011955
806 Ga0105240_10021450
807 Ga0105240_10028599
808 Ga0105240_10034646
809 Ga0105240_10047255
810 Ga0105240_10056838
811 Ga0105240_10177519
812 Ga0105245_10010013
813 Ga0105245_10013828
814 Ga0105247_10009610
815 Ga0105247_10042366
816 Ga0105247_10117117
817 Ga0105243_10000003
818 Ga0105241_10000006
819 Ga0105241_10000082
820 Ga0105241_10007395
821 Ga0105241_10030547
822 Ga0105241_10142380
823 Ga0105242_10079151
824 Ga0105248_10000004
825 Ga0105248_10006857
826 Ga0105248_10107745
827 Ga0105237_10000245
828 Ga0105237_10068011
829 Ga0105237_10071675
830 Ga0105238_10000098
831 Ga0105238_10004480
832 Ga0105238_10013476
833 Ga0105238_10031788
834 Ga0105238_10040480
835 Ga0105238_10044434
836 Ga0105238_10050752
837 Ga0105238_10068275
838 Ga0105238_10106064
839 Ga0105238_10194689
840 Ga0105249_10033978
841 Ga0105239_10000569
842 Ga0105239_10031957
843 Ga0105239_10039229
844 Ga0105239_10117574
845 Ga0105239_10206092
846 Ga0105246_10007351
847 Ga0157373_10053635
848 Ga0157373_10082762
849 Ga0157371_10060811
850 Ga0157370_10000195
851 Ga0157370_10004397
852 Ga0157370_10005642
853 Ga0157370_10009996
854 Ga0157370_10073257
855 Ga0157370_10105532
856 Ga0157369_10000711
857 Ga0157369_10002489
858 Ga0157369_10004540
859 Ga0157369_10010663
860 Ga0157369_10011538
861 Ga0157369_10017521
862 Ga0157369_10025541
863 Ga0157369_10025596
864 Ga0157369_10119639
865 Ga0157374_10001735
866 Ga0157374_10006894
867 Ga0157374_10006930
868 Ga0157374_10013101
869 Ga0157374_10015187
870 Ga0157374_10016088
871 Ga0157374_10025430
872 Ga0157374_10120865
873 Ga0157374_10139496
874 Ga0157378_10000036
875 Ga0157378_10005409
876 Ga0157378_10024465
877 Ga0157378_10043623
878 Ga0157378_10139238
879 Ga0163162_10025780
880 Ga0163162_10029109
881 Ga0157372_10003822
882 Ga0157372_10006837
883 Ga0157372_10009966
884 Ga0157372_10010289
885 Ga0157372_10014580
886 Ga0157372_10023922
887 Ga0157372_10032773
888 Ga0157372_10131629
889 Ga0157372_10289977
890 Ga0157375_10004276
891 Ga0157375_10004846
892 Ga0157375_10146282
893 Ga0163163_10013483
894 Ga0163163_10028724
895 Ga0157379_10030932
896 Ga0157376_10024663
897 Ga0182006_1000455
898 Ga0163161_10000122
899 Ga0163161_10013240
900 Ga0163161_10092079
901 Ga0209674_100545
902 Ga0209437_100138
903 Ga0209437_101652
904 Ga0209258_103183
905 Ga0209646_1000006
906 Ga0209026_1000214
907 Ga0209026_1001073
908 Ga0209148_1000002
909 Ga0209233_1000705
910 Ga0209233_1014351
911 Ga0209673_1000187
912 Ga0209564_1001813
913 Ga0209758_1000392
914 Ga0209758_1036283
915 Ga0209050_1000259
916 Ga0207426_1000209
917 Ga0207426_1000678
918 Ga0209257_1004199
919 Ga0207656_10002511
920 Ga0207696_1000259
921 Ga0207696_1008441
922 Ga0207655_1000025
923 Ga0207655_1000196
924 Ga0207655_1000199
925 Ga0207655_1005152
926 Ga0207655_1027244
927 Ga0207713_1000052
928 Ga0207713_1000139
929 Ga0207713_1025113
930 Ga0207692_10084596
931 Ga0207710_10001857
932 Ga0207710_10003932
933 Ga0207680_10000001
934 Ga0207647_10014966
935 Ga0207647_10015456
936 Ga0207647_10017939
937 Ga0207705_10000012
938 Ga0207705_10001178
939 Ga0207705_10009473
940 Ga0207705_10026081
941 Ga0207684_10003569
942 Ga0207654_10000008
943 Ga0207654_10000021
944 Ga0207654_10036330
945 Ga0207707_10083145
946 Ga0207695_10000035
947 Ga0207695_10000188
948 Ga0207695_10002026
949 Ga0207695_10003052
950 Ga0207695_10007747
951 Ga0207695_10022190
952 Ga0207695_10037713
953 Ga0207695_10048325
954 Ga0207695_10052357
955 Ga0207695_10123972
956 Ga0207695_10127565
957 Ga0207695_10139147
958 Ga0207671_10000305
959 Ga0207671_10004903
960 Ga0207671_10029598
961 Ga0207693_10050145
962 Ga0207693_10058722
963 Ga0207693_10083612
964 Ga0207663_10113775
965 Ga0207660_10056445
966 Ga0207660_10130259
967 Ga0207657_10079582
968 Ga0207652_10001274
969 Ga0207652_10016441
970 Ga0207652_10062711
971 Ga0207646_10002951
972 Ga0207694_10000180
973 Ga0207694_10002063
974 Ga0207694_10008781
975 Ga0207694_10030475
976 Ga0207694_10049316
977 Ga0207687_10047510
978 Ga0207700_10010671
979 Ga0207664_10095536
980 Ga0207644_10028615
981 Ga0207709_10000008
982 Ga0207691_10052156
983 Ga0207711_10000008
984 Ga0207711_10000010
985 Ga0207711_10008053
986 Ga0207661_10008161
987 Ga0207661_10019954
988 Ga0207661_10087181
989 Ga0207679_10066908
990 Ga0207679_10077054
991 Ga0207667_10000062
992 Ga0207667_10003059
993 Ga0207667_10018423
994 Ga0207667_10023717
995 Ga0207667_10064950
996 Ga0207667_10071190
997 Ga0207667_10095332
998 Ga0207712_10054655
999 Ga0207712_10125702
1000 Ga0207640_10000022
1001 Ga0207658_10004075
1002 Ga0207658_10038103
1003 Ga0207677_10001044
1004 Ga0207677_10004037
1005 Ga0207703_10001798
1006 Ga0207639_10016492
1007 Ga0207639_10046593
1008 Ga0207639_10150134
1009 Ga0207678_10002009
1010 Ga0207678_10002837
1011 Ga0207678_10053331
1012 Ga0207678_10174847
1013 Ga0207702_10000286
1014 Ga0207702_10020413
1015 Ga0207641_10106294
1016 Ga0207676_10136493
1017 Ga0207674_10000538
1018 Ga0207674_10035398
1019 Ga0207698_10000032
1020 Ga0207698_10014367
1021 Ga0207698_10052478
1022 Ga0209281_1000014
1023 Ga0209281_1000079
1024 Ga0209281_1000142
1025 Ga0209281_1000225
1026 Ga0209281_1000901
1027 Ga0209371_1006814
1028 Ga0268266_10000059
1029 Ga0268266_10001065
1030 Ga0268266_10004302
1031 Ga0268266_10032237
1032 Ga0268266_10066031
1033 Ga0268265_10012507
1034 Ga0268264_10006133
1035 Ga0265326_10010191
1036 Ga0265319_1009371
1037 Ga0265318_10006291
1038 Ga0307515_10015541
1039 Ga0265338_10000291
1040 Ga0265324_10011722
1041 Ga0307511_10000192
1042 Ga0307511_10012036
1043 Ga0265320_10029046
1044 Ga0265327_10000032
1045 Ga0265327_10026071
1046 Ga0265316_10014114
1047 Ga0265316_10116253
1048 Ga0307513_10009145
1049 Ga0307513_10079857
1050 Ga0265313_10010274
1051 Ga0265313_10031092
1052 Ga0265314_10000203
1053 Ga0265314_10005471
1054 Ga0307510_10000003
1055 Ga0307510_10000010
1056 Ga0307510_10000070
1057 Ga0307510_10047132
1058 Ga0307510_10118104
1059 Ga0373933_0019237
1060 Ga0373937_0021309
1061 Ga0316584_0189810
1062 Ga0395899_0000370
1063 Ga0395899_0027279
1064 Ga0395898_0018016
1065 Ga0395898_0036061
1066 Ga0395898_0115288
1067 Ga0395905_0010150
1068 Ga0395905_0130811
1069 Ga0395901_0027021
1070 Ga0400483_275741
1071 Ga0436365_0325190
1072 Ga0439438_000814
1073 Ga0439466_0013918
1074 Ga0439432_005270
1075 Ga0451577_0000030
1076 Ga0451577_0000034
1077 Ga0451577_0003397
1078 Ga0451577_0005843
1079 Ga0451577_0010861
1080 Ga0451577_0013839
1081 Ga0451577_0026907
1082 Ga0451577_0033257
1083 Ga0451577_0055938
1084 Ga0451577_0087380
1085 Ga0451577_0123060
1086 Ga0451577_0159197
1087 Ga0451577_0193069
1088 Ga0453683_0000005
1089 Ga0453683_0000122
1090 Ga0453683_0000754
1091 Ga0453683_0001313
1092 Ga0453683_0021161
1093 Ga0453683_0025987
1094 Ga0453683_0037580
1095 Ga0453683_0039140
1096 Ga0453683_0061216
1097 Ga0453683_0068216
1098 Ga0453683_0098007
1099 Ga0453683_0099177
1100 Ga0453684_0000001
1101 Ga0453684_0000010
1102 Ga0453684_0000098
1103 Ga0453684_0000260
1104 Ga0453684_0000557
1105 Ga0453684_0001093
1106 Ga0453684_0001226
1107 Ga0453684_0001814
1108 Ga0453684_0003020
1109 Ga0453684_0004244
1110 Ga0453684_0023515
1111 Ga0453684_0030146
1112 Ga0453684_0038963
1113 Ga0453684_0044064
1114 Ga0453684_0069386
1115 Ga0453684_0075348
1116 Ga0453684_0105599
1117 Ga0453684_0110210
1118 Ga0453684_0130461
1119 Ga0453684_0148379
1120 Ga0453684_0228653
1121 Ga0451576_0000036
1122 Ga0451576_0000103
1123 Ga0451576_0000948
1124 Ga0451576_0001706
1125 Ga0451576_0001972
1126 Ga0451576_0002281
1127 Ga0451576_0003128
1128 Ga0451576_0007861
1129 Ga0451576_0008105
1130 Ga0451576_0012394
1131 Ga0451576_0032699
1132 Ga0451576_0085689
1133 Ga0451576_0091252
1134 Ga0451576_0119971
1135 Ga0451576_0233965
1136 Ga0451576_0245941
1137 Ga0466958_0011133
1138 Ga0466958_0025823
1139 Ga0495627_000015
1140 Ga0495590_0000001
1141 Ga0495638_0000609
1142 Ga0495653_0045381
1143 Ga0495653_0060227
1144 Ga0495650_0000332
1145 Ga0495650_0003894
1146 Ga0495605_0000116
1147 Ga0495605_0024767
1148 Ga0495605_0027905
1149 Ga0495584_0000982
1150 Ga0495594_0047329
1151 Ga0495596_0011965
1152 Ga0495607_0002760
1153 Ga0495607_0006595
1154 Ga0495607_0042820
1155 Ga0495583_0000431
1156 Ga0495606_0027355
1157 Ga0495606_0159187
1158 Ga0495616_0001926
1159 Ga0495632_0002076
1160 Ga0495643_0000383
1161 Ga0495643_0001216
1162 Ga0495642_0023972
1163 Ga0495654_0000191
1164 Ga0495654_0005624
1165 Ga0495654_0022429
1166 Ga0495654_0032405
1167 Ga0495609_0000021
1168 Ga0495597_0000704
1169 Ga0495633_0019395
1170 Ga0495611_0017036
1171 Ga0495625_0000178
1172 Ga0495625_0002671
1173 Ga0495625_0012201
1174 Ga0495625_0017113
1175 Ga0495625_0022225
1176 Ga0495661_0000091
1177 Ga0495661_0000296
1178 Ga0495661_0023504
1179 Ga0495588_0000083
1180 Ga0495588_0001881
1181 Ga0495669_0007706
1182 Ga0495670_0000008
1183 Ga0495649_0065392
1184 Ga0495589_0000013
1185 Ga0495589_0000022
1186 Ga0495589_0055057
1187 Ga0495660_0000044
1188 Ga0495660_0000121
1189 Ga0495660_0034294
1190 Ga0495672_0000156
1191 Ga0495672_0001631
1192 Ga0495672_0001702
1193 Ga0495683_0026391
1194 Ga0495683_0033438
1195 Ga0495687_000099
1196 Ga0495687_000151
1197 Ga0495687_025883
1198 Ga0495677_0004730
1199 Ga0495677_0009316
1200 Ga0495677_0011693
1201 Ga0495679_000169
1202 Ga0495679_001444
1203 Ga0495673_0000343
1204 Ga0495681_0013827
1205 Ga0495686_0000018
1206 Ga0495686_0007246
1207 Ga0495686_0008641
1208 Ga0495686_0032453
1209 Ga0495602_0083056
1210 Ga0495626_0000021
1211 Ga0496101_0071141
1212 Ga0496105_0092371
1213 Ga0496109_0044819
1214 Ga0496110_0130710
1215 Ga0496115_0124642
1216 Ga0496117_0018705
1217 Ga0496118_0012888
1218 Ga0496119_0001662
1219 Ga0496120_0002669
1220 Ga0496121_0083402
1221 Ga0496122_0001639
1222 Ga0496122_0019663
1223 Ga0496123_0001205
1224 Ga0496124_0001923
1225 Ga0496124_0022135
1226 Ga0496124_0026932
1227 Ga0496124_0206134
1228 Ga0496125_0000405
1229 Ga0496125_0000509
1230 Ga0496126_0000042
1231 Ga0496126_0000074
1232 Ga0496126_0007416
1233 Ga0496126_0012853
1234 Ga0496126_0131622
1235 Ga0495678_000009
1236 Ga0495678_002710
1237 Ga0501033_0163509
1238 Ga0501034_0079080
1239 Ga0501037_0064643
1240 Ga0501039_0041135
1241 Ga0501043_0028839
1242 Ga0501043_0062124
1243 Ga0501043_0125017
1244 Ga0501047_0009474
1245 Ga0501047_0037425
1246 Ga0501047_0049728
1247 Ga0501047_0146152
1248 Ga0501070_0008289
1249 Ga0501080_0178897
1250 Ga0501035_0011822
1251 Ga0501035_0016453
1252 Ga0501035_0031905
1253 Ga0501035_0034882
1254 Ga0501035_0189367
1255 Ga0501044_0003640
1256 Ga0501044_0004964
1257 Ga0501044_0008162
1258 Ga0501044_0046629
1259 Ga0500646_0018661
1260 Ga0500583_0030559
1261 Ga0500595_017845
1262 Ga0500652_025006
1263 Ga0500588_0001788
1264 Ga0500622_0002425
1265 Ga0500639_012162
1266 Ga0500584_007517
1267 Ga0466962_0119329
1268 2508854186
1269 2520882595
1270 2555260061
1271 2585197866
1272 2599412548
1273 2601644129
1274 2601663954
1275 2601696911
1276 2601701960
1277 2601722360
1278 2601743207
1279 2601754001
1280 2602021095
1281 2603662112
1282 2603667011
1283 2603877823
1284 2606071684
1285 2644009461
1286 2644233858
1287 2671587170
1288 2676405291
1289 2722731082
1290 2738734424
1291 2738767182
1292 2739216005
1293 2739790686
1294 2791921285
1295 2807180144
1296 2817416656
1297 2830076808
1298 2857557036
1299 2884414554
1300 2891675314
1301 2919111186
1302 2919194497
1303 2919477487
1304 2920108727
1305 2928966791
1306 2929153381
1307 2929924798
1308 2939575649
1309 2939606390
1310 2958462461
1311 2971822289
1312 640939790
1313 8003156285
1314 8054852169
1315 8055095698
1316 8055100446
1317 8055694793
1318 8057306554

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

80

526

0.94

PF07690

MFS_1

Major Facilitator Superfamily

84

477

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9141 17 453
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9138 17 453
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9099 17 453
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9097 17 453
4ja3-assembly1.cif.gz_A partially occluded inward open conformation of the xylose transporter xyle from e. coli 0.8981 13 449
ID Description Score Start End Superfamily
af_P0AEP1_8_453_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9603 12 463 1.20.1250.20
af_I1K6U5_2_263_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9502 14 248 1.20.1250.20
af_A0A1D6LG74_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9433 61 222 1.20.1250.20
af_P0AEP1_8_453_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9433 12 463 1.20.1250.20
af_Q54UC8_260_478_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9416 253 449 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3N5SKX6-F1-model_v4 deleted 0.9949 11 199
AF-A0A3N5SII1-F1-model_v4 deleted 0.9919 4 332
AF-A0A836RJU5-F1-model_v4 MFS transporter 0.9898 67 463 GO:0016020
GO:0022857
AF-A0A5J4Q740-F1-model_v4 D-xylose-proton symporter 0.9875 8 373 GO:0016020
GO:0022857
AF-W0AAI2-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9845 2 451 GO:0005886
GO:0022857

Map