F473282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 308 | 1318 | 469 |
Family's Representative Sequence
| Representative Sequence | 3300047470|Ga0495681_0018487|Ga0495681_0018487_1348_2931 |
| Length | 527 |
| Sequence | MTRRLYGWHGGASHAALPWRATDLAWLAGPHARLSFVRLPAEFIFITETKDHAMMHGVEHTISGNAAAARPASTTTLWLAAAVSALGGLLFGYDWVVIGGAKPFYEAWFQLVEPAQQAWAVSCALIGCLVGAIGSGWISDRLGRRRGLLIAALIFAVSSLGTGWAASFYSFIAWRIIGGVAIGLAAGLSPVYIAEIAPAAIRGRMVCLNQIAIVLGILGAQIVNLLIAEPVPAGATAAGLAASWNGTTGWRWMFAAAAVPAMAFLLGCLLIPESPRWLAGRGRQQDALAALHRLGGADYARDAMHDIGQALGAATGRTLKQVLAEPRFARVLGIGIVLAVLQQWCGINVIFNYAQEIFASAGYAVSDMLFNIVITGVVNCVFALVALATVERWGRRRLMLLGCAGLFVIYVALGACYLAGWQGWPLLLLVVTAIAVYSMTLAPVTWVALSEIFPQEVRGACMAVATTALWAACFLLTYTFPLINAAMGTGMTFWLYAVICLAGFVFVLRQLPETRGKSLEEIEQGWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 178 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 179 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 183 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 184 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 185 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 229 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 230 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 231 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 232 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 233 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 234 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 237 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 238 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 250 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 251 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 252 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 253 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 254 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 255 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 256 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 257 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 258 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 259 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 260 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 261 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 262 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 263 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 264 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 265 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 266 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 267 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 268 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 269 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 270 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 271 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 272 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 273 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 274 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 275 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 276 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 277 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 278 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 279 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 280 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 281 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 282 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 283 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 284 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 285 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 286 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 287 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 288 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 289 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 290 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 291 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 292 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 293 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 294 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 295 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 296 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 297 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 298 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 299 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 300 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 301 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 302 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 303 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 304 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 305 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 306 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 307 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 308 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.26 |
| Metatranscriptomes | 0 |
| Isolates | 7.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.16 |
| Nodule | 1.97 |
| Rhizoplane | 3.03 |
| Rhizosphere | 79.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495681_0018487 | 3300047470 | Bacteria | 3839 |
| 2 | SwRhRL2b_contig_1650735 | 2162886007 | Bacteria | 1921 |
| 3 | JGI24735J21928_10003364 | 3300002067 | Bacteria | 5457 |
| 4 | JGI24735J21928_10013377 | 3300002067 | Bacteria | 2582 |
| 5 | JGI25162J39368_1000751 | 3300002737 | Bacteria | 22045 |
| 6 | JGI25154J39366_1000028 | 3300002738 | Bacteria | 195818 |
| 7 | JGI25157J39369_1001285 | 3300002741 | Bacteria | 10091 |
| 8 | JGI25153J46596_10006976 | 3300003215 | Bacteria | 5628 |
| 9 | JGI25153J46596_10011924 | 3300003215 | Bacteria | 3803 |
| 10 | rootH1_10006496 | 3300003316 | Bacteria | 3429 |
| 11 | rootH1_10039085 | 3300003316 | Bacteria | 4064 |
| 12 | rootH1_10121669 | 3300003316 | Bacteria | 2764 |
| 13 | rootH2_10002124 | 3300003320 | Bacteria | 9338 |
| 14 | rootH2_10011842 | 3300003320 | Bacteria | 4956 |
| 15 | rootH2_10013751 | 3300003320 | Bacteria | 43446 |
| 16 | rootH2_10034304 | 3300003320 | Bacteria | 3291 |
| 17 | rootH2_10049273 | 3300003320 | Bacteria | 21502 |
| 18 | rootH2_10059965 | 3300003320 | Bacteria | 2274 |
| 19 | rootH2_10084100 | 3300003320 | Bacteria | 3343 |
| 20 | rootH2_10133820 | 3300003320 | Bacteria | 3311 |
| 21 | rootL2_10029592 | 3300003322 | Bacteria | 11227 |
| 22 | rootL2_10106337 | 3300003322 | Bacteria | 10478 |
| 23 | rootL2_10251988 | 3300003322 | Bacteria | 2088 |
| 24 | JGI25160J50197_1004507 | 3300003354 | Bacteria | 6014 |
| 25 | Ga0055542_1000230 | 3300003762 | Bacteria | 65902 |
| 26 | Ga0055528_1000029 | 3300003790 | Bacteria | 122126 |
| 27 | Ga0055530_10000551 | 3300003791 | Bacteria | 32460 |
| 28 | Ga0058692_1002427 | 3300003856 | Bacteria | 6242 |
| 29 | Ga0058692_1006407 | 3300003856 | Bacteria | 3241 |
| 30 | Ga0065165_1000052 | 3300005262 | Bacteria | 192010 |
| 31 | Ga0065165_1001448 | 3300005262 | Bacteria | 25708 |
| 32 | Ga0065165_1017901 | 3300005262 | Bacteria | 2589 |
| 33 | Ga0065703_1018781 | 3300005272 | Bacteria | 8629 |
| 34 | Ga0065704_10001610 | 3300005289 | Bacteria | 12189 |
| 35 | Ga0065704_10073199 | 3300005289 | Bacteria | 7461 |
| 36 | Ga0065704_10085567 | 3300005289 | Bacteria | 3209 |
| 37 | Ga0070658_10000006 | 3300005327 | Bacteria | 374835 |
| 38 | Ga0070658_10000355 | 3300005327 | Bacteria | 39796 |
| 39 | Ga0070658_10001785 | 3300005327 | Bacteria | 18113 |
| 40 | Ga0070658_10011799 | 3300005327 | Bacteria | 7012 |
| 41 | Ga0070658_10014817 | 3300005327 | Bacteria | 6248 |
| 42 | Ga0070658_10026725 | 3300005327 | Bacteria | 4632 |
| 43 | Ga0070683_100009887 | 3300005329 | Bacteria | 8174 |
| 44 | Ga0070683_100016329 | 3300005329 | Bacteria | 6546 |
| 45 | Ga0070683_100083473 | 3300005329 | Unclassified | 2992 |
| 46 | Ga0070683_100114300 | 3300005329 | Bacteria | 2548 |
| 47 | Ga0068869_100007051 | 3300005334 | Bacteria | 7156 |
| 48 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 49 | Ga0070666_10033504 | 3300005335 | Bacteria | 3399 |
| 50 | Ga0068868_100029026 | 3300005338 | Unclassified | 4235 |
| 51 | Ga0070660_100217318 | 3300005339 | Bacteria | 1553 |
| 52 | Ga0070671_100034239 | 3300005355 | Bacteria | 4205 |
| 53 | Ga0070671_100069878 | 3300005355 | Bacteria | 2929 |
| 54 | Ga0070667_100010129 | 3300005367 | Bacteria | 7799 |
| 55 | Ga0070714_100028908 | 3300005435 | Bacteria | 4604 |
| 56 | Ga0070714_100077324 | 3300005435 | Bacteria | 2890 |
| 57 | Ga0070713_100000709 | 3300005436 | Bacteria | 21386 |
| 58 | Ga0070710_10051836 | 3300005437 | Bacteria | 2306 |
| 59 | Ga0070708_100017849 | 3300005445 | Bacteria | 5928 |
| 60 | Ga0070708_100134765 | 3300005445 | Bacteria | 2287 |
| 61 | Ga0070663_100169741 | 3300005455 | Bacteria | 1685 |
| 62 | Ga0070681_10018105 | 3300005458 | Bacteria | 7044 |
| 63 | Ga0070681_10066757 | 3300005458 | Unclassified | 3566 |
| 64 | Ga0070706_100026495 | 3300005467 | Bacteria | 5333 |
| 65 | Ga0070706_100068757 | 3300005467 | Bacteria | 3275 |
| 66 | Ga0070707_100004902 | 3300005468 | Bacteria | 12544 |
| 67 | Ga0070707_100059641 | 3300005468 | Bacteria | 3659 |
| 68 | Ga0070698_100029627 | 3300005471 | Bacteria | 5683 |
| 69 | Ga0070698_100030913 | 3300005471 | Bacteria | 5553 |
| 70 | Ga0070699_100067891 | 3300005518 | Bacteria | 3096 |
| 71 | Ga0070679_100001816 | 3300005530 | Bacteria | 19251 |
| 72 | Ga0070679_100015518 | 3300005530 | Bacteria | 7320 |
| 73 | Ga0070679_100098274 | 3300005530 | Bacteria | 2915 |
| 74 | Ga0070684_100040889 | 3300005535 | Bacteria | 3994 |
| 75 | Ga0070684_100082046 | 3300005535 | Bacteria | 2854 |
| 76 | Ga0070697_100041878 | 3300005536 | Bacteria | 3707 |
| 77 | Ga0068853_100013405 | 3300005539 | Bacteria | 6692 |
| 78 | Ga0068853_100045938 | 3300005539 | Bacteria | 3743 |
| 79 | Ga0070665_100010184 | 3300005548 | Bacteria | 9510 |
| 80 | Ga0070665_100055410 | 3300005548 | Bacteria | 3977 |
| 81 | Ga0070665_100066905 | 3300005548 | Bacteria | 3604 |
| 82 | Ga0070665_100102037 | 3300005548 | Unclassified | 2872 |
| 83 | Ga0070665_100134621 | 3300005548 | Bacteria | 2473 |
| 84 | Ga0070704_100112764 | 3300005549 | Bacteria | 2072 |
| 85 | Ga0068855_100000148 | 3300005563 | Bacteria | 89300 |
| 86 | Ga0068855_100005929 | 3300005563 | Bacteria | 14899 |
| 87 | Ga0068855_100006646 | 3300005563 | Bacteria | 14047 |
| 88 | Ga0068855_100011888 | 3300005563 | Bacteria | 10525 |
| 89 | Ga0068855_100019045 | 3300005563 | Bacteria | 8251 |
| 90 | Ga0068855_100033705 | 3300005563 | Bacteria | 6110 |
| 91 | Ga0068855_100111364 | 3300005563 | Bacteria | 3143 |
| 92 | Ga0068855_100147403 | 3300005563 | Bacteria | 2678 |
| 93 | Ga0068855_100213171 | 3300005563 | Bacteria | 2169 |
| 94 | Ga0070664_100110284 | 3300005564 | Bacteria | 2401 |
| 95 | Ga0068857_100001579 | 3300005577 | Bacteria | 18252 |
| 96 | Ga0068857_100004216 | 3300005577 | Bacteria | 12115 |
| 97 | Ga0068857_100062339 | 3300005577 | Bacteria | 3314 |
| 98 | Ga0068854_100000054 | 3300005578 | Bacteria | 84435 |
| 99 | Ga0068854_100034084 | 3300005578 | Bacteria | 3554 |
| 100 | Ga0068856_100001773 | 3300005614 | Bacteria | 22538 |
| 101 | Ga0068852_100003810 | 3300005616 | Bacteria | 10583 |
| 102 | Ga0068859_100012271 | 3300005617 | Bacteria | 8618 |
| 103 | Ga0068859_100054448 | 3300005617 | Bacteria | 4024 |
| 104 | Ga0068864_100063293 | 3300005618 | Bacteria | 3206 |
| 105 | Ga0068851_10014782 | 3300005834 | Bacteria | 3711 |
| 106 | Ga0068851_10015576 | 3300005834 | Bacteria | 3624 |
| 107 | Ga0068863_100028902 | 3300005841 | Bacteria | 5294 |
| 108 | Ga0068858_100002682 | 3300005842 | Bacteria | 17922 |
| 109 | Ga0068860_100001987 | 3300005843 | Bacteria | 21593 |
| 110 | Ga0068860_100005502 | 3300005843 | Bacteria | 12825 |
| 111 | Ga0068860_100084604 | 3300005843 | Bacteria | 3018 |
| 112 | Ga0068862_100004867 | 3300005844 | Bacteria | 11306 |
| 113 | Ga0068862_100097952 | 3300005844 | Bacteria | 2561 |
| 114 | Ga0070717_10004293 | 3300006028 | Bacteria | 10275 |
| 115 | Ga0070717_10007004 | 3300006028 | Bacteria | 8343 |
| 116 | Ga0070717_10118800 | 3300006028 | Bacteria | 2263 |
| 117 | Ga0097621_100018922 | 3300006237 | Bacteria | 5275 |
| 118 | Ga0097621_100064327 | 3300006237 | Bacteria | 3016 |
| 119 | Ga0068871_100007526 | 3300006358 | Bacteria | 7788 |
| 120 | Ga0075433_10243530 | 3300006852 | Bacteria | 1596 |
| 121 | Ga0097620_100012271 | 3300006931 | Bacteria | 8618 |
| 122 | Ga0097620_100054450 | 3300006931 | Bacteria | 4024 |
| 123 | Ga0099824_1002532 | 3300006942 | Bacteria | 26760 |
| 124 | Ga0079104_1000201 | 3300006946 | Bacteria | 83853 |
| 125 | Ga0079104_1000365 | 3300006946 | Bacteria | 53914 |
| 126 | Ga0079104_1001078 | 3300006946 | Bacteria | 20455 |
| 127 | Ga0079104_1002451 | 3300006946 | Bacteria | 10007 |
| 128 | Ga0079104_1003548 | 3300006946 | Bacteria | 7173 |
| 129 | Ga0079104_1017543 | 3300006946 | Bacteria | 2054 |
| 130 | Ga0099826_10005490 | 3300006948 | Bacteria | 9100 |
| 131 | Ga0105251_10000556 | 3300009011 | Bacteria | 34974 |
| 132 | Ga0105251_10002699 | 3300009011 | Bacteria | 13633 |
| 133 | Ga0105244_10000007 | 3300009036 | Bacteria | 352275 |
| 134 | Ga0105244_10000075 | 3300009036 | Bacteria | 111242 |
| 135 | Ga0105244_10001065 | 3300009036 | Bacteria | 22915 |
| 136 | Ga0105244_10003093 | 3300009036 | Bacteria | 12177 |
| 137 | Ga0105244_10032945 | 3300009036 | Bacteria | 2737 |
| 138 | Ga0105250_10000492 | 3300009092 | Bacteria | 27777 |
| 139 | Ga0105250_10001277 | 3300009092 | Bacteria | 13828 |
| 140 | Ga0105250_10003227 | 3300009092 | Bacteria | 7774 |
| 141 | Ga0105240_10000594 | 3300009093 | Bacteria | 67129 |
| 142 | Ga0105240_10001347 | 3300009093 | Bacteria | 42146 |
| 143 | Ga0105240_10003557 | 3300009093 | Bacteria | 24176 |
| 144 | Ga0105240_10007025 | 3300009093 | Bacteria | 16429 |
| 145 | Ga0105240_10008652 | 3300009093 | Bacteria | 14543 |
| 146 | Ga0105240_10011955 | 3300009093 | Bacteria | 12033 |
| 147 | Ga0105240_10021450 | 3300009093 | Bacteria | 8589 |
| 148 | Ga0105240_10028599 | 3300009093 | Bacteria | 7276 |
| 149 | Ga0105240_10034646 | 3300009093 | Bacteria | 6510 |
| 150 | Ga0105240_10047255 | 3300009093 | Bacteria | 5447 |
| 151 | Ga0105240_10056838 | 3300009093 | Unclassified | 4894 |
| 152 | Ga0105240_10177519 | 3300009093 | Unclassified | 2517 |
| 153 | Ga0105245_10010013 | 3300009098 | Bacteria | 8255 |
| 154 | Ga0105245_10013828 | 3300009098 | Bacteria | 7030 |
| 155 | Ga0105247_10009610 | 3300009101 | Bacteria | 5870 |
| 156 | Ga0105247_10042366 | 3300009101 | Bacteria | 2789 |
| 157 | Ga0105247_10117117 | 3300009101 | Bacteria | 1722 |
| 158 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 159 | Ga0105241_10000006 | 3300009174 | Bacteria | 373608 |
| 160 | Ga0105241_10000082 | 3300009174 | Bacteria | 70717 |
| 161 | Ga0105241_10007395 | 3300009174 | Bacteria | 8080 |
| 162 | Ga0105241_10030547 | 3300009174 | Bacteria | 4028 |
| 163 | Ga0105241_10142380 | 3300009174 | Bacteria | 1954 |
| 164 | Ga0105242_10079151 | 3300009176 | Bacteria | 2745 |
| 165 | Ga0105248_10000004 | 3300009177 | Bacteria | 695244 |
| 166 | Ga0105248_10006857 | 3300009177 | Bacteria | 12489 |
| 167 | Ga0105248_10107745 | 3300009177 | Bacteria | 3142 |
| 168 | Ga0105237_10000245 | 3300009545 | Bacteria | 76791 |
| 169 | Ga0105237_10068011 | 3300009545 | Unclassified | 3556 |
| 170 | Ga0105237_10071675 | 3300009545 | Bacteria | 3459 |
| 171 | Ga0105238_10000098 | 3300009551 | Bacteria | 98005 |
| 172 | Ga0105238_10004480 | 3300009551 | Bacteria | 13844 |
| 173 | Ga0105238_10013476 | 3300009551 | Bacteria | 8253 |
| 174 | Ga0105238_10031788 | 3300009551 | Bacteria | 5371 |
| 175 | Ga0105238_10040480 | 3300009551 | Bacteria | 4722 |
| 176 | Ga0105238_10044434 | 3300009551 | Unclassified | 4491 |
| 177 | Ga0105238_10050752 | 3300009551 | Bacteria | 4175 |
| 178 | Ga0105238_10068275 | 3300009551 | Unclassified | 3556 |
| 179 | Ga0105238_10106064 | 3300009551 | Bacteria | 2792 |
| 180 | Ga0105238_10194689 | 3300009551 | Unclassified | 2003 |
| 181 | Ga0105249_10033978 | 3300009553 | Bacteria | 4619 |
| 182 | Ga0105239_10000569 | 3300010375 | Bacteria | 52971 |
| 183 | Ga0105239_10031957 | 3300010375 | Bacteria | 5784 |
| 184 | Ga0105239_10039229 | 3300010375 | Bacteria | 5188 |
| 185 | Ga0105239_10117574 | 3300010375 | Bacteria | 2951 |
| 186 | Ga0105239_10206092 | 3300010375 | Bacteria | 2203 |
| 187 | Ga0105246_10007351 | 3300011119 | Bacteria | 6749 |
| 188 | Ga0157373_10053635 | 3300013100 | Bacteria | 2867 |
| 189 | Ga0157373_10082762 | 3300013100 | Bacteria | 2262 |
| 190 | Ga0157371_10060811 | 3300013102 | Bacteria | 2678 |
| 191 | Ga0157370_10000195 | 3300013104 | Bacteria | 76072 |
| 192 | Ga0157370_10004397 | 3300013104 | Bacteria | 16165 |
| 193 | Ga0157370_10005642 | 3300013104 | Bacteria | 14000 |
| 194 | Ga0157370_10009996 | 3300013104 | Bacteria | 10036 |
| 195 | Ga0157370_10073257 | 3300013104 | Unclassified | 3231 |
| 196 | Ga0157370_10105532 | 3300013104 | Bacteria | 2637 |
| 197 | Ga0157369_10000711 | 3300013105 | Bacteria | 42778 |
| 198 | Ga0157369_10002489 | 3300013105 | Bacteria | 22074 |
| 199 | Ga0157369_10004540 | 3300013105 | Bacteria | 16332 |
| 200 | Ga0157369_10010663 | 3300013105 | Bacteria | 10459 |
| 201 | Ga0157369_10011538 | 3300013105 | Bacteria | 10036 |
| 202 | Ga0157369_10017521 | 3300013105 | Bacteria | 8050 |
| 203 | Ga0157369_10025541 | 3300013105 | Bacteria | 6557 |
| 204 | Ga0157369_10025596 | 3300013105 | Bacteria | 6548 |
| 205 | Ga0157369_10119639 | 3300013105 | Unclassified | 2795 |
| 206 | Ga0157374_10001735 | 3300013296 | Bacteria | 18284 |
| 207 | Ga0157374_10006894 | 3300013296 | Bacteria | 9662 |
| 208 | Ga0157374_10006930 | 3300013296 | Bacteria | 9638 |
| 209 | Ga0157374_10013101 | 3300013296 | Bacteria | 7232 |
| 210 | Ga0157374_10015187 | 3300013296 | Bacteria | 6752 |
| 211 | Ga0157374_10016088 | 3300013296 | Bacteria | 6572 |
| 212 | Ga0157374_10025430 | 3300013296 | Bacteria | 5316 |
| 213 | Ga0157374_10120865 | 3300013296 | Bacteria | 2528 |
| 214 | Ga0157374_10139496 | 3300013296 | Bacteria | 2352 |
| 215 | Ga0157378_10000036 | 3300013297 | Bacteria | 117422 |
| 216 | Ga0157378_10005409 | 3300013297 | Bacteria | 11198 |
| 217 | Ga0157378_10024465 | 3300013297 | Bacteria | 5315 |
| 218 | Ga0157378_10043623 | 3300013297 | Bacteria | 3983 |
| 219 | Ga0157378_10139238 | 3300013297 | Unclassified | 2252 |
| 220 | Ga0163162_10025780 | 3300013306 | Bacteria | 5811 |
| 221 | Ga0163162_10029109 | 3300013306 | Bacteria | 5465 |
| 222 | Ga0157372_10003822 | 3300013307 | Bacteria | 16184 |
| 223 | Ga0157372_10006837 | 3300013307 | Bacteria | 12130 |
| 224 | Ga0157372_10009966 | 3300013307 | Bacteria | 10106 |
| 225 | Ga0157372_10010289 | 3300013307 | Bacteria | 9938 |
| 226 | Ga0157372_10014580 | 3300013307 | Bacteria | 8407 |
| 227 | Ga0157372_10023922 | 3300013307 | Bacteria | 6628 |
| 228 | Ga0157372_10032773 | 3300013307 | Bacteria | 5701 |
| 229 | Ga0157372_10131629 | 3300013307 | Unclassified | 2878 |
| 230 | Ga0157372_10289977 | 3300013307 | Bacteria | 1903 |
| 231 | Ga0157375_10004276 | 3300013308 | Bacteria | 12387 |
| 232 | Ga0157375_10004846 | 3300013308 | Bacteria | 11690 |
| 233 | Ga0157375_10146282 | 3300013308 | Bacteria | 2494 |
| 234 | Ga0163163_10013483 | 3300014325 | Bacteria | 7487 |
| 235 | Ga0163163_10028724 | 3300014325 | Bacteria | 5345 |
| 236 | Ga0157379_10030932 | 3300014968 | Bacteria | 4769 |
| 237 | Ga0157376_10024663 | 3300014969 | Bacteria | 4726 |
| 238 | Ga0182006_1000455 | 3300015261 | Bacteria | 32311 |
| 239 | Ga0163161_10000122 | 3300017792 | Bacteria | 73118 |
| 240 | Ga0163161_10013240 | 3300017792 | Bacteria | 5734 |
| 241 | Ga0163161_10092079 | 3300017792 | Bacteria | 2244 |
| 242 | Ga0209674_100545 | 3300025226 | Bacteria | 15073 |
| 243 | Ga0209437_100138 | 3300025233 | Bacteria | 172839 |
| 244 | Ga0209437_101652 | 3300025233 | Bacteria | 5044 |
| 245 | Ga0209258_103183 | 3300025242 | Bacteria | 3688 |
| 246 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 247 | Ga0209026_1000214 | 3300025250 | Bacteria | 80595 |
| 248 | Ga0209026_1001073 | 3300025250 | Bacteria | 13209 |
| 249 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 250 | Ga0209233_1000705 | 3300025261 | Bacteria | 15603 |
| 251 | Ga0209233_1014351 | 3300025261 | Bacteria | 2234 |
| 252 | Ga0209673_1000187 | 3300025273 | Bacteria | 124227 |
| 253 | Ga0209564_1001813 | 3300025295 | Bacteria | 19674 |
| 254 | Ga0209758_1000392 | 3300025297 | Bacteria | 75737 |
| 255 | Ga0209758_1036283 | 3300025297 | Bacteria | 1927 |
| 256 | Ga0209050_1000259 | 3300025298 | Bacteria | 113475 |
| 257 | Ga0207426_1000209 | 3300025302 | Bacteria | 139524 |
| 258 | Ga0207426_1000678 | 3300025302 | Bacteria | 41242 |
| 259 | Ga0209257_1004199 | 3300025304 | Bacteria | 11422 |
| 260 | Ga0207656_10002511 | 3300025321 | Bacteria | 6192 |
| 261 | Ga0207696_1000259 | 3300025711 | Bacteria | 68316 |
| 262 | Ga0207696_1008441 | 3300025711 | Bacteria | 3937 |
| 263 | Ga0207655_1000025 | 3300025728 | Bacteria | 449261 |
| 264 | Ga0207655_1000196 | 3300025728 | Bacteria | 106283 |
| 265 | Ga0207655_1000199 | 3300025728 | Bacteria | 105047 |
| 266 | Ga0207655_1005152 | 3300025728 | Bacteria | 8996 |
| 267 | Ga0207655_1027244 | 3300025728 | Bacteria | 2726 |
| 268 | Ga0207713_1000052 | 3300025735 | Bacteria | 222663 |
| 269 | Ga0207713_1000139 | 3300025735 | Bacteria | 110486 |
| 270 | Ga0207713_1025113 | 3300025735 | Bacteria | 2758 |
| 271 | Ga0207692_10084596 | 3300025898 | Bacteria | 1705 |
| 272 | Ga0207710_10001857 | 3300025900 | Bacteria | 10173 |
| 273 | Ga0207710_10003932 | 3300025900 | Bacteria | 6556 |
| 274 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 275 | Ga0207647_10014966 | 3300025904 | Bacteria | 5332 |
| 276 | Ga0207647_10015456 | 3300025904 | Bacteria | 5231 |
| 277 | Ga0207647_10017939 | 3300025904 | Bacteria | 4800 |
| 278 | Ga0207705_10000012 | 3300025909 | Bacteria | 472336 |
| 279 | Ga0207705_10001178 | 3300025909 | Bacteria | 21244 |
| 280 | Ga0207705_10009473 | 3300025909 | Bacteria | 7085 |
| 281 | Ga0207705_10026081 | 3300025909 | Unclassified | 4170 |
| 282 | Ga0207684_10003569 | 3300025910 | Bacteria | 15137 |
| 283 | Ga0207654_10000008 | 3300025911 | Bacteria | 375871 |
| 284 | Ga0207654_10000021 | 3300025911 | Bacteria | 165620 |
| 285 | Ga0207654_10036330 | 3300025911 | Bacteria | 2751 |
| 286 | Ga0207707_10083145 | 3300025912 | Unclassified | 2795 |
| 287 | Ga0207695_10000035 | 3300025913 | Bacteria | 486590 |
| 288 | Ga0207695_10000188 | 3300025913 | Bacteria | 178721 |
| 289 | Ga0207695_10002026 | 3300025913 | Bacteria | 31122 |
| 290 | Ga0207695_10003052 | 3300025913 | Bacteria | 24001 |
| 291 | Ga0207695_10007747 | 3300025913 | Bacteria | 13607 |
| 292 | Ga0207695_10022190 | 3300025913 | Bacteria | 7218 |
| 293 | Ga0207695_10037713 | 3300025913 | Bacteria | 5213 |
| 294 | Ga0207695_10048325 | 3300025913 | Bacteria | 4494 |
| 295 | Ga0207695_10052357 | 3300025913 | Unclassified | 4278 |
| 296 | Ga0207695_10123972 | 3300025913 | Unclassified | 2549 |
| 297 | Ga0207695_10127565 | 3300025913 | Bacteria | 2505 |
| 298 | Ga0207695_10139147 | 3300025913 | Unclassified | 2378 |
| 299 | Ga0207671_10000305 | 3300025914 | Bacteria | 72354 |
| 300 | Ga0207671_10004903 | 3300025914 | Bacteria | 12573 |
| 301 | Ga0207671_10029598 | 3300025914 | Bacteria | 4089 |
| 302 | Ga0207693_10050145 | 3300025915 | Bacteria | 3278 |
| 303 | Ga0207693_10058722 | 3300025915 | Bacteria | 3013 |
| 304 | Ga0207693_10083612 | 3300025915 | Bacteria | 2501 |
| 305 | Ga0207663_10113775 | 3300025916 | Bacteria | 1841 |
| 306 | Ga0207660_10056445 | 3300025917 | Bacteria | 2810 |
| 307 | Ga0207660_10130259 | 3300025917 | Bacteria | 1914 |
| 308 | Ga0207657_10079582 | 3300025919 | Bacteria | 2757 |
| 309 | Ga0207652_10001274 | 3300025921 | Bacteria | 22442 |
| 310 | Ga0207652_10016441 | 3300025921 | Bacteria | 6042 |
| 311 | Ga0207652_10062711 | 3300025921 | Bacteria | 3212 |
| 312 | Ga0207646_10002951 | 3300025922 | Bacteria | 19693 |
| 313 | Ga0207694_10000180 | 3300025924 | Bacteria | 65444 |
| 314 | Ga0207694_10002063 | 3300025924 | Bacteria | 16607 |
| 315 | Ga0207694_10008781 | 3300025924 | Bacteria | 7625 |
| 316 | Ga0207694_10030475 | 3300025924 | Bacteria | 4120 |
| 317 | Ga0207694_10049316 | 3300025924 | Bacteria | 3259 |
| 318 | Ga0207687_10047510 | 3300025927 | Bacteria | 2976 |
| 319 | Ga0207700_10010671 | 3300025928 | Bacteria | 5811 |
| 320 | Ga0207664_10095536 | 3300025929 | Unclassified | 2445 |
| 321 | Ga0207644_10028615 | 3300025931 | Bacteria | 3860 |
| 322 | Ga0207709_10000008 | 3300025935 | Bacteria | 713099 |
| 323 | Ga0207691_10052156 | 3300025940 | Bacteria | 3736 |
| 324 | Ga0207711_10000008 | 3300025941 | Bacteria | 597686 |
| 325 | Ga0207711_10000010 | 3300025941 | Bacteria | 557970 |
| 326 | Ga0207711_10008053 | 3300025941 | Bacteria | 8821 |
| 327 | Ga0207661_10008161 | 3300025944 | Bacteria | 7473 |
| 328 | Ga0207661_10019954 | 3300025944 | Bacteria | 5003 |
| 329 | Ga0207661_10087181 | 3300025944 | Bacteria | 2592 |
| 330 | Ga0207679_10066908 | 3300025945 | Bacteria | 2694 |
| 331 | Ga0207679_10077054 | 3300025945 | Bacteria | 2535 |
| 332 | Ga0207667_10000062 | 3300025949 | Bacteria | 190422 |
| 333 | Ga0207667_10003059 | 3300025949 | Bacteria | 20741 |
| 334 | Ga0207667_10018423 | 3300025949 | Bacteria | 7829 |
| 335 | Ga0207667_10023717 | 3300025949 | Bacteria | 6756 |
| 336 | Ga0207667_10064950 | 3300025949 | Bacteria | 3808 |
| 337 | Ga0207667_10071190 | 3300025949 | Bacteria | 3617 |
| 338 | Ga0207667_10095332 | 3300025949 | Bacteria | 3072 |
| 339 | Ga0207712_10054655 | 3300025961 | Bacteria | 2805 |
| 340 | Ga0207712_10125702 | 3300025961 | Bacteria | 1946 |
| 341 | Ga0207640_10000022 | 3300025981 | Bacteria | 167526 |
| 342 | Ga0207658_10004075 | 3300025986 | Bacteria | 10204 |
| 343 | Ga0207658_10038103 | 3300025986 | Bacteria | 3461 |
| 344 | Ga0207677_10001044 | 3300026023 | Bacteria | 15218 |
| 345 | Ga0207677_10004037 | 3300026023 | Bacteria | 7834 |
| 346 | Ga0207703_10001798 | 3300026035 | Bacteria | 19132 |
| 347 | Ga0207639_10016492 | 3300026041 | Bacteria | 5229 |
| 348 | Ga0207639_10046593 | 3300026041 | Unclassified | 3272 |
| 349 | Ga0207639_10150134 | 3300026041 | Bacteria | 1951 |
| 350 | Ga0207678_10002009 | 3300026067 | Bacteria | 18512 |
| 351 | Ga0207678_10002837 | 3300026067 | Bacteria | 15710 |
| 352 | Ga0207678_10053331 | 3300026067 | Bacteria | 3485 |
| 353 | Ga0207678_10174847 | 3300026067 | Bacteria | 1833 |
| 354 | Ga0207702_10000286 | 3300026078 | Bacteria | 58533 |
| 355 | Ga0207702_10020413 | 3300026078 | Bacteria | 5488 |
| 356 | Ga0207641_10106294 | 3300026088 | Bacteria | 2480 |
| 357 | Ga0207676_10136493 | 3300026095 | Bacteria | 2093 |
| 358 | Ga0207674_10000538 | 3300026116 | Bacteria | 49663 |
| 359 | Ga0207674_10035398 | 3300026116 | Bacteria | 5210 |
| 360 | Ga0207698_10000032 | 3300026142 | Bacteria | 112742 |
| 361 | Ga0207698_10014367 | 3300026142 | Bacteria | 5261 |
| 362 | Ga0207698_10052478 | 3300026142 | Unclassified | 3124 |
| 363 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 364 | Ga0209281_1000079 | 3300027111 | Bacteria | 261444 |
| 365 | Ga0209281_1000142 | 3300027111 | Bacteria | 174280 |
| 366 | Ga0209281_1000225 | 3300027111 | Bacteria | 120218 |
| 367 | Ga0209281_1000901 | 3300027111 | Bacteria | 24924 |
| 368 | Ga0209371_1006814 | 3300027312 | Bacteria | 4136 |
| 369 | Ga0268266_10000059 | 3300028379 | Bacteria | 269485 |
| 370 | Ga0268266_10001065 | 3300028379 | Bacteria | 34389 |
| 371 | Ga0268266_10004302 | 3300028379 | Bacteria | 13710 |
| 372 | Ga0268266_10032237 | 3300028379 | Bacteria | 4452 |
| 373 | Ga0268266_10066031 | 3300028379 | Bacteria | 3128 |
| 374 | Ga0268265_10012507 | 3300028380 | Bacteria | 5751 |
| 375 | Ga0268264_10006133 | 3300028381 | Bacteria | 10156 |
| 376 | Ga0265326_10010191 | 3300028558 | Bacteria | 2794 |
| 377 | Ga0265319_1009371 | 3300028563 | Bacteria | 4177 |
| 378 | Ga0265318_10006291 | 3300028577 | Bacteria | 5487 |
| 379 | Ga0307515_10015541 | 3300028794 | Bacteria | 14012 |
| 380 | Ga0265338_10000291 | 3300028800 | Bacteria | 90081 |
| 381 | Ga0265324_10011722 | 3300029957 | Bacteria | 3333 |
| 382 | Ga0307511_10000192 | 3300030521 | Bacteria | 60792 |
| 383 | Ga0307511_10012036 | 3300030521 | Bacteria | 8511 |
| 384 | Ga0265320_10029046 | 3300031240 | Bacteria | 2865 |
| 385 | Ga0265327_10000032 | 3300031251 | Bacteria | 318763 |
| 386 | Ga0265327_10026071 | 3300031251 | Bacteria | 3393 |
| 387 | Ga0265316_10014114 | 3300031344 | Bacteria | 7048 |
| 388 | Ga0265316_10116253 | 3300031344 | Bacteria | 2022 |
| 389 | Ga0307513_10009145 | 3300031456 | Bacteria | 12551 |
| 390 | Ga0307513_10079857 | 3300031456 | Bacteria | 3377 |
| 391 | Ga0265313_10010274 | 3300031595 | Bacteria | 5949 |
| 392 | Ga0265313_10031092 | 3300031595 | Bacteria | 2739 |
| 393 | Ga0265314_10000203 | 3300031711 | Bacteria | 87485 |
| 394 | Ga0265314_10005471 | 3300031711 | Bacteria | 11453 |
| 395 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 396 | Ga0307510_10000010 | 3300033180 | Bacteria | 377457 |
| 397 | Ga0307510_10000070 | 3300033180 | Bacteria | 77054 |
| 398 | Ga0307510_10047132 | 3300033180 | Bacteria | 4623 |
| 399 | Ga0307510_10118104 | 3300033180 | Bacteria | 2366 |
| 400 | Ga0373933_0019237 | 3300035724 | Bacteria | 3854 |
| 401 | Ga0373937_0021309 | 3300036401 | Bacteria | 5817 |
| 402 | Ga0316584_0189810 | 3300036712 | Bacteria | 1519 |
| 403 | Ga0395899_0000370 | 3300037312 | Bacteria | 54053 |
| 404 | Ga0395899_0027279 | 3300037312 | Bacteria | 4306 |
| 405 | Ga0395898_0018016 | 3300037466 | Bacteria | 7205 |
| 406 | Ga0395898_0036061 | 3300037466 | Unclassified | 4914 |
| 407 | Ga0395898_0115288 | 3300037466 | Bacteria | 2574 |
| 408 | Ga0395905_0010150 | 3300037471 | Bacteria | 9177 |
| 409 | Ga0395905_0130811 | 3300037471 | Bacteria | 2360 |
| 410 | Ga0395901_0027021 | 3300038443 | Bacteria | 5894 |
| 411 | Ga0400483_275741 | 3300039062 | Bacteria | 3212 |
| 412 | Ga0436365_0325190 | 3300039437 | Bacteria | 2292 |
| 413 | Ga0439438_000814 | 3300041405 | Bacteria | 13947 |
| 414 | Ga0439466_0013918 | 3300041411 | Bacteria | 2938 |
| 415 | Ga0439432_005270 | 3300042006 | Bacteria | 4666 |
| 416 | Ga0451577_0000030 | 3300042876 | Bacteria | 391423 |
| 417 | Ga0451577_0000034 | 3300042876 | Bacteria | 376183 |
| 418 | Ga0451577_0003397 | 3300042876 | Bacteria | 17787 |
| 419 | Ga0451577_0005843 | 3300042876 | Bacteria | 12451 |
| 420 | Ga0451577_0010861 | 3300042876 | Bacteria | 8651 |
| 421 | Ga0451577_0013839 | 3300042876 | Bacteria | 7536 |
| 422 | Ga0451577_0026907 | 3300042876 | Bacteria | 5207 |
| 423 | Ga0451577_0033257 | 3300042876 | Bacteria | 4648 |
| 424 | Ga0451577_0055938 | 3300042876 | Bacteria | 3519 |
| 425 | Ga0451577_0087380 | 3300042876 | Unclassified | 2782 |
| 426 | Ga0451577_0123060 | 3300042876 | Bacteria | 2324 |
| 427 | Ga0451577_0159197 | 3300042876 | Bacteria | 2033 |
| 428 | Ga0451577_0193069 | 3300042876 | Bacteria | 1837 |
| 429 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 430 | Ga0453683_0000122 | 3300044673 | Bacteria | 116184 |
| 431 | Ga0453683_0000754 | 3300044673 | Bacteria | 32636 |
| 432 | Ga0453683_0001313 | 3300044673 | Bacteria | 21932 |
| 433 | Ga0453683_0021161 | 3300044673 | Bacteria | 4152 |
| 434 | Ga0453683_0025987 | 3300044673 | Bacteria | 3717 |
| 435 | Ga0453683_0037580 | 3300044673 | Bacteria | 3046 |
| 436 | Ga0453683_0039140 | 3300044673 | Bacteria | 2980 |
| 437 | Ga0453683_0061216 | 3300044673 | Unclassified | 2354 |
| 438 | Ga0453683_0068216 | 3300044673 | Bacteria | 2223 |
| 439 | Ga0453683_0098007 | 3300044673 | Bacteria | 1840 |
| 440 | Ga0453683_0099177 | 3300044673 | Bacteria | 1829 |
| 441 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 442 | Ga0453684_0000010 | 3300044712 | Bacteria | 1133422 |
| 443 | Ga0453684_0000098 | 3300044712 | Bacteria | 376183 |
| 444 | Ga0453684_0000260 | 3300044712 | Bacteria | 227076 |
| 445 | Ga0453684_0000557 | 3300044712 | Bacteria | 140566 |
| 446 | Ga0453684_0001093 | 3300044712 | Bacteria | 85531 |
| 447 | Ga0453684_0001226 | 3300044712 | Bacteria | 78620 |
| 448 | Ga0453684_0001814 | 3300044712 | Bacteria | 56316 |
| 449 | Ga0453684_0003020 | 3300044712 | Bacteria | 39129 |
| 450 | Ga0453684_0004244 | 3300044712 | Bacteria | 30652 |
| 451 | Ga0453684_0023515 | 3300044712 | Bacteria | 9066 |
| 452 | Ga0453684_0030146 | 3300044712 | Bacteria | 7672 |
| 453 | Ga0453684_0038963 | 3300044712 | Bacteria | 6483 |
| 454 | Ga0453684_0044064 | 3300044712 | Bacteria | 5981 |
| 455 | Ga0453684_0069386 | 3300044712 | Bacteria | 4471 |
| 456 | Ga0453684_0075348 | 3300044712 | Bacteria | 4241 |
| 457 | Ga0453684_0105599 | 3300044712 | Bacteria | 3434 |
| 458 | Ga0453684_0110210 | 3300044712 | Unclassified | 3346 |
| 459 | Ga0453684_0130461 | 3300044712 | Bacteria | 3016 |
| 460 | Ga0453684_0148379 | 3300044712 | Bacteria | 2790 |
| 461 | Ga0453684_0228653 | 3300044712 | Bacteria | 2149 |
| 462 | Ga0451576_0000036 | 3300045051 | Bacteria | 376183 |
| 463 | Ga0451576_0000103 | 3300045051 | Bacteria | 217967 |
| 464 | Ga0451576_0000948 | 3300045051 | Bacteria | 54439 |
| 465 | Ga0451576_0001706 | 3300045051 | Bacteria | 36282 |
| 466 | Ga0451576_0001972 | 3300045051 | Bacteria | 32636 |
| 467 | Ga0451576_0002281 | 3300045051 | Bacteria | 29258 |
| 468 | Ga0451576_0003128 | 3300045051 | Bacteria | 23199 |
| 469 | Ga0451576_0007861 | 3300045051 | Bacteria | 12639 |
| 470 | Ga0451576_0008105 | 3300045051 | Bacteria | 12382 |
| 471 | Ga0451576_0012394 | 3300045051 | Bacteria | 9577 |
| 472 | Ga0451576_0032699 | 3300045051 | Bacteria | 5534 |
| 473 | Ga0451576_0085689 | 3300045051 | Bacteria | 3277 |
| 474 | Ga0451576_0091252 | 3300045051 | Bacteria | 3169 |
| 475 | Ga0451576_0119971 | 3300045051 | Bacteria | 2738 |
| 476 | Ga0451576_0233965 | 3300045051 | Bacteria | 1919 |
| 477 | Ga0451576_0245941 | 3300045051 | Bacteria | 1869 |
| 478 | Ga0466958_0011133 | 3300045836 | Bacteria | 5060 |
| 479 | Ga0466958_0025823 | 3300045836 | Bacteria | 3467 |
| 480 | Ga0495627_000015 | 3300046453 | Bacteria | 320787 |
| 481 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 482 | Ga0495638_0000609 | 3300046460 | Bacteria | 40051 |
| 483 | Ga0495653_0045381 | 3300046463 | Bacteria | 3407 |
| 484 | Ga0495653_0060227 | 3300046463 | Bacteria | 2877 |
| 485 | Ga0495650_0000332 | 3300046471 | Bacteria | 84720 |
| 486 | Ga0495650_0003894 | 3300046471 | Bacteria | 10558 |
| 487 | Ga0495605_0000116 | 3300046474 | Bacteria | 103357 |
| 488 | Ga0495605_0024767 | 3300046474 | Bacteria | 3136 |
| 489 | Ga0495605_0027905 | 3300046474 | Bacteria | 2919 |
| 490 | Ga0495584_0000982 | 3300046491 | Bacteria | 17889 |
| 491 | Ga0495594_0047329 | 3300046499 | Bacteria | 2361 |
| 492 | Ga0495596_0011965 | 3300046500 | Bacteria | 3724 |
| 493 | Ga0495607_0002760 | 3300046501 | Bacteria | 14001 |
| 494 | Ga0495607_0006595 | 3300046501 | Bacteria | 8146 |
| 495 | Ga0495607_0042820 | 3300046501 | Bacteria | 2681 |
| 496 | Ga0495583_0000431 | 3300046506 | Bacteria | 63149 |
| 497 | Ga0495606_0027355 | 3300046507 | Bacteria | 4047 |
| 498 | Ga0495606_0159187 | 3300046507 | Bacteria | 1319 |
| 499 | Ga0495616_0001926 | 3300046513 | Bacteria | 13964 |
| 500 | Ga0495632_0002076 | 3300046519 | Bacteria | 15693 |
| 501 | Ga0495643_0000383 | 3300046522 | Bacteria | 58554 |
| 502 | Ga0495643_0001216 | 3300046522 | Bacteria | 24920 |
| 503 | Ga0495642_0023972 | 3300046528 | Bacteria | 2412 |
| 504 | Ga0495654_0000191 | 3300046530 | Bacteria | 59909 |
| 505 | Ga0495654_0005624 | 3300046530 | Bacteria | 7251 |
| 506 | Ga0495654_0022429 | 3300046530 | Bacteria | 3279 |
| 507 | Ga0495654_0032405 | 3300046530 | Bacteria | 2649 |
| 508 | Ga0495609_0000021 | 3300046538 | Bacteria | 281770 |
| 509 | Ga0495597_0000704 | 3300046542 | Bacteria | 26756 |
| 510 | Ga0495633_0019395 | 3300046558 | Bacteria | 3440 |
| 511 | Ga0495611_0017036 | 3300046648 | Bacteria | 3106 |
| 512 | Ga0495625_0000178 | 3300046660 | Bacteria | 98905 |
| 513 | Ga0495625_0002671 | 3300046660 | Bacteria | 18973 |
| 514 | Ga0495625_0012201 | 3300046660 | Bacteria | 6969 |
| 515 | Ga0495625_0017113 | 3300046660 | Bacteria | 5682 |
| 516 | Ga0495625_0022225 | 3300046660 | Bacteria | 4867 |
| 517 | Ga0495661_0000091 | 3300046665 | Bacteria | 110008 |
| 518 | Ga0495661_0000296 | 3300046665 | Bacteria | 56421 |
| 519 | Ga0495661_0023504 | 3300046665 | Bacteria | 4000 |
| 520 | Ga0495588_0000083 | 3300046674 | Bacteria | 197018 |
| 521 | Ga0495588_0001881 | 3300046674 | Bacteria | 8945 |
| 522 | Ga0495669_0007706 | 3300046684 | Bacteria | 4519 |
| 523 | Ga0495670_0000008 | 3300046691 | Bacteria | 219555 |
| 524 | Ga0495649_0065392 | 3300046694 | Unclassified | 1952 |
| 525 | Ga0495589_0000013 | 3300046794 | Bacteria | 248616 |
| 526 | Ga0495589_0000022 | 3300046794 | Bacteria | 196021 |
| 527 | Ga0495589_0055057 | 3300046794 | Bacteria | 1960 |
| 528 | Ga0495660_0000044 | 3300046810 | Bacteria | 150926 |
| 529 | Ga0495660_0000121 | 3300046810 | Bacteria | 85122 |
| 530 | Ga0495660_0034294 | 3300046810 | Bacteria | 2841 |
| 531 | Ga0495672_0000156 | 3300047320 | Bacteria | 98712 |
| 532 | Ga0495672_0001631 | 3300047320 | Bacteria | 21827 |
| 533 | Ga0495672_0001702 | 3300047320 | Bacteria | 21328 |
| 534 | Ga0495683_0026391 | 3300047323 | Bacteria | 2973 |
| 535 | Ga0495683_0033438 | 3300047323 | Bacteria | 2616 |
| 536 | Ga0495687_000099 | 3300047443 | Bacteria | 132139 |
| 537 | Ga0495687_000151 | 3300047443 | Bacteria | 105607 |
| 538 | Ga0495687_025883 | 3300047443 | Bacteria | 2767 |
| 539 | Ga0495677_0004730 | 3300047445 | Bacteria | 5185 |
| 540 | Ga0495677_0009316 | 3300047445 | Bacteria | 3628 |
| 541 | Ga0495677_0011693 | 3300047445 | Bacteria | 3208 |
| 542 | Ga0495679_000169 | 3300047446 | Bacteria | 59122 |
| 543 | Ga0495679_001444 | 3300047446 | Bacteria | 13471 |
| 544 | Ga0495673_0000343 | 3300047469 | Bacteria | 58816 |
| 545 | Ga0495681_0013827 | 3300047470 | Bacteria | 4666 |
| 546 | Ga0495686_0000018 | 3300047472 | Bacteria | 434962 |
| 547 | Ga0495686_0007246 | 3300047472 | Bacteria | 8346 |
| 548 | Ga0495686_0008641 | 3300047472 | Bacteria | 7438 |
| 549 | Ga0495686_0032453 | 3300047472 | Plasmid | 3380 |
| 550 | Ga0495602_0083056 | 3300048088 | Bacteria | 2685 |
| 551 | Ga0495626_0000021 | 3300048091 | Bacteria | 217213 |
| 552 | Ga0496101_0071141 | 3300048904 | Unclassified | 2550 |
| 553 | Ga0496105_0092371 | 3300048908 | Bacteria | 2499 |
| 554 | Ga0496109_0044819 | 3300048912 | Unclassified | 4013 |
| 555 | Ga0496110_0130710 | 3300048913 | Unclassified | 2267 |
| 556 | Ga0496115_0124642 | 3300048918 | Bacteria | 2122 |
| 557 | Ga0496117_0018705 | 3300048920 | Bacteria | 5724 |
| 558 | Ga0496118_0012888 | 3300048921 | Bacteria | 7967 |
| 559 | Ga0496119_0001662 | 3300048922 | Bacteria | 26028 |
| 560 | Ga0496120_0002669 | 3300048923 | Bacteria | 17571 |
| 561 | Ga0496121_0083402 | 3300048924 | Bacteria | 2523 |
| 562 | Ga0496122_0001639 | 3300048925 | Bacteria | 34793 |
| 563 | Ga0496122_0019663 | 3300048925 | Bacteria | 6156 |
| 564 | Ga0496123_0001205 | 3300048926 | Bacteria | 37836 |
| 565 | Ga0496124_0001923 | 3300048927 | Bacteria | 28444 |
| 566 | Ga0496124_0022135 | 3300048927 | Bacteria | 5834 |
| 567 | Ga0496124_0026932 | 3300048927 | Bacteria | 5174 |
| 568 | Ga0496124_0206134 | 3300048927 | Bacteria | 1491 |
| 569 | Ga0496125_0000405 | 3300048928 | Bacteria | 80765 |
| 570 | Ga0496125_0000509 | 3300048928 | Bacteria | 67449 |
| 571 | Ga0496126_0000042 | 3300048929 | Bacteria | 340121 |
| 572 | Ga0496126_0000074 | 3300048929 | Bacteria | 235643 |
| 573 | Ga0496126_0007416 | 3300048929 | Bacteria | 12032 |
| 574 | Ga0496126_0012853 | 3300048929 | Bacteria | 8555 |
| 575 | Ga0496126_0131622 | 3300048929 | Bacteria | 2161 |
| 576 | Ga0495678_000009 | 3300049459 | Bacteria | 373806 |
| 577 | Ga0495678_002710 | 3300049459 | Bacteria | 11676 |
| 578 | Ga0501033_0163509 | 3300049570 | Bacteria | 1601 |
| 579 | Ga0501034_0079080 | 3300049571 | Bacteria | 3292 |
| 580 | Ga0501037_0064643 | 3300049573 | Bacteria | 2666 |
| 581 | Ga0501039_0041135 | 3300049575 | Bacteria | 3569 |
| 582 | Ga0501043_0028839 | 3300049579 | Bacteria | 4357 |
| 583 | Ga0501043_0062124 | 3300049579 | Bacteria | 2933 |
| 584 | Ga0501043_0125017 | 3300049579 | Unclassified | 2016 |
| 585 | Ga0501047_0009474 | 3300049581 | Bacteria | 9200 |
| 586 | Ga0501047_0037425 | 3300049581 | Bacteria | 4692 |
| 587 | Ga0501047_0049728 | 3300049581 | Bacteria | 4047 |
| 588 | Ga0501047_0146152 | 3300049581 | Bacteria | 2241 |
| 589 | Ga0501070_0008289 | 3300049586 | Bacteria | 8784 |
| 590 | Ga0501080_0178897 | 3300049742 | Bacteria | 1953 |
| 591 | Ga0501035_0011822 | 3300049822 | Bacteria | 8084 |
| 592 | Ga0501035_0016453 | 3300049822 | Bacteria | 6821 |
| 593 | Ga0501035_0031905 | 3300049822 | Bacteria | 4797 |
| 594 | Ga0501035_0034882 | 3300049822 | Bacteria | 4570 |
| 595 | Ga0501035_0189367 | 3300049822 | Bacteria | 1769 |
| 596 | Ga0501044_0003640 | 3300049823 | Bacteria | 17346 |
| 597 | Ga0501044_0004964 | 3300049823 | Bacteria | 14878 |
| 598 | Ga0501044_0008162 | 3300049823 | Bacteria | 11487 |
| 599 | Ga0501044_0046629 | 3300049823 | Bacteria | 4486 |
| 600 | Ga0500646_0018661 | 3300053090 | Bacteria | 1829 |
| 601 | Ga0500583_0030559 | 3300053092 | Bacteria | 2361 |
| 602 | Ga0500595_017845 | 3300053119 | Unclassified | 2608 |
| 603 | Ga0500652_025006 | 3300053131 | Bacteria | 2284 |
| 604 | Ga0500588_0001788 | 3300053146 | Bacteria | 4188 |
| 605 | Ga0500622_0002425 | 3300053156 | Bacteria | 13460 |
| 606 | Ga0500639_012162 | 3300053163 | Bacteria | 4516 |
| 607 | Ga0500584_007517 | 3300053726 | Bacteria | 4739 |
| 608 | Ga0466962_0119329 | 3300061719 | Bacteria | 1272 |
| 609 | 2508854186 | 2508501071 | Bacteria | 5454741 |
| 610 | 2520882595 | 2519899754 | Bacteria | 5336938 |
| 611 | 2555260061 | 2554235234 | Bacteria | 5762085 |
| 612 | 2585197866 | 2582581293 | Bacteria | 5907401 |
| 613 | 2599412548 | 2599185169 | Bacteria | 5441380 |
| 614 | 2601644129 | 2600255287 | Bacteria | 5210468 |
| 615 | 2601663954 | 2600255291 | Bacteria | 5217298 |
| 616 | 2601696911 | 2600255298 | Bacteria | 5215185 |
| 617 | 2601701960 | 2600255299 | Bacteria | 5218662 |
| 618 | 2601722360 | 2600255303 | Bacteria | 5219315 |
| 619 | 2601743207 | 2600255307 | Bacteria | 5439064 |
| 620 | 2601754001 | 2600255309 | Bacteria | 5431045 |
| 621 | 2602021095 | 2600255392 | Bacteria | 5437392 |
| 622 | 2603662112 | 2602042052 | Bacteria | 5215873 |
| 623 | 2603667011 | 2602042053 | Bacteria | 5214361 |
| 624 | 2603877823 | 2602042111 | Bacteria | 5212080 |
| 625 | 2606071684 | 2603880184 | Bacteria | 5217896 |
| 626 | 2644009461 | 2643221600 | Bacteria | 5530138 |
| 627 | 2644233858 | 2643221642 | Bacteria | 5357871 |
| 628 | 2671587170 | 2671180115 | Bacteria | 5353919 |
| 629 | 2676405291 | 2675903046 | Bacteria | 5451247 |
| 630 | 2722731082 | 2721755487 | Bacteria | 6357185 |
| 631 | 2738734424 | 2738541279 | Bacteria | 6149495 |
| 632 | 2738767182 | 2738541285 | Bacteria | 6150075 |
| 633 | 2739216005 | 2738543007 | Bacteria | 6149845 |
| 634 | 2739790686 | 2739367756 | Bacteria | 4553612 |
| 635 | 2791921285 | 2791354903 | Bacteria | 4937680 |
| 636 | 2807180144 | 2806310673 | Bacteria | 4801221 |
| 637 | 2817416656 | 2816332280 | Bacteria | 5109718 |
| 638 | 2830076808 | 2830075706 | Bacteria | 3855215 |
| 639 | 2857557036 | 2857553236 | Bacteria | 6166726 |
| 640 | 2884414554 | 2884411467 | Bacteria | 5246714 |
| 641 | 2891675314 | 2891670763 | Bacteria | 4967099 |
| 642 | 2919111186 | 2919108558 | Bacteria | 5897419 |
| 643 | 2919194497 | 2919191525 | Bacteria | 5765973 |
| 644 | 2919477487 | 2919476304 | Bacteria | 5888696 |
| 645 | 2920108727 | 2920107658 | Bacteria | 10042636 |
| 646 | 2928966791 | 2928963466 | Bacteria | 5165703 |
| 647 | 2929153381 | 2929150217 | Bacteria | 5462483 |
| 648 | 2929924798 | 2929921140 | Bacteria | 8649150 |
| 649 | 2939575649 | 2939573065 | Bacteria | 4926053 |
| 650 | 2939606390 | 2939602548 | Bacteria | 4950493 |
| 651 | 2958462461 | 2958458903 | Bacteria | 5301041 |
| 652 | 2971822289 | 2971820967 | Bacteria | 5823634 |
| 653 | 640939790 | 640753048 | Bacteria | 5495657 |
| 654 | 8003156285 | 8003151029 | Bacteria | 8187759 |
| 655 | 8054852169 | 8054849141 | Bacteria | 5232694 |
| 656 | 8055095698 | 8055092621 | Bacteria | 4873875 |
| 657 | 8055100446 | 8055097453 | Bacteria | 4865496 |
| 658 | 8055694793 | 8055693939 | Bacteria | 4772047 |
| 659 | 8057306554 | 8057304971 | Bacteria | 4649742 |
| 660 | Ga0495681_0018487 | |||
| 661 | SwRhRL2b_contig_1650735 | |||
| 662 | JGI24735J21928_10003364 | |||
| 663 | JGI24735J21928_10013377 | |||
| 664 | JGI25162J39368_1000751 | |||
| 665 | JGI25154J39366_1000028 | |||
| 666 | JGI25157J39369_1001285 | |||
| 667 | JGI25153J46596_10006976 | |||
| 668 | JGI25153J46596_10011924 | |||
| 669 | rootH1_10006496 | |||
| 670 | rootH1_10039085 | |||
| 671 | rootH1_10121669 | |||
| 672 | rootH2_10002124 | |||
| 673 | rootH2_10011842 | |||
| 674 | rootH2_10013751 | |||
| 675 | rootH2_10034304 | |||
| 676 | rootH2_10049273 | |||
| 677 | rootH2_10059965 | |||
| 678 | rootH2_10084100 | |||
| 679 | rootH2_10133820 | |||
| 680 | rootL2_10029592 | |||
| 681 | rootL2_10106337 | |||
| 682 | rootL2_10251988 | |||
| 683 | JGI25160J50197_1004507 | |||
| 684 | Ga0055542_1000230 | |||
| 685 | Ga0055528_1000029 | |||
| 686 | Ga0055530_10000551 | |||
| 687 | Ga0058692_1002427 | |||
| 688 | Ga0058692_1006407 | |||
| 689 | Ga0065165_1000052 | |||
| 690 | Ga0065165_1001448 | |||
| 691 | Ga0065165_1017901 | |||
| 692 | Ga0065703_1018781 | |||
| 693 | Ga0065704_10001610 | |||
| 694 | Ga0065704_10073199 | |||
| 695 | Ga0065704_10085567 | |||
| 696 | Ga0070658_10000006 | |||
| 697 | Ga0070658_10000355 | |||
| 698 | Ga0070658_10001785 | |||
| 699 | Ga0070658_10011799 | |||
| 700 | Ga0070658_10014817 | |||
| 701 | Ga0070658_10026725 | |||
| 702 | Ga0070683_100009887 | |||
| 703 | Ga0070683_100016329 | |||
| 704 | Ga0070683_100083473 | |||
| 705 | Ga0070683_100114300 | |||
| 706 | Ga0068869_100007051 | |||
| 707 | Ga0070666_10000013 | |||
| 708 | Ga0070666_10033504 | |||
| 709 | Ga0068868_100029026 | |||
| 710 | Ga0070660_100217318 | |||
| 711 | Ga0070671_100034239 | |||
| 712 | Ga0070671_100069878 | |||
| 713 | Ga0070667_100010129 | |||
| 714 | Ga0070714_100028908 | |||
| 715 | Ga0070714_100077324 | |||
| 716 | Ga0070713_100000709 | |||
| 717 | Ga0070710_10051836 | |||
| 718 | Ga0070708_100017849 | |||
| 719 | Ga0070708_100134765 | |||
| 720 | Ga0070663_100169741 | |||
| 721 | Ga0070681_10018105 | |||
| 722 | Ga0070681_10066757 | |||
| 723 | Ga0070706_100026495 | |||
| 724 | Ga0070706_100068757 | |||
| 725 | Ga0070707_100004902 | |||
| 726 | Ga0070707_100059641 | |||
| 727 | Ga0070698_100029627 | |||
| 728 | Ga0070698_100030913 | |||
| 729 | Ga0070699_100067891 | |||
| 730 | Ga0070679_100001816 | |||
| 731 | Ga0070679_100015518 | |||
| 732 | Ga0070679_100098274 | |||
| 733 | Ga0070684_100040889 | |||
| 734 | Ga0070684_100082046 | |||
| 735 | Ga0070697_100041878 | |||
| 736 | Ga0068853_100013405 | |||
| 737 | Ga0068853_100045938 | |||
| 738 | Ga0070665_100010184 | |||
| 739 | Ga0070665_100055410 | |||
| 740 | Ga0070665_100066905 | |||
| 741 | Ga0070665_100102037 | |||
| 742 | Ga0070665_100134621 | |||
| 743 | Ga0070704_100112764 | |||
| 744 | Ga0068855_100000148 | |||
| 745 | Ga0068855_100005929 | |||
| 746 | Ga0068855_100006646 | |||
| 747 | Ga0068855_100011888 | |||
| 748 | Ga0068855_100019045 | |||
| 749 | Ga0068855_100033705 | |||
| 750 | Ga0068855_100111364 | |||
| 751 | Ga0068855_100147403 | |||
| 752 | Ga0068855_100213171 | |||
| 753 | Ga0070664_100110284 | |||
| 754 | Ga0068857_100001579 | |||
| 755 | Ga0068857_100004216 | |||
| 756 | Ga0068857_100062339 | |||
| 757 | Ga0068854_100000054 | |||
| 758 | Ga0068854_100034084 | |||
| 759 | Ga0068856_100001773 | |||
| 760 | Ga0068852_100003810 | |||
| 761 | Ga0068859_100012271 | |||
| 762 | Ga0068859_100054448 | |||
| 763 | Ga0068864_100063293 | |||
| 764 | Ga0068851_10014782 | |||
| 765 | Ga0068851_10015576 | |||
| 766 | Ga0068863_100028902 | |||
| 767 | Ga0068858_100002682 | |||
| 768 | Ga0068860_100001987 | |||
| 769 | Ga0068860_100005502 | |||
| 770 | Ga0068860_100084604 | |||
| 771 | Ga0068862_100004867 | |||
| 772 | Ga0068862_100097952 | |||
| 773 | Ga0070717_10004293 | |||
| 774 | Ga0070717_10007004 | |||
| 775 | Ga0070717_10118800 | |||
| 776 | Ga0097621_100018922 | |||
| 777 | Ga0097621_100064327 | |||
| 778 | Ga0068871_100007526 | |||
| 779 | Ga0075433_10243530 | |||
| 780 | Ga0097620_100012271 | |||
| 781 | Ga0097620_100054450 | |||
| 782 | Ga0099824_1002532 | |||
| 783 | Ga0079104_1000201 | |||
| 784 | Ga0079104_1000365 | |||
| 785 | Ga0079104_1001078 | |||
| 786 | Ga0079104_1002451 | |||
| 787 | Ga0079104_1003548 | |||
| 788 | Ga0079104_1017543 | |||
| 789 | Ga0099826_10005490 | |||
| 790 | Ga0105251_10000556 | |||
| 791 | Ga0105251_10002699 | |||
| 792 | Ga0105244_10000007 | |||
| 793 | Ga0105244_10000075 | |||
| 794 | Ga0105244_10001065 | |||
| 795 | Ga0105244_10003093 | |||
| 796 | Ga0105244_10032945 | |||
| 797 | Ga0105250_10000492 | |||
| 798 | Ga0105250_10001277 | |||
| 799 | Ga0105250_10003227 | |||
| 800 | Ga0105240_10000594 | |||
| 801 | Ga0105240_10001347 | |||
| 802 | Ga0105240_10003557 | |||
| 803 | Ga0105240_10007025 | |||
| 804 | Ga0105240_10008652 | |||
| 805 | Ga0105240_10011955 | |||
| 806 | Ga0105240_10021450 | |||
| 807 | Ga0105240_10028599 | |||
| 808 | Ga0105240_10034646 | |||
| 809 | Ga0105240_10047255 | |||
| 810 | Ga0105240_10056838 | |||
| 811 | Ga0105240_10177519 | |||
| 812 | Ga0105245_10010013 | |||
| 813 | Ga0105245_10013828 | |||
| 814 | Ga0105247_10009610 | |||
| 815 | Ga0105247_10042366 | |||
| 816 | Ga0105247_10117117 | |||
| 817 | Ga0105243_10000003 | |||
| 818 | Ga0105241_10000006 | |||
| 819 | Ga0105241_10000082 | |||
| 820 | Ga0105241_10007395 | |||
| 821 | Ga0105241_10030547 | |||
| 822 | Ga0105241_10142380 | |||
| 823 | Ga0105242_10079151 | |||
| 824 | Ga0105248_10000004 | |||
| 825 | Ga0105248_10006857 | |||
| 826 | Ga0105248_10107745 | |||
| 827 | Ga0105237_10000245 | |||
| 828 | Ga0105237_10068011 | |||
| 829 | Ga0105237_10071675 | |||
| 830 | Ga0105238_10000098 | |||
| 831 | Ga0105238_10004480 | |||
| 832 | Ga0105238_10013476 | |||
| 833 | Ga0105238_10031788 | |||
| 834 | Ga0105238_10040480 | |||
| 835 | Ga0105238_10044434 | |||
| 836 | Ga0105238_10050752 | |||
| 837 | Ga0105238_10068275 | |||
| 838 | Ga0105238_10106064 | |||
| 839 | Ga0105238_10194689 | |||
| 840 | Ga0105249_10033978 | |||
| 841 | Ga0105239_10000569 | |||
| 842 | Ga0105239_10031957 | |||
| 843 | Ga0105239_10039229 | |||
| 844 | Ga0105239_10117574 | |||
| 845 | Ga0105239_10206092 | |||
| 846 | Ga0105246_10007351 | |||
| 847 | Ga0157373_10053635 | |||
| 848 | Ga0157373_10082762 | |||
| 849 | Ga0157371_10060811 | |||
| 850 | Ga0157370_10000195 | |||
| 851 | Ga0157370_10004397 | |||
| 852 | Ga0157370_10005642 | |||
| 853 | Ga0157370_10009996 | |||
| 854 | Ga0157370_10073257 | |||
| 855 | Ga0157370_10105532 | |||
| 856 | Ga0157369_10000711 | |||
| 857 | Ga0157369_10002489 | |||
| 858 | Ga0157369_10004540 | |||
| 859 | Ga0157369_10010663 | |||
| 860 | Ga0157369_10011538 | |||
| 861 | Ga0157369_10017521 | |||
| 862 | Ga0157369_10025541 | |||
| 863 | Ga0157369_10025596 | |||
| 864 | Ga0157369_10119639 | |||
| 865 | Ga0157374_10001735 | |||
| 866 | Ga0157374_10006894 | |||
| 867 | Ga0157374_10006930 | |||
| 868 | Ga0157374_10013101 | |||
| 869 | Ga0157374_10015187 | |||
| 870 | Ga0157374_10016088 | |||
| 871 | Ga0157374_10025430 | |||
| 872 | Ga0157374_10120865 | |||
| 873 | Ga0157374_10139496 | |||
| 874 | Ga0157378_10000036 | |||
| 875 | Ga0157378_10005409 | |||
| 876 | Ga0157378_10024465 | |||
| 877 | Ga0157378_10043623 | |||
| 878 | Ga0157378_10139238 | |||
| 879 | Ga0163162_10025780 | |||
| 880 | Ga0163162_10029109 | |||
| 881 | Ga0157372_10003822 | |||
| 882 | Ga0157372_10006837 | |||
| 883 | Ga0157372_10009966 | |||
| 884 | Ga0157372_10010289 | |||
| 885 | Ga0157372_10014580 | |||
| 886 | Ga0157372_10023922 | |||
| 887 | Ga0157372_10032773 | |||
| 888 | Ga0157372_10131629 | |||
| 889 | Ga0157372_10289977 | |||
| 890 | Ga0157375_10004276 | |||
| 891 | Ga0157375_10004846 | |||
| 892 | Ga0157375_10146282 | |||
| 893 | Ga0163163_10013483 | |||
| 894 | Ga0163163_10028724 | |||
| 895 | Ga0157379_10030932 | |||
| 896 | Ga0157376_10024663 | |||
| 897 | Ga0182006_1000455 | |||
| 898 | Ga0163161_10000122 | |||
| 899 | Ga0163161_10013240 | |||
| 900 | Ga0163161_10092079 | |||
| 901 | Ga0209674_100545 | |||
| 902 | Ga0209437_100138 | |||
| 903 | Ga0209437_101652 | |||
| 904 | Ga0209258_103183 | |||
| 905 | Ga0209646_1000006 | |||
| 906 | Ga0209026_1000214 | |||
| 907 | Ga0209026_1001073 | |||
| 908 | Ga0209148_1000002 | |||
| 909 | Ga0209233_1000705 | |||
| 910 | Ga0209233_1014351 | |||
| 911 | Ga0209673_1000187 | |||
| 912 | Ga0209564_1001813 | |||
| 913 | Ga0209758_1000392 | |||
| 914 | Ga0209758_1036283 | |||
| 915 | Ga0209050_1000259 | |||
| 916 | Ga0207426_1000209 | |||
| 917 | Ga0207426_1000678 | |||
| 918 | Ga0209257_1004199 | |||
| 919 | Ga0207656_10002511 | |||
| 920 | Ga0207696_1000259 | |||
| 921 | Ga0207696_1008441 | |||
| 922 | Ga0207655_1000025 | |||
| 923 | Ga0207655_1000196 | |||
| 924 | Ga0207655_1000199 | |||
| 925 | Ga0207655_1005152 | |||
| 926 | Ga0207655_1027244 | |||
| 927 | Ga0207713_1000052 | |||
| 928 | Ga0207713_1000139 | |||
| 929 | Ga0207713_1025113 | |||
| 930 | Ga0207692_10084596 | |||
| 931 | Ga0207710_10001857 | |||
| 932 | Ga0207710_10003932 | |||
| 933 | Ga0207680_10000001 | |||
| 934 | Ga0207647_10014966 | |||
| 935 | Ga0207647_10015456 | |||
| 936 | Ga0207647_10017939 | |||
| 937 | Ga0207705_10000012 | |||
| 938 | Ga0207705_10001178 | |||
| 939 | Ga0207705_10009473 | |||
| 940 | Ga0207705_10026081 | |||
| 941 | Ga0207684_10003569 | |||
| 942 | Ga0207654_10000008 | |||
| 943 | Ga0207654_10000021 | |||
| 944 | Ga0207654_10036330 | |||
| 945 | Ga0207707_10083145 | |||
| 946 | Ga0207695_10000035 | |||
| 947 | Ga0207695_10000188 | |||
| 948 | Ga0207695_10002026 | |||
| 949 | Ga0207695_10003052 | |||
| 950 | Ga0207695_10007747 | |||
| 951 | Ga0207695_10022190 | |||
| 952 | Ga0207695_10037713 | |||
| 953 | Ga0207695_10048325 | |||
| 954 | Ga0207695_10052357 | |||
| 955 | Ga0207695_10123972 | |||
| 956 | Ga0207695_10127565 | |||
| 957 | Ga0207695_10139147 | |||
| 958 | Ga0207671_10000305 | |||
| 959 | Ga0207671_10004903 | |||
| 960 | Ga0207671_10029598 | |||
| 961 | Ga0207693_10050145 | |||
| 962 | Ga0207693_10058722 | |||
| 963 | Ga0207693_10083612 | |||
| 964 | Ga0207663_10113775 | |||
| 965 | Ga0207660_10056445 | |||
| 966 | Ga0207660_10130259 | |||
| 967 | Ga0207657_10079582 | |||
| 968 | Ga0207652_10001274 | |||
| 969 | Ga0207652_10016441 | |||
| 970 | Ga0207652_10062711 | |||
| 971 | Ga0207646_10002951 | |||
| 972 | Ga0207694_10000180 | |||
| 973 | Ga0207694_10002063 | |||
| 974 | Ga0207694_10008781 | |||
| 975 | Ga0207694_10030475 | |||
| 976 | Ga0207694_10049316 | |||
| 977 | Ga0207687_10047510 | |||
| 978 | Ga0207700_10010671 | |||
| 979 | Ga0207664_10095536 | |||
| 980 | Ga0207644_10028615 | |||
| 981 | Ga0207709_10000008 | |||
| 982 | Ga0207691_10052156 | |||
| 983 | Ga0207711_10000008 | |||
| 984 | Ga0207711_10000010 | |||
| 985 | Ga0207711_10008053 | |||
| 986 | Ga0207661_10008161 | |||
| 987 | Ga0207661_10019954 | |||
| 988 | Ga0207661_10087181 | |||
| 989 | Ga0207679_10066908 | |||
| 990 | Ga0207679_10077054 | |||
| 991 | Ga0207667_10000062 | |||
| 992 | Ga0207667_10003059 | |||
| 993 | Ga0207667_10018423 | |||
| 994 | Ga0207667_10023717 | |||
| 995 | Ga0207667_10064950 | |||
| 996 | Ga0207667_10071190 | |||
| 997 | Ga0207667_10095332 | |||
| 998 | Ga0207712_10054655 | |||
| 999 | Ga0207712_10125702 | |||
| 1000 | Ga0207640_10000022 | |||
| 1001 | Ga0207658_10004075 | |||
| 1002 | Ga0207658_10038103 | |||
| 1003 | Ga0207677_10001044 | |||
| 1004 | Ga0207677_10004037 | |||
| 1005 | Ga0207703_10001798 | |||
| 1006 | Ga0207639_10016492 | |||
| 1007 | Ga0207639_10046593 | |||
| 1008 | Ga0207639_10150134 | |||
| 1009 | Ga0207678_10002009 | |||
| 1010 | Ga0207678_10002837 | |||
| 1011 | Ga0207678_10053331 | |||
| 1012 | Ga0207678_10174847 | |||
| 1013 | Ga0207702_10000286 | |||
| 1014 | Ga0207702_10020413 | |||
| 1015 | Ga0207641_10106294 | |||
| 1016 | Ga0207676_10136493 | |||
| 1017 | Ga0207674_10000538 | |||
| 1018 | Ga0207674_10035398 | |||
| 1019 | Ga0207698_10000032 | |||
| 1020 | Ga0207698_10014367 | |||
| 1021 | Ga0207698_10052478 | |||
| 1022 | Ga0209281_1000014 | |||
| 1023 | Ga0209281_1000079 | |||
| 1024 | Ga0209281_1000142 | |||
| 1025 | Ga0209281_1000225 | |||
| 1026 | Ga0209281_1000901 | |||
| 1027 | Ga0209371_1006814 | |||
| 1028 | Ga0268266_10000059 | |||
| 1029 | Ga0268266_10001065 | |||
| 1030 | Ga0268266_10004302 | |||
| 1031 | Ga0268266_10032237 | |||
| 1032 | Ga0268266_10066031 | |||
| 1033 | Ga0268265_10012507 | |||
| 1034 | Ga0268264_10006133 | |||
| 1035 | Ga0265326_10010191 | |||
| 1036 | Ga0265319_1009371 | |||
| 1037 | Ga0265318_10006291 | |||
| 1038 | Ga0307515_10015541 | |||
| 1039 | Ga0265338_10000291 | |||
| 1040 | Ga0265324_10011722 | |||
| 1041 | Ga0307511_10000192 | |||
| 1042 | Ga0307511_10012036 | |||
| 1043 | Ga0265320_10029046 | |||
| 1044 | Ga0265327_10000032 | |||
| 1045 | Ga0265327_10026071 | |||
| 1046 | Ga0265316_10014114 | |||
| 1047 | Ga0265316_10116253 | |||
| 1048 | Ga0307513_10009145 | |||
| 1049 | Ga0307513_10079857 | |||
| 1050 | Ga0265313_10010274 | |||
| 1051 | Ga0265313_10031092 | |||
| 1052 | Ga0265314_10000203 | |||
| 1053 | Ga0265314_10005471 | |||
| 1054 | Ga0307510_10000003 | |||
| 1055 | Ga0307510_10000010 | |||
| 1056 | Ga0307510_10000070 | |||
| 1057 | Ga0307510_10047132 | |||
| 1058 | Ga0307510_10118104 | |||
| 1059 | Ga0373933_0019237 | |||
| 1060 | Ga0373937_0021309 | |||
| 1061 | Ga0316584_0189810 | |||
| 1062 | Ga0395899_0000370 | |||
| 1063 | Ga0395899_0027279 | |||
| 1064 | Ga0395898_0018016 | |||
| 1065 | Ga0395898_0036061 | |||
| 1066 | Ga0395898_0115288 | |||
| 1067 | Ga0395905_0010150 | |||
| 1068 | Ga0395905_0130811 | |||
| 1069 | Ga0395901_0027021 | |||
| 1070 | Ga0400483_275741 | |||
| 1071 | Ga0436365_0325190 | |||
| 1072 | Ga0439438_000814 | |||
| 1073 | Ga0439466_0013918 | |||
| 1074 | Ga0439432_005270 | |||
| 1075 | Ga0451577_0000030 | |||
| 1076 | Ga0451577_0000034 | |||
| 1077 | Ga0451577_0003397 | |||
| 1078 | Ga0451577_0005843 | |||
| 1079 | Ga0451577_0010861 | |||
| 1080 | Ga0451577_0013839 | |||
| 1081 | Ga0451577_0026907 | |||
| 1082 | Ga0451577_0033257 | |||
| 1083 | Ga0451577_0055938 | |||
| 1084 | Ga0451577_0087380 | |||
| 1085 | Ga0451577_0123060 | |||
| 1086 | Ga0451577_0159197 | |||
| 1087 | Ga0451577_0193069 | |||
| 1088 | Ga0453683_0000005 | |||
| 1089 | Ga0453683_0000122 | |||
| 1090 | Ga0453683_0000754 | |||
| 1091 | Ga0453683_0001313 | |||
| 1092 | Ga0453683_0021161 | |||
| 1093 | Ga0453683_0025987 | |||
| 1094 | Ga0453683_0037580 | |||
| 1095 | Ga0453683_0039140 | |||
| 1096 | Ga0453683_0061216 | |||
| 1097 | Ga0453683_0068216 | |||
| 1098 | Ga0453683_0098007 | |||
| 1099 | Ga0453683_0099177 | |||
| 1100 | Ga0453684_0000001 | |||
| 1101 | Ga0453684_0000010 | |||
| 1102 | Ga0453684_0000098 | |||
| 1103 | Ga0453684_0000260 | |||
| 1104 | Ga0453684_0000557 | |||
| 1105 | Ga0453684_0001093 | |||
| 1106 | Ga0453684_0001226 | |||
| 1107 | Ga0453684_0001814 | |||
| 1108 | Ga0453684_0003020 | |||
| 1109 | Ga0453684_0004244 | |||
| 1110 | Ga0453684_0023515 | |||
| 1111 | Ga0453684_0030146 | |||
| 1112 | Ga0453684_0038963 | |||
| 1113 | Ga0453684_0044064 | |||
| 1114 | Ga0453684_0069386 | |||
| 1115 | Ga0453684_0075348 | |||
| 1116 | Ga0453684_0105599 | |||
| 1117 | Ga0453684_0110210 | |||
| 1118 | Ga0453684_0130461 | |||
| 1119 | Ga0453684_0148379 | |||
| 1120 | Ga0453684_0228653 | |||
| 1121 | Ga0451576_0000036 | |||
| 1122 | Ga0451576_0000103 | |||
| 1123 | Ga0451576_0000948 | |||
| 1124 | Ga0451576_0001706 | |||
| 1125 | Ga0451576_0001972 | |||
| 1126 | Ga0451576_0002281 | |||
| 1127 | Ga0451576_0003128 | |||
| 1128 | Ga0451576_0007861 | |||
| 1129 | Ga0451576_0008105 | |||
| 1130 | Ga0451576_0012394 | |||
| 1131 | Ga0451576_0032699 | |||
| 1132 | Ga0451576_0085689 | |||
| 1133 | Ga0451576_0091252 | |||
| 1134 | Ga0451576_0119971 | |||
| 1135 | Ga0451576_0233965 | |||
| 1136 | Ga0451576_0245941 | |||
| 1137 | Ga0466958_0011133 | |||
| 1138 | Ga0466958_0025823 | |||
| 1139 | Ga0495627_000015 | |||
| 1140 | Ga0495590_0000001 | |||
| 1141 | Ga0495638_0000609 | |||
| 1142 | Ga0495653_0045381 | |||
| 1143 | Ga0495653_0060227 | |||
| 1144 | Ga0495650_0000332 | |||
| 1145 | Ga0495650_0003894 | |||
| 1146 | Ga0495605_0000116 | |||
| 1147 | Ga0495605_0024767 | |||
| 1148 | Ga0495605_0027905 | |||
| 1149 | Ga0495584_0000982 | |||
| 1150 | Ga0495594_0047329 | |||
| 1151 | Ga0495596_0011965 | |||
| 1152 | Ga0495607_0002760 | |||
| 1153 | Ga0495607_0006595 | |||
| 1154 | Ga0495607_0042820 | |||
| 1155 | Ga0495583_0000431 | |||
| 1156 | Ga0495606_0027355 | |||
| 1157 | Ga0495606_0159187 | |||
| 1158 | Ga0495616_0001926 | |||
| 1159 | Ga0495632_0002076 | |||
| 1160 | Ga0495643_0000383 | |||
| 1161 | Ga0495643_0001216 | |||
| 1162 | Ga0495642_0023972 | |||
| 1163 | Ga0495654_0000191 | |||
| 1164 | Ga0495654_0005624 | |||
| 1165 | Ga0495654_0022429 | |||
| 1166 | Ga0495654_0032405 | |||
| 1167 | Ga0495609_0000021 | |||
| 1168 | Ga0495597_0000704 | |||
| 1169 | Ga0495633_0019395 | |||
| 1170 | Ga0495611_0017036 | |||
| 1171 | Ga0495625_0000178 | |||
| 1172 | Ga0495625_0002671 | |||
| 1173 | Ga0495625_0012201 | |||
| 1174 | Ga0495625_0017113 | |||
| 1175 | Ga0495625_0022225 | |||
| 1176 | Ga0495661_0000091 | |||
| 1177 | Ga0495661_0000296 | |||
| 1178 | Ga0495661_0023504 | |||
| 1179 | Ga0495588_0000083 | |||
| 1180 | Ga0495588_0001881 | |||
| 1181 | Ga0495669_0007706 | |||
| 1182 | Ga0495670_0000008 | |||
| 1183 | Ga0495649_0065392 | |||
| 1184 | Ga0495589_0000013 | |||
| 1185 | Ga0495589_0000022 | |||
| 1186 | Ga0495589_0055057 | |||
| 1187 | Ga0495660_0000044 | |||
| 1188 | Ga0495660_0000121 | |||
| 1189 | Ga0495660_0034294 | |||
| 1190 | Ga0495672_0000156 | |||
| 1191 | Ga0495672_0001631 | |||
| 1192 | Ga0495672_0001702 | |||
| 1193 | Ga0495683_0026391 | |||
| 1194 | Ga0495683_0033438 | |||
| 1195 | Ga0495687_000099 | |||
| 1196 | Ga0495687_000151 | |||
| 1197 | Ga0495687_025883 | |||
| 1198 | Ga0495677_0004730 | |||
| 1199 | Ga0495677_0009316 | |||
| 1200 | Ga0495677_0011693 | |||
| 1201 | Ga0495679_000169 | |||
| 1202 | Ga0495679_001444 | |||
| 1203 | Ga0495673_0000343 | |||
| 1204 | Ga0495681_0013827 | |||
| 1205 | Ga0495686_0000018 | |||
| 1206 | Ga0495686_0007246 | |||
| 1207 | Ga0495686_0008641 | |||
| 1208 | Ga0495686_0032453 | |||
| 1209 | Ga0495602_0083056 | |||
| 1210 | Ga0495626_0000021 | |||
| 1211 | Ga0496101_0071141 | |||
| 1212 | Ga0496105_0092371 | |||
| 1213 | Ga0496109_0044819 | |||
| 1214 | Ga0496110_0130710 | |||
| 1215 | Ga0496115_0124642 | |||
| 1216 | Ga0496117_0018705 | |||
| 1217 | Ga0496118_0012888 | |||
| 1218 | Ga0496119_0001662 | |||
| 1219 | Ga0496120_0002669 | |||
| 1220 | Ga0496121_0083402 | |||
| 1221 | Ga0496122_0001639 | |||
| 1222 | Ga0496122_0019663 | |||
| 1223 | Ga0496123_0001205 | |||
| 1224 | Ga0496124_0001923 | |||
| 1225 | Ga0496124_0022135 | |||
| 1226 | Ga0496124_0026932 | |||
| 1227 | Ga0496124_0206134 | |||
| 1228 | Ga0496125_0000405 | |||
| 1229 | Ga0496125_0000509 | |||
| 1230 | Ga0496126_0000042 | |||
| 1231 | Ga0496126_0000074 | |||
| 1232 | Ga0496126_0007416 | |||
| 1233 | Ga0496126_0012853 | |||
| 1234 | Ga0496126_0131622 | |||
| 1235 | Ga0495678_000009 | |||
| 1236 | Ga0495678_002710 | |||
| 1237 | Ga0501033_0163509 | |||
| 1238 | Ga0501034_0079080 | |||
| 1239 | Ga0501037_0064643 | |||
| 1240 | Ga0501039_0041135 | |||
| 1241 | Ga0501043_0028839 | |||
| 1242 | Ga0501043_0062124 | |||
| 1243 | Ga0501043_0125017 | |||
| 1244 | Ga0501047_0009474 | |||
| 1245 | Ga0501047_0037425 | |||
| 1246 | Ga0501047_0049728 | |||
| 1247 | Ga0501047_0146152 | |||
| 1248 | Ga0501070_0008289 | |||
| 1249 | Ga0501080_0178897 | |||
| 1250 | Ga0501035_0011822 | |||
| 1251 | Ga0501035_0016453 | |||
| 1252 | Ga0501035_0031905 | |||
| 1253 | Ga0501035_0034882 | |||
| 1254 | Ga0501035_0189367 | |||
| 1255 | Ga0501044_0003640 | |||
| 1256 | Ga0501044_0004964 | |||
| 1257 | Ga0501044_0008162 | |||
| 1258 | Ga0501044_0046629 | |||
| 1259 | Ga0500646_0018661 | |||
| 1260 | Ga0500583_0030559 | |||
| 1261 | Ga0500595_017845 | |||
| 1262 | Ga0500652_025006 | |||
| 1263 | Ga0500588_0001788 | |||
| 1264 | Ga0500622_0002425 | |||
| 1265 | Ga0500639_012162 | |||
| 1266 | Ga0500584_007517 | |||
| 1267 | Ga0466962_0119329 | |||
| 1268 | 2508854186 | |||
| 1269 | 2520882595 | |||
| 1270 | 2555260061 | |||
| 1271 | 2585197866 | |||
| 1272 | 2599412548 | |||
| 1273 | 2601644129 | |||
| 1274 | 2601663954 | |||
| 1275 | 2601696911 | |||
| 1276 | 2601701960 | |||
| 1277 | 2601722360 | |||
| 1278 | 2601743207 | |||
| 1279 | 2601754001 | |||
| 1280 | 2602021095 | |||
| 1281 | 2603662112 | |||
| 1282 | 2603667011 | |||
| 1283 | 2603877823 | |||
| 1284 | 2606071684 | |||
| 1285 | 2644009461 | |||
| 1286 | 2644233858 | |||
| 1287 | 2671587170 | |||
| 1288 | 2676405291 | |||
| 1289 | 2722731082 | |||
| 1290 | 2738734424 | |||
| 1291 | 2738767182 | |||
| 1292 | 2739216005 | |||
| 1293 | 2739790686 | |||
| 1294 | 2791921285 | |||
| 1295 | 2807180144 | |||
| 1296 | 2817416656 | |||
| 1297 | 2830076808 | |||
| 1298 | 2857557036 | |||
| 1299 | 2884414554 | |||
| 1300 | 2891675314 | |||
| 1301 | 2919111186 | |||
| 1302 | 2919194497 | |||
| 1303 | 2919477487 | |||
| 1304 | 2920108727 | |||
| 1305 | 2928966791 | |||
| 1306 | 2929153381 | |||
| 1307 | 2929924798 | |||
| 1308 | 2939575649 | |||
| 1309 | 2939606390 | |||
| 1310 | 2958462461 | |||
| 1311 | 2971822289 | |||
| 1312 | 640939790 | |||
| 1313 | 8003156285 | |||
| 1314 | 8054852169 | |||
| 1315 | 8055095698 | |||
| 1316 | 8055100446 | |||
| 1317 | 8055694793 | |||
| 1318 | 8057306554 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lds-assembly1.cif.gz_A | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.9141 | 17 | 453 |
| 4lds-assembly1.cif.gz_B | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.9138 | 17 | 453 |
| 4lds-assembly1.cif.gz_A | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.9099 | 17 | 453 |
| 4lds-assembly1.cif.gz_B | the inward-facing structure of the glucose transporter from staphylococcus epidermidis | 0.9097 | 17 | 453 |
| 4ja3-assembly1.cif.gz_A | partially occluded inward open conformation of the xylose transporter xyle from e. coli | 0.8981 | 13 | 449 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEP1_8_453_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9603 | 12 | 463 | 1.20.1250.20 |
| af_I1K6U5_2_263_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9502 | 14 | 248 | 1.20.1250.20 |
| af_A0A1D6LG74_1_148_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9433 | 61 | 222 | 1.20.1250.20 |
| af_P0AEP1_8_453_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9433 | 12 | 463 | 1.20.1250.20 |
| af_Q54UC8_260_478_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9416 | 253 | 449 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5SKX6-F1-model_v4 | deleted | 0.9949 | 11 | 199 |
|
| AF-A0A3N5SII1-F1-model_v4 | deleted | 0.9919 | 4 | 332 |
|
| AF-A0A836RJU5-F1-model_v4 | MFS transporter | 0.9898 | 67 | 463 |
GO:0016020
GO:0022857 |
| AF-A0A5J4Q740-F1-model_v4 | D-xylose-proton symporter | 0.9875 | 8 | 373 |
GO:0016020
GO:0022857 |
| AF-W0AAI2-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9845 | 2 | 451 |
GO:0005886
GO:0022857 |