F473286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 364 | 570 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300049554|Ga0501338_00782|Ga0501338_00782_646_1425 |
| Length | 259 |
| Sequence | LNEYLGKVLALFYVGGYSAKTTIKEEIKMAKKGKKYLEAAKLVDRSKAYPIGEAVELVKQTSFTKFDASVEAAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKVKEAEAAGADYVGDTEYINKISQGWFEFDVIVATPDMMGEVGKLGRTLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKASFETEKLVENFNTIFETMVKVKPAAAKGTYMKNVAVTSTMGPSVKVDPATAGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 2 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 3 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 4 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 5 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 6 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 7 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 8 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 9 | 2600255229 | Lactobacillus acidophilus A 16 | Isolate | Rhizosphere |
| 10 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 11 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 12 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 13 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 14 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 15 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 16 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 17 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 18 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 19 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 20 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 21 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 22 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 23 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 24 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 25 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 26 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 27 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 28 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 29 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 30 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 31 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 32 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 33 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 34 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 35 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 36 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 37 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 38 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 39 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 40 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 41 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 42 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 43 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 44 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 45 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 46 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 47 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 48 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 49 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 50 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 51 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 52 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 53 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 54 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 55 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 56 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 57 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 58 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 59 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 60 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 61 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 62 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 63 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 64 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 65 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 66 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 67 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 68 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 69 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 70 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 71 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 72 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 73 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 74 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 75 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 76 | 3006879489 | Bacillus atrophaeus UCMB-5137 | Isolate | Rhizosphere |
| 77 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 78 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 79 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 80 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 81 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 82 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 83 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 84 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 85 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 87 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 89 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 107 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 117 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 118 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300029272 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 | Metatranscriptome | Rhizosphere |
| 189 | 3300029273 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 | Metatranscriptome | Rhizosphere |
| 190 | 3300029280 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 | Metatranscriptome | Rhizosphere |
| 191 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 204 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 215 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049555 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 337 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 338 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 340 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 357 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 358 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 359 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 360 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 361 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 362 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 363 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 364 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.17 |
| Metatranscriptomes | 32.32 |
| Isolates | 13.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.88 |
| Nodule | 0.91 |
| Rhizoplane | 5.46 |
| Rhizosphere | 82.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000735 | 3300003187 | Bacteria | 26974 |
| 2 | JGI25151J46595_10001136 | 3300003187 | Bacteria | 19348 |
| 3 | JGI25151J46595_10003308 | 3300003187 | Bacteria | 8947 |
| 4 | JGI25151J46595_10012381 | 3300003187 | Bacteria | 3883 |
| 5 | rootH1_10000848 | 3300003316 | Bacteria | 58943 |
| 6 | rootL2_10052955 | 3300003322 | Bacteria | 32035 |
| 7 | Ga0006562J51391_1000046 | 3300003578 | Bacteria | 48312 |
| 8 | Ga0006562J51391_1000677 | 3300003578 | Bacteria | 45519 |
| 9 | Ga0055538_1000081 | 3300003751 | Bacteria | 85159 |
| 10 | Ga0055528_1001614 | 3300003790 | Bacteria | 13323 |
| 11 | Ga0065704_10019174 | 3300005289 | Bacteria | 1706 |
| 12 | Ga0065712_10079230 | 3300005290 | Bacteria | 3236 |
| 13 | Ga0065712_10189397 | 3300005290 | Bacteria | 1155 |
| 14 | Ga0065715_10190587 | 3300005293 | Bacteria | 1417 |
| 15 | Ga0070676_10006452 | 3300005328 | Bacteria | 6271 |
| 16 | Ga0070676_10240833 | 3300005328 | Bacteria | 1203 |
| 17 | Ga0070670_100019013 | 3300005331 | Bacteria | 5892 |
| 18 | Ga0070670_100020078 | 3300005331 | Bacteria | 5738 |
| 19 | Ga0070670_100560597 | 3300005331 | Bacteria | 1020 |
| 20 | Ga0068869_100075173 | 3300005334 | Bacteria | 2509 |
| 21 | Ga0068868_100339119 | 3300005338 | Bacteria | 1285 |
| 22 | Ga0070689_100027530 | 3300005340 | Bacteria | 4286 |
| 23 | Ga0070692_10398912 | 3300005345 | Bacteria | 868 |
| 24 | Ga0070669_100199350 | 3300005353 | Bacteria | 1574 |
| 25 | Ga0070675_100066415 | 3300005354 | Bacteria | 2984 |
| 26 | Ga0070675_100398625 | 3300005354 | Bacteria | 1227 |
| 27 | Ga0070671_100011607 | 3300005355 | Bacteria | 7086 |
| 28 | Ga0070674_100570710 | 3300005356 | Bacteria | 952 |
| 29 | Ga0070688_100026187 | 3300005365 | Bacteria | 3462 |
| 30 | Ga0070659_100814034 | 3300005366 | Bacteria | 813 |
| 31 | Ga0070700_100522998 | 3300005441 | Bacteria | 917 |
| 32 | Ga0070694_100528691 | 3300005444 | Bacteria | 942 |
| 33 | Ga0070708_100715719 | 3300005445 | Bacteria | 942 |
| 34 | Ga0070678_100272510 | 3300005456 | Bacteria | 1428 |
| 35 | Ga0070678_100316314 | 3300005456 | Bacteria | 1332 |
| 36 | Ga0070678_100375143 | 3300005456 | Bacteria | 1229 |
| 37 | Ga0068867_100023582 | 3300005459 | Bacteria | 4405 |
| 38 | Ga0070685_10006863 | 3300005466 | Bacteria | 5812 |
| 39 | Ga0070706_100466541 | 3300005467 | Bacteria | 1175 |
| 40 | Ga0070707_100709667 | 3300005468 | Bacteria | 969 |
| 41 | Ga0070698_100278933 | 3300005471 | Bacteria | 1603 |
| 42 | Ga0070699_100080347 | 3300005518 | Bacteria | 2841 |
| 43 | Ga0070679_100432153 | 3300005530 | Bacteria | 1262 |
| 44 | Ga0070697_100017739 | 3300005536 | Bacteria | 5607 |
| 45 | Ga0070697_100253963 | 3300005536 | Bacteria | 1504 |
| 46 | Ga0070672_100025082 | 3300005543 | Bacteria | 4417 |
| 47 | Ga0070665_101155262 | 3300005548 | Bacteria | 785 |
| 48 | Ga0068857_100013317 | 3300005577 | Bacteria | 7161 |
| 49 | Ga0068859_100028015 | 3300005617 | Bacteria | 5649 |
| 50 | Ga0068862_100128838 | 3300005844 | Bacteria | 2237 |
| 51 | Ga0075364_10006779 | 3300006051 | Bacteria | 6755 |
| 52 | Ga0070715_10058571 | 3300006163 | Bacteria | 1682 |
| 53 | Ga0070715_10065228 | 3300006163 | Bacteria | 1611 |
| 54 | Ga0075367_10195954 | 3300006178 | Bacteria | 1261 |
| 55 | Ga0075428_100063863 | 3300006844 | Bacteria | 4031 |
| 56 | Ga0075428_100542290 | 3300006844 | Bacteria | 1243 |
| 57 | Ga0075431_100177183 | 3300006847 | Bacteria | 2189 |
| 58 | Ga0075434_100062039 | 3300006871 | Bacteria | 3720 |
| 59 | Ga0068865_100123349 | 3300006881 | Bacteria | 1930 |
| 60 | Ga0068865_100450720 | 3300006881 | Bacteria | 1064 |
| 61 | Ga0075436_100041067 | 3300006914 | Bacteria | 3192 |
| 62 | Ga0097620_100028015 | 3300006931 | Bacteria | 5649 |
| 63 | Ga0079104_1001572 | 3300006946 | Bacteria | 14942 |
| 64 | Ga0079104_1009498 | 3300006946 | Bacteria | 3287 |
| 65 | Ga0075435_100148690 | 3300007076 | Bacteria | 1968 |
| 66 | Ga0105244_10026966 | 3300009036 | Bacteria | 3103 |
| 67 | Ga0105244_10094277 | 3300009036 | Bacteria | 1470 |
| 68 | Ga0105250_10018759 | 3300009092 | Bacteria | 2800 |
| 69 | Ga0111539_10042697 | 3300009094 | Bacteria | 5443 |
| 70 | Ga0111539_10076046 | 3300009094 | Bacteria | 3954 |
| 71 | Ga0111539_10741310 | 3300009094 | Bacteria | 1143 |
| 72 | Ga0111539_11101146 | 3300009094 | Bacteria | 923 |
| 73 | Ga0105245_10006900 | 3300009098 | Bacteria | 9956 |
| 74 | Ga0105245_10129583 | 3300009098 | Bacteria | 2365 |
| 75 | Ga0105247_10000354 | 3300009101 | Bacteria | 39709 |
| 76 | Ga0105243_10000301 | 3300009148 | Bacteria | 54622 |
| 77 | Ga0105243_10228729 | 3300009148 | Bacteria | 1649 |
| 78 | Ga0105241_10088992 | 3300009174 | Bacteria | 2432 |
| 79 | Ga0105242_10004076 | 3300009176 | Bacteria | 11356 |
| 80 | Ga0105242_10065634 | 3300009176 | Bacteria | 2995 |
| 81 | Ga0099796_10025844 | 3300010159 | Bacteria | 1859 |
| 82 | Ga0105246_10000077 | 3300011119 | Bacteria | 41151 |
| 83 | Ga0157371_10005050 | 3300013102 | Bacteria | 11283 |
| 84 | Ga0157374_10013578 | 3300013296 | Bacteria | 7114 |
| 85 | Ga0157378_10000237 | 3300013297 | Bacteria | 53846 |
| 86 | Ga0157378_10066150 | 3300013297 | Bacteria | 3237 |
| 87 | Ga0157375_10153511 | 3300013308 | Bacteria | 2440 |
| 88 | Ga0157375_10249039 | 3300013308 | Bacteria | 1937 |
| 89 | Ga0157380_10046726 | 3300014326 | Bacteria | 3402 |
| 90 | Ga0157377_10002894 | 3300014745 | Bacteria | 7675 |
| 91 | Ga0157376_10014258 | 3300014969 | Bacteria | 5959 |
| 92 | Ga0224712_10011825 | 3300022467 | Bacteria | 2722 |
| 93 | Ga0209784_100044 | 3300025224 | Bacteria | 206858 |
| 94 | Ga0209147_100806 | 3300025229 | Bacteria | 15071 |
| 95 | Ga0209673_1001881 | 3300025273 | Bacteria | 16921 |
| 96 | Ga0209676_1057025 | 3300025292 | Bacteria | 992 |
| 97 | Ga0209025_1000639 | 3300025294 | Bacteria | 61845 |
| 98 | Ga0209025_1002868 | 3300025294 | Bacteria | 17284 |
| 99 | Ga0209025_1016387 | 3300025294 | Bacteria | 4378 |
| 100 | Ga0209025_1021451 | 3300025294 | Bacteria | 3478 |
| 101 | Ga0207426_1008659 | 3300025302 | Bacteria | 4084 |
| 102 | Ga0207696_1004774 | 3300025711 | Bacteria | 5763 |
| 103 | Ga0207655_1007619 | 3300025728 | Bacteria | 6993 |
| 104 | Ga0207713_1000405 | 3300025735 | Bacteria | 46074 |
| 105 | Ga0207688_10121887 | 3300025901 | Bacteria | 1522 |
| 106 | Ga0207685_10228621 | 3300025905 | Bacteria | 889 |
| 107 | Ga0207645_10036479 | 3300025907 | Bacteria | 3156 |
| 108 | Ga0207646_10012863 | 3300025922 | Bacteria | 8022 |
| 109 | Ga0207646_10166025 | 3300025922 | Bacteria | 1993 |
| 110 | Ga0207681_10110484 | 3300025923 | Bacteria | 1999 |
| 111 | Ga0207681_10254309 | 3300025923 | Bacteria | 1373 |
| 112 | Ga0207681_10440745 | 3300025923 | Bacteria | 1058 |
| 113 | Ga0207681_10527108 | 3300025923 | Bacteria | 970 |
| 114 | Ga0207650_10013760 | 3300025925 | Bacteria | 5611 |
| 115 | Ga0207659_10053626 | 3300025926 | Bacteria | 2876 |
| 116 | Ga0207659_10274297 | 3300025926 | Bacteria | 1377 |
| 117 | Ga0207687_10006698 | 3300025927 | Bacteria | 7599 |
| 118 | Ga0207687_10095721 | 3300025927 | Bacteria | 2175 |
| 119 | Ga0207644_10001801 | 3300025931 | Bacteria | 13903 |
| 120 | Ga0207686_10004946 | 3300025934 | Bacteria | 7173 |
| 121 | Ga0207686_10169188 | 3300025934 | Bacteria | 1539 |
| 122 | Ga0207709_10000416 | 3300025935 | Bacteria | 41461 |
| 123 | Ga0207709_10374243 | 3300025935 | Bacteria | 1082 |
| 124 | Ga0207670_10059001 | 3300025936 | Bacteria | 2609 |
| 125 | Ga0207669_10074531 | 3300025937 | Bacteria | 2147 |
| 126 | Ga0207669_10475814 | 3300025937 | Bacteria | 995 |
| 127 | Ga0207704_10043139 | 3300025938 | Bacteria | 2660 |
| 128 | Ga0207704_10179121 | 3300025938 | Bacteria | 1530 |
| 129 | Ga0207691_10039329 | 3300025940 | Bacteria | 4375 |
| 130 | Ga0207689_10085506 | 3300025942 | Bacteria | 2592 |
| 131 | Ga0207712_10048314 | 3300025961 | Bacteria | 2959 |
| 132 | Ga0207668_10298490 | 3300025972 | Bacteria | 1329 |
| 133 | Ga0207677_10253818 | 3300026023 | Bacteria | 1430 |
| 134 | Ga0207677_10465257 | 3300026023 | Bacteria | 1086 |
| 135 | Ga0207678_10356877 | 3300026067 | Bacteria | 1261 |
| 136 | Ga0207708_10132970 | 3300026075 | Bacteria | 1946 |
| 137 | Ga0207648_10033930 | 3300026089 | Bacteria | 4500 |
| 138 | Ga0207648_10068016 | 3300026089 | Bacteria | 3104 |
| 139 | Ga0207675_100087087 | 3300026118 | Bacteria | 2933 |
| 140 | Ga0207675_100709680 | 3300026118 | Bacteria | 1015 |
| 141 | Ga0207683_10206718 | 3300026121 | Bacteria | 1786 |
| 142 | Ga0207683_10249025 | 3300026121 | Bacteria | 1621 |
| 143 | Ga0207683_10615407 | 3300026121 | Bacteria | 1005 |
| 144 | Ga0209281_1000059 | 3300027111 | Bacteria | 295913 |
| 145 | Ga0209281_1000435 | 3300027111 | Bacteria | 61761 |
| 146 | Ga0209281_1008199 | 3300027111 | Bacteria | 2558 |
| 147 | Ga0209281_1027375 | 3300027111 | Bacteria | 1045 |
| 148 | Ga0209970_1002684 | 3300027614 | Bacteria | 3012 |
| 149 | Ga0209588_1019099 | 3300027671 | Bacteria | 2138 |
| 150 | Ga0207428_10658161 | 3300027907 | Bacteria | 751 |
| 151 | Ga0268266_10555901 | 3300028379 | Bacteria | 1100 |
| 152 | Ga0268265_10241703 | 3300028380 | Bacteria | 1594 |
| 153 | Ga0265334_10043783 | 3300028573 | Bacteria | 1741 |
| 154 | Ga0311000_121821 | 3300029272 | Bacteria | 1739 |
| 155 | Ga0311008_105417 | 3300029273 | Bacteria | 1160 |
| 156 | Ga0311011_144096 | 3300029280 | Bacteria | 1125 |
| 157 | Ga0316176_1026675 | 3300030732 | Bacteria | 1253 |
| 158 | Ga0265327_10057128 | 3300031251 | Bacteria | 2008 |
| 159 | Ga0265327_10094537 | 3300031251 | Bacteria | 1452 |
| 160 | Ga0307408_100017547 | 3300031548 | Bacteria | 4790 |
| 161 | Ga0307408_100028935 | 3300031548 | Bacteria | 3833 |
| 162 | Ga0316579_10073769 | 3300031691 | Bacteria | 1619 |
| 163 | Ga0316576_10025195 | 3300031727 | Bacteria | 4161 |
| 164 | Ga0316578_10037404 | 3300031728 | Bacteria | 2796 |
| 165 | Ga0307405_10021522 | 3300031731 | Bacteria | 3627 |
| 166 | Ga0307405_10215272 | 3300031731 | Bacteria | 1406 |
| 167 | Ga0316577_10048191 | 3300031733 | Bacteria | 2380 |
| 168 | Ga0307407_10029070 | 3300031903 | Bacteria | 2964 |
| 169 | Ga0307412_10505837 | 3300031911 | Bacteria | 1007 |
| 170 | Ga0307409_100018876 | 3300031995 | Bacteria | 4652 |
| 171 | Ga0307409_100071775 | 3300031995 | Bacteria | 2754 |
| 172 | Ga0307409_100088345 | 3300031995 | Bacteria | 2530 |
| 173 | Ga0307416_100018258 | 3300032002 | Bacteria | 4936 |
| 174 | Ga0307416_100044091 | 3300032002 | Bacteria | 3498 |
| 175 | Ga0307416_100078459 | 3300032002 | Bacteria | 2778 |
| 176 | Ga0307416_100198442 | 3300032002 | Bacteria | 1901 |
| 177 | Ga0316583_10023640 | 3300032133 | Bacteria | 2195 |
| 178 | Ga0316593_10087435 | 3300032168 | Bacteria | 1094 |
| 179 | Ga0316596_1014855 | 3300033541 | Bacteria | 1936 |
| 180 | Ga0373956_0164319 | 3300035119 | Bacteria | 1047 |
| 181 | Ga0373946_0074711 | 3300035171 | Bacteria | 1472 |
| 182 | Ga0316574_0071026 | 3300035398 | Bacteria | 2198 |
| 183 | Ga0373933_0064935 | 3300035724 | Bacteria | 2209 |
| 184 | Ga0373937_0035502 | 3300036401 | Bacteria | 4538 |
| 185 | Ga0373937_0112227 | 3300036401 | Bacteria | 2536 |
| 186 | Ga0373937_0305712 | 3300036401 | Bacteria | 1504 |
| 187 | Ga0373937_0931437 | 3300036401 | Bacteria | 818 |
| 188 | Ga0316584_0056348 | 3300036712 | Bacteria | 2942 |
| 189 | Ga0395901_0400270 | 3300038443 | Bacteria | 1411 |
| 190 | Ga0436363_0569927 | 3300039450 | Bacteria | 1027 |
| 191 | Ga0451837_1797435 | 3300041494 | Bacteria | 1347 |
| 192 | Ga0451849_1220464 | 3300041505 | Bacteria | 898 |
| 193 | Ga0439432_084115 | 3300042006 | Bacteria | 962 |
| 194 | Ga0439434_0016420 | 3300042435 | Bacteria | 2212 |
| 195 | Ga0451577_0000006 | 3300042876 | Bacteria | 709265 |
| 196 | Ga0451577_0003986 | 3300042876 | Bacteria | 15905 |
| 197 | Ga0451577_0013644 | 3300042876 | Bacteria | 7597 |
| 198 | Ga0451577_0044106 | 3300042876 | Bacteria | 3992 |
| 199 | Ga0451577_0049529 | 3300042876 | Bacteria | 3751 |
| 200 | Ga0451577_0406614 | 3300042876 | Bacteria | 1235 |
| 201 | Ga0453683_0000088 | 3300044673 | Bacteria | 138620 |
| 202 | Ga0453683_0054407 | 3300044673 | Bacteria | 2504 |
| 203 | Ga0453683_0060221 | 3300044673 | Bacteria | 2374 |
| 204 | Ga0453683_0061026 | 3300044673 | Bacteria | 2358 |
| 205 | Ga0453683_0120787 | 3300044673 | Bacteria | 1649 |
| 206 | Ga0453684_0000037 | 3300044712 | Bacteria | 709327 |
| 207 | Ga0453684_0014172 | 3300044712 | Bacteria | 12805 |
| 208 | Ga0453684_0041342 | 3300044712 | Bacteria | 6238 |
| 209 | Ga0453684_0084669 | 3300044712 | Bacteria | 3942 |
| 210 | Ga0453684_0111896 | 3300044712 | Bacteria | 3315 |
| 211 | Ga0453684_0354000 | 3300044712 | Bacteria | 1655 |
| 212 | Ga0451576_0005544 | 3300045051 | Bacteria | 15765 |
| 213 | Ga0451576_0046384 | 3300045051 | Bacteria | 4576 |
| 214 | Ga0451576_0047429 | 3300045051 | Bacteria | 4517 |
| 215 | Ga0451576_0125712 | 3300045051 | Bacteria | 2672 |
| 216 | Ga0451576_0132882 | 3300045051 | Bacteria | 2594 |
| 217 | Ga0451576_0167626 | 3300045051 | Bacteria | 2292 |
| 218 | Ga0466967_0495836 | 3300045976 | Bacteria | 1198 |
| 219 | Ga0495592_0070640 | 3300046454 | Bacteria | 2543 |
| 220 | Ga0495603_0087286 | 3300046455 | Bacteria | 1825 |
| 221 | Ga0495591_045300 | 3300046458 | Bacteria | 1227 |
| 222 | Ga0495629_0172448 | 3300046459 | Bacteria | 1501 |
| 223 | Ga0495653_0067992 | 3300046463 | Bacteria | 2673 |
| 224 | Ga0495653_0084133 | 3300046463 | Bacteria | 2344 |
| 225 | Ga0495653_0163694 | 3300046463 | Bacteria | 1542 |
| 226 | Ga0495582_0145586 | 3300046473 | Bacteria | 1344 |
| 227 | Ga0495582_0298656 | 3300046473 | Bacteria | 926 |
| 228 | Ga0495605_0031123 | 3300046474 | Bacteria | 2728 |
| 229 | Ga0495664_0051180 | 3300046477 | Bacteria | 2453 |
| 230 | Ga0495584_0010128 | 3300046491 | Bacteria | 4842 |
| 231 | Ga0495585_0012105 | 3300046492 | Bacteria | 5090 |
| 232 | Ga0495608_0064181 | 3300046511 | Bacteria | 2408 |
| 233 | Ga0495608_0110656 | 3300046511 | Bacteria | 1766 |
| 234 | Ga0495608_0195916 | 3300046511 | Bacteria | 1274 |
| 235 | Ga0495618_0063017 | 3300046514 | Bacteria | 2353 |
| 236 | Ga0495620_0007139 | 3300046515 | Bacteria | 6087 |
| 237 | Ga0495620_0067795 | 3300046515 | Bacteria | 1467 |
| 238 | Ga0495628_0038439 | 3300046516 | Bacteria | 3831 |
| 239 | Ga0495630_0058372 | 3300046517 | Bacteria | 2893 |
| 240 | Ga0495630_0063945 | 3300046517 | Bacteria | 2764 |
| 241 | Ga0495630_0266288 | 3300046517 | Bacteria | 1309 |
| 242 | Ga0495630_0307226 | 3300046517 | Bacteria | 1212 |
| 243 | Ga0495666_0018757 | 3300046526 | Bacteria | 3437 |
| 244 | Ga0495654_0060239 | 3300046530 | Bacteria | 1825 |
| 245 | Ga0495654_0110322 | 3300046530 | Bacteria | 1256 |
| 246 | Ga0495654_0139995 | 3300046530 | Bacteria | 1079 |
| 247 | Ga0495640_0098790 | 3300046533 | Bacteria | 1918 |
| 248 | Ga0495640_0102471 | 3300046533 | Bacteria | 1878 |
| 249 | Ga0495640_0185275 | 3300046533 | Bacteria | 1325 |
| 250 | Ga0495645_0170033 | 3300046543 | Bacteria | 1501 |
| 251 | Ga0495622_0014485 | 3300046557 | Bacteria | 3662 |
| 252 | Ga0495622_0018727 | 3300046557 | Bacteria | 3224 |
| 253 | Ga0495622_0173473 | 3300046557 | Bacteria | 969 |
| 254 | Ga0495633_0262847 | 3300046558 | Bacteria | 786 |
| 255 | Ga0495634_0021845 | 3300046642 | Bacteria | 4516 |
| 256 | Ga0495634_0079214 | 3300046642 | Bacteria | 2152 |
| 257 | Ga0495611_0277620 | 3300046648 | Bacteria | 774 |
| 258 | Ga0495635_0220469 | 3300046663 | Bacteria | 1283 |
| 259 | Ga0495635_0407410 | 3300046663 | Bacteria | 903 |
| 260 | Ga0495661_0071169 | 3300046665 | Bacteria | 2033 |
| 261 | Ga0495661_0090130 | 3300046665 | Bacteria | 1746 |
| 262 | Ga0495661_0100675 | 3300046665 | Bacteria | 1627 |
| 263 | Ga0495661_0193121 | 3300046665 | Bacteria | 1071 |
| 264 | Ga0495657_0057798 | 3300046675 | Bacteria | 2578 |
| 265 | Ga0495657_0194364 | 3300046675 | Bacteria | 1239 |
| 266 | Ga0495658_0135894 | 3300046683 | Bacteria | 1500 |
| 267 | Ga0495613_0001886 | 3300046689 | Bacteria | 15917 |
| 268 | Ga0495613_0113102 | 3300046689 | Bacteria | 1955 |
| 269 | Ga0495624_0316939 | 3300046690 | Bacteria | 939 |
| 270 | Ga0495660_0031747 | 3300046810 | Bacteria | 2968 |
| 271 | Ga0495672_0007452 | 3300047320 | Bacteria | 8231 |
| 272 | Ga0495676_0059397 | 3300047321 | Bacteria | 3003 |
| 273 | Ga0495676_0096860 | 3300047321 | Bacteria | 2192 |
| 274 | Ga0495676_0183628 | 3300047321 | Bacteria | 1464 |
| 275 | Ga0495680_0132020 | 3300047322 | Bacteria | 1834 |
| 276 | Ga0495683_0040440 | 3300047323 | Bacteria | 2356 |
| 277 | Ga0495675_0065031 | 3300047444 | Bacteria | 2307 |
| 278 | Ga0495684_0117934 | 3300047471 | Bacteria | 2000 |
| 279 | Ga0495684_0196949 | 3300047471 | Bacteria | 1487 |
| 280 | Ga0495684_0415683 | 3300047471 | Bacteria | 941 |
| 281 | Ga0495602_0168676 | 3300048088 | Bacteria | 1701 |
| 282 | Ga0495614_0010194 | 3300048089 | Bacteria | 4144 |
| 283 | Ga0495626_0079304 | 3300048091 | Bacteria | 1461 |
| 284 | Ga0496100_0005282 | 3300048903 | Bacteria | 6938 |
| 285 | Ga0496100_0024474 | 3300048903 | Bacteria | 3684 |
| 286 | Ga0496100_0160296 | 3300048903 | Bacteria | 1612 |
| 287 | Ga0496101_0110123 | 3300048904 | Bacteria | 2072 |
| 288 | Ga0496101_0228242 | 3300048904 | Bacteria | 1447 |
| 289 | Ga0496102_0010275 | 3300048905 | Bacteria | 8048 |
| 290 | Ga0496102_0270627 | 3300048905 | Bacteria | 1602 |
| 291 | Ga0496102_0389929 | 3300048905 | Bacteria | 1310 |
| 292 | Ga0496102_0485597 | 3300048905 | Bacteria | 1157 |
| 293 | Ga0496102_0573952 | 3300048905 | Bacteria | 1051 |
| 294 | Ga0496103_0001500 | 3300048906 | Bacteria | 15621 |
| 295 | Ga0496104_0001186 | 3300048907 | Bacteria | 22389 |
| 296 | Ga0496104_0187871 | 3300048907 | Bacteria | 1977 |
| 297 | Ga0496104_0876139 | 3300048907 | Bacteria | 803 |
| 298 | Ga0496105_0000964 | 3300048908 | Bacteria | 19760 |
| 299 | Ga0496105_0053016 | 3300048908 | Bacteria | 3350 |
| 300 | Ga0496105_0248853 | 3300048908 | Bacteria | 1440 |
| 301 | Ga0496106_0000361 | 3300048909 | Bacteria | 32313 |
| 302 | Ga0496106_0476293 | 3300048909 | Bacteria | 1003 |
| 303 | Ga0496107_0000282 | 3300048910 | Bacteria | 26883 |
| 304 | Ga0496108_0000443 | 3300048911 | Bacteria | 33208 |
| 305 | Ga0496109_0000778 | 3300048912 | Bacteria | 26502 |
| 306 | Ga0496109_0013733 | 3300048912 | Bacteria | 7037 |
| 307 | Ga0496109_0827626 | 3300048912 | Bacteria | 864 |
| 308 | Ga0496110_0002382 | 3300048913 | Bacteria | 14089 |
| 309 | Ga0496110_0117605 | 3300048913 | Bacteria | 2394 |
| 310 | Ga0496111_0000191 | 3300048914 | Bacteria | 28382 |
| 311 | Ga0496111_0206802 | 3300048914 | Bacteria | 1459 |
| 312 | Ga0496112_0006179 | 3300048915 | Bacteria | 10476 |
| 313 | Ga0496112_0251313 | 3300048915 | Bacteria | 1719 |
| 314 | Ga0496113_0001366 | 3300048916 | Bacteria | 13528 |
| 315 | Ga0496113_0113068 | 3300048916 | Bacteria | 2116 |
| 316 | Ga0496113_0364520 | 3300048916 | Bacteria | 1159 |
| 317 | Ga0496114_0113786 | 3300048917 | Bacteria | 2320 |
| 318 | Ga0496116_0001671 | 3300048919 | Bacteria | 24360 |
| 319 | Ga0496117_0022031 | 3300048920 | Bacteria | 5124 |
| 320 | Ga0496119_0005613 | 3300048922 | Bacteria | 11930 |
| 321 | Ga0496120_0007962 | 3300048923 | Bacteria | 7802 |
| 322 | Ga0496122_0013343 | 3300048925 | Bacteria | 8048 |
| 323 | Ga0496122_0022454 | 3300048925 | Bacteria | 5608 |
| 324 | Ga0496123_0004637 | 3300048926 | Bacteria | 14282 |
| 325 | Ga0496125_0004215 | 3300048928 | Bacteria | 16755 |
| 326 | Ga0496126_0004639 | 3300048929 | Bacteria | 16261 |
| 327 | Ga0496126_0005295 | 3300048929 | Bacteria | 14809 |
| 328 | Ga0501306_000031 | 3300049127 | Bacteria | 7963 |
| 329 | Ga0501306_000487 | 3300049127 | Bacteria | 3061 |
| 330 | Ga0501306_000497 | 3300049127 | Bacteria | 3050 |
| 331 | Ga0501306_000655 | 3300049127 | Bacteria | 2790 |
| 332 | Ga0501306_000823 | 3300049127 | Bacteria | 2631 |
| 333 | Ga0501306_001717 | 3300049127 | Bacteria | 2125 |
| 334 | Ga0501306_002383 | 3300049127 | Bacteria | 1920 |
| 335 | Ga0501306_002549 | 3300049127 | Bacteria | 1881 |
| 336 | Ga0501306_002657 | 3300049127 | Bacteria | 1858 |
| 337 | Ga0501308_000210 | 3300049128 | Bacteria | 3315 |
| 338 | Ga0501308_000287 | 3300049128 | Bacteria | 3046 |
| 339 | Ga0501308_001173 | 3300049128 | Bacteria | 2022 |
| 340 | Ga0501308_001828 | 3300049128 | Bacteria | 1778 |
| 341 | Ga0501308_003751 | 3300049128 | Bacteria | 1427 |
| 342 | Ga0501308_005283 | 3300049128 | Bacteria | 1280 |
| 343 | Ga0501309_000397 | 3300049129 | Bacteria | 3395 |
| 344 | Ga0501309_000721 | 3300049129 | Bacteria | 2871 |
| 345 | Ga0501309_001124 | 3300049129 | Bacteria | 2506 |
| 346 | Ga0501309_001463 | 3300049129 | Bacteria | 2329 |
| 347 | Ga0501309_010685 | 3300049129 | Bacteria | 1187 |
| 348 | Ga0501310_000371 | 3300049130 | Bacteria | 4033 |
| 349 | Ga0501310_000609 | 3300049130 | Bacteria | 3152 |
| 350 | Ga0501310_001129 | 3300049130 | Bacteria | 2402 |
| 351 | Ga0501310_002486 | 3300049130 | Bacteria | 1754 |
| 352 | Ga0501341_00107 | 3300049131 | Bacteria | 2594 |
| 353 | Ga0501341_00208 | 3300049131 | Bacteria | 2141 |
| 354 | Ga0501341_00221 | 3300049131 | Bacteria | 2117 |
| 355 | Ga0501341_00334 | 3300049131 | Bacteria | 1872 |
| 356 | Ga0501341_00436 | 3300049131 | Bacteria | 1746 |
| 357 | Ga0501341_05480 | 3300049131 | Bacteria | 761 |
| 358 | Ga0501343_000282 | 3300049132 | Bacteria | 2803 |
| 359 | Ga0501343_000822 | 3300049132 | Bacteria | 1952 |
| 360 | Ga0501343_001772 | 3300049132 | Bacteria | 1489 |
| 361 | Ga0501343_005673 | 3300049132 | Bacteria | 962 |
| 362 | Ga0501344_00106 | 3300049133 | Bacteria | 2723 |
| 363 | Ga0501344_00120 | 3300049133 | Bacteria | 2644 |
| 364 | Ga0501344_00965 | 3300049133 | Bacteria | 1323 |
| 365 | Ga0501345_00054 | 3300049134 | Bacteria | 2678 |
| 366 | Ga0501304_000742 | 3300049160 | Bacteria | 1845 |
| 367 | Ga0501304_001331 | 3300049160 | Bacteria | 1566 |
| 368 | Ga0501304_002229 | 3300049160 | Bacteria | 1330 |
| 369 | Ga0501305_000002 | 3300049161 | Bacteria | 17524 |
| 370 | Ga0501305_000036 | 3300049161 | Bacteria | 7597 |
| 371 | Ga0501305_000182 | 3300049161 | Bacteria | 4371 |
| 372 | Ga0501305_000320 | 3300049161 | Bacteria | 3757 |
| 373 | Ga0501305_000675 | 3300049161 | Bacteria | 2932 |
| 374 | Ga0501305_000790 | 3300049161 | Bacteria | 2796 |
| 375 | Ga0501305_001538 | 3300049161 | Bacteria | 2283 |
| 376 | Ga0501305_002447 | 3300049161 | Bacteria | 2004 |
| 377 | Ga0501305_002739 | 3300049161 | Bacteria | 1933 |
| 378 | Ga0501305_003224 | 3300049161 | Bacteria | 1834 |
| 379 | Ga0501305_006283 | 3300049161 | Bacteria | 1470 |
| 380 | Ga0501305_024578 | 3300049161 | Bacteria | 909 |
| 381 | Ga0501307_000012 | 3300049162 | Bacteria | 6382 |
| 382 | Ga0501307_000146 | 3300049162 | Bacteria | 3691 |
| 383 | Ga0501307_000209 | 3300049162 | Bacteria | 3392 |
| 384 | Ga0501307_000398 | 3300049162 | Bacteria | 2879 |
| 385 | Ga0501307_000466 | 3300049162 | Bacteria | 2738 |
| 386 | Ga0501307_000679 | 3300049162 | Bacteria | 2494 |
| 387 | Ga0501307_002114 | 3300049162 | Bacteria | 1809 |
| 388 | Ga0501342_00058 | 3300049163 | Bacteria | 2302 |
| 389 | Ga0501311_000004 | 3300049527 | Bacteria | 9566 |
| 390 | Ga0501311_000007 | 3300049527 | Bacteria | 8668 |
| 391 | Ga0501311_000810 | 3300049527 | Bacteria | 2422 |
| 392 | Ga0501311_001097 | 3300049527 | Bacteria | 2240 |
| 393 | Ga0501311_001468 | 3300049527 | Bacteria | 2058 |
| 394 | Ga0501311_002237 | 3300049527 | Bacteria | 1825 |
| 395 | Ga0501312_000003 | 3300049528 | Bacteria | 16850 |
| 396 | Ga0501312_000006 | 3300049528 | Bacteria | 10477 |
| 397 | Ga0501312_000567 | 3300049528 | Bacteria | 3090 |
| 398 | Ga0501312_000589 | 3300049528 | Bacteria | 3053 |
| 399 | Ga0501312_000598 | 3300049528 | Bacteria | 3037 |
| 400 | Ga0501312_000704 | 3300049528 | Bacteria | 2870 |
| 401 | Ga0501312_000761 | 3300049528 | Bacteria | 2807 |
| 402 | Ga0501312_000887 | 3300049528 | Bacteria | 2696 |
| 403 | Ga0501312_004363 | 3300049528 | Bacteria | 1663 |
| 404 | Ga0501313_000017 | 3300049529 | Bacteria | 8074 |
| 405 | Ga0501313_000080 | 3300049529 | Bacteria | 4457 |
| 406 | Ga0501313_000518 | 3300049529 | Bacteria | 2688 |
| 407 | Ga0501313_000585 | 3300049529 | Bacteria | 2623 |
| 408 | Ga0501313_001232 | 3300049529 | Bacteria | 2150 |
| 409 | Ga0501313_001631 | 3300049529 | Bacteria | 2004 |
| 410 | Ga0501313_006310 | 3300049529 | Bacteria | 1281 |
| 411 | Ga0501313_006820 | 3300049529 | Bacteria | 1246 |
| 412 | Ga0501314_000256 | 3300049530 | Bacteria | 3073 |
| 413 | Ga0501314_000364 | 3300049530 | Bacteria | 2732 |
| 414 | Ga0501314_000376 | 3300049530 | Bacteria | 2713 |
| 415 | Ga0501314_000408 | 3300049530 | Bacteria | 2651 |
| 416 | Ga0501314_000534 | 3300049530 | Bacteria | 2405 |
| 417 | Ga0501314_000966 | 3300049530 | Bacteria | 1949 |
| 418 | Ga0501314_001086 | 3300049530 | Bacteria | 1884 |
| 419 | Ga0501315_000019 | 3300049531 | Bacteria | 7980 |
| 420 | Ga0501315_000121 | 3300049531 | Bacteria | 4217 |
| 421 | Ga0501315_000389 | 3300049531 | Bacteria | 2964 |
| 422 | Ga0501315_000420 | 3300049531 | Bacteria | 2887 |
| 423 | Ga0501315_000455 | 3300049531 | Bacteria | 2824 |
| 424 | Ga0501315_001280 | 3300049531 | Bacteria | 2101 |
| 425 | Ga0501315_001361 | 3300049531 | Bacteria | 2067 |
| 426 | Ga0501315_002350 | 3300049531 | Bacteria | 1765 |
| 427 | Ga0501316_000029 | 3300049532 | Bacteria | 5933 |
| 428 | Ga0501316_000057 | 3300049532 | Bacteria | 4894 |
| 429 | Ga0501316_000077 | 3300049532 | Bacteria | 4588 |
| 430 | Ga0501316_000101 | 3300049532 | Bacteria | 4292 |
| 431 | Ga0501316_000267 | 3300049532 | Bacteria | 3270 |
| 432 | Ga0501316_000578 | 3300049532 | Bacteria | 2626 |
| 433 | Ga0501316_006198 | 3300049532 | Bacteria | 1267 |
| 434 | Ga0501317_000001 | 3300049533 | Bacteria | 21405 |
| 435 | Ga0501317_000015 | 3300049533 | Bacteria | 8499 |
| 436 | Ga0501317_000025 | 3300049533 | Bacteria | 7145 |
| 437 | Ga0501317_000117 | 3300049533 | Bacteria | 4257 |
| 438 | Ga0501317_000283 | 3300049533 | Bacteria | 3283 |
| 439 | Ga0501317_000743 | 3300049533 | Bacteria | 2483 |
| 440 | Ga0501317_001493 | 3300049533 | Bacteria | 2026 |
| 441 | Ga0501318_000001 | 3300049534 | Bacteria | 17462 |
| 442 | Ga0501318_000024 | 3300049534 | Bacteria | 6225 |
| 443 | Ga0501318_000298 | 3300049534 | Bacteria | 2899 |
| 444 | Ga0501318_000737 | 3300049534 | Bacteria | 2248 |
| 445 | Ga0501318_000818 | 3300049534 | Bacteria | 2175 |
| 446 | Ga0501318_001153 | 3300049534 | Bacteria | 1990 |
| 447 | Ga0501318_001644 | 3300049534 | Bacteria | 1804 |
| 448 | Ga0501319_000019 | 3300049535 | Bacteria | 5995 |
| 449 | Ga0501319_000069 | 3300049535 | Bacteria | 3482 |
| 450 | Ga0501319_000142 | 3300049535 | Bacteria | 2712 |
| 451 | Ga0501320_000031 | 3300049536 | Bacteria | 7449 |
| 452 | Ga0501320_000127 | 3300049536 | Bacteria | 3488 |
| 453 | Ga0501320_000269 | 3300049536 | Bacteria | 2795 |
| 454 | Ga0501320_000417 | 3300049536 | Bacteria | 2438 |
| 455 | Ga0501320_001252 | 3300049536 | Bacteria | 1810 |
| 456 | Ga0501320_011413 | 3300049536 | Bacteria | 920 |
| 457 | Ga0501321_000001 | 3300049537 | Bacteria | 16207 |
| 458 | Ga0501321_000032 | 3300049537 | Bacteria | 6962 |
| 459 | Ga0501321_000087 | 3300049537 | Bacteria | 4286 |
| 460 | Ga0501321_000347 | 3300049537 | Bacteria | 2848 |
| 461 | Ga0501321_000491 | 3300049537 | Bacteria | 2548 |
| 462 | Ga0501321_000499 | 3300049537 | Bacteria | 2534 |
| 463 | Ga0501321_005487 | 3300049537 | Bacteria | 1256 |
| 464 | Ga0501321_023432 | 3300049537 | Bacteria | 783 |
| 465 | Ga0501322_000105 | 3300049538 | Bacteria | 3214 |
| 466 | Ga0501322_000132 | 3300049538 | Bacteria | 2858 |
| 467 | Ga0501322_000252 | 3300049538 | Bacteria | 2333 |
| 468 | Ga0501322_000299 | 3300049538 | Bacteria | 2191 |
| 469 | Ga0501322_000543 | 3300049538 | Bacteria | 1820 |
| 470 | Ga0501322_000986 | 3300049538 | Bacteria | 1494 |
| 471 | Ga0501323_000031 | 3300049539 | Bacteria | 6387 |
| 472 | Ga0501323_000123 | 3300049539 | Bacteria | 4354 |
| 473 | Ga0501323_000356 | 3300049539 | Bacteria | 3260 |
| 474 | Ga0501323_000970 | 3300049539 | Bacteria | 2369 |
| 475 | Ga0501323_001243 | 3300049539 | Bacteria | 2202 |
| 476 | Ga0501323_001559 | 3300049539 | Bacteria | 2070 |
| 477 | Ga0501323_001588 | 3300049539 | Bacteria | 2058 |
| 478 | Ga0501323_002019 | 3300049539 | Bacteria | 1913 |
| 479 | Ga0501324_000001 | 3300049540 | Bacteria | 20831 |
| 480 | Ga0501324_000376 | 3300049540 | Bacteria | 2340 |
| 481 | Ga0501324_000524 | 3300049540 | Bacteria | 2114 |
| 482 | Ga0501324_000689 | 3300049540 | Bacteria | 1967 |
| 483 | Ga0501324_000710 | 3300049540 | Bacteria | 1950 |
| 484 | Ga0501324_001015 | 3300049540 | Bacteria | 1761 |
| 485 | Ga0501326_00062 | 3300049542 | Bacteria | 3234 |
| 486 | Ga0501326_00067 | 3300049542 | Bacteria | 3110 |
| 487 | Ga0501326_00091 | 3300049542 | Bacteria | 2798 |
| 488 | Ga0501326_00102 | 3300049542 | Bacteria | 2677 |
| 489 | Ga0501327_00098 | 3300049543 | Bacteria | 2655 |
| 490 | Ga0501327_00117 | 3300049543 | Bacteria | 2454 |
| 491 | Ga0501327_01095 | 3300049543 | Bacteria | 1251 |
| 492 | Ga0501328_00058 | 3300049544 | Bacteria | 2566 |
| 493 | Ga0501328_00120 | 3300049544 | Bacteria | 2054 |
| 494 | Ga0501328_00233 | 3300049544 | Bacteria | 1656 |
| 495 | Ga0501329_00035 | 3300049545 | Bacteria | 3186 |
| 496 | Ga0501330_000008 | 3300049546 | Bacteria | 6041 |
| 497 | Ga0501330_000037 | 3300049546 | Bacteria | 3347 |
| 498 | Ga0501330_000125 | 3300049546 | Bacteria | 2480 |
| 499 | Ga0501330_000173 | 3300049546 | Bacteria | 2255 |
| 500 | Ga0501330_000225 | 3300049546 | Bacteria | 2104 |
| 501 | Ga0501331_00059 | 3300049547 | Bacteria | 3195 |
| 502 | Ga0501332_00020 | 3300049548 | Bacteria | 4348 |
| 503 | Ga0501332_00078 | 3300049548 | Bacteria | 2904 |
| 504 | Ga0501332_00260 | 3300049548 | Bacteria | 2144 |
| 505 | Ga0501333_000285 | 3300049549 | Bacteria | 2172 |
| 506 | Ga0501333_000472 | 3300049549 | Bacteria | 1851 |
| 507 | Ga0501333_000872 | 3300049549 | Bacteria | 1520 |
| 508 | Ga0501334_00027 | 3300049550 | Bacteria | 4527 |
| 509 | Ga0501334_00251 | 3300049550 | Bacteria | 2218 |
| 510 | Ga0501335_000498 | 3300049551 | Bacteria | 2548 |
| 511 | Ga0501335_001188 | 3300049551 | Bacteria | 1952 |
| 512 | Ga0501335_001575 | 3300049551 | Bacteria | 1766 |
| 513 | Ga0501335_001947 | 3300049551 | Bacteria | 1638 |
| 514 | Ga0501335_002815 | 3300049551 | Bacteria | 1436 |
| 515 | Ga0501335_003930 | 3300049551 | Bacteria | 1279 |
| 516 | Ga0501335_006302 | 3300049551 | Bacteria | 1078 |
| 517 | Ga0501336_000091 | 3300049552 | Bacteria | 3189 |
| 518 | Ga0501337_000054 | 3300049553 | Bacteria | 3895 |
| 519 | Ga0501337_000088 | 3300049553 | Bacteria | 3392 |
| 520 | Ga0501337_000691 | 3300049553 | Bacteria | 1748 |
| 521 | Ga0501337_000729 | 3300049553 | Bacteria | 1713 |
| 522 | Ga0501338_00091 | 3300049554 | Bacteria | 2839 |
| 523 | Ga0501338_00103 | 3300049554 | Bacteria | 2781 |
| 524 | Ga0501338_00500 | 3300049554 | Bacteria | 1800 |
| 525 | Ga0501338_00782 | 3300049554 | Bacteria | 1547 |
| 526 | Ga0501338_01785 | 3300049554 | Bacteria | 1187 |
| 527 | Ga0501339_00007 | 3300049555 | Bacteria | 2547 |
| 528 | Ga0501340_000099 | 3300049556 | Bacteria | 2752 |
| 529 | Ga0501340_000108 | 3300049556 | Bacteria | 2699 |
| 530 | Ga0501340_000251 | 3300049556 | Bacteria | 2075 |
| 531 | Ga0501034_0024059 | 3300049571 | Bacteria | 6197 |
| 532 | Ga0501040_0350956 | 3300049576 | Bacteria | 1057 |
| 533 | Ga0501041_0333186 | 3300049577 | Bacteria | 958 |
| 534 | Ga0501043_0094276 | 3300049579 | Bacteria | 2353 |
| 535 | Ga0501046_0049684 | 3300049580 | Bacteria | 3317 |
| 536 | Ga0501047_0063124 | 3300049581 | Bacteria | 3573 |
| 537 | Ga0501070_0011947 | 3300049586 | Bacteria | 7333 |
| 538 | Ga0501072_0170876 | 3300049588 | Bacteria | 1735 |
| 539 | Ga0501072_0209865 | 3300049588 | Bacteria | 1552 |
| 540 | Ga0501072_0266591 | 3300049588 | Bacteria | 1363 |
| 541 | Ga0501073_0118279 | 3300049589 | Bacteria | 1837 |
| 542 | Ga0501075_0236530 | 3300049591 | Bacteria | 1393 |
| 543 | Ga0501202_018425 | 3300049652 | Bacteria | 1371 |
| 544 | Ga0501217_004344 | 3300049661 | Bacteria | 2908 |
| 545 | Ga0501217_005351 | 3300049661 | Bacteria | 2679 |
| 546 | Ga0501227_021242 | 3300049665 | Bacteria | 1496 |
| 547 | Ga0501245_009931 | 3300049708 | Bacteria | 1371 |
| 548 | Ga0501080_0027162 | 3300049742 | Bacteria | 5323 |
| 549 | Ga0501270_001993 | 3300049767 | Bacteria | 2040 |
| 550 | Ga0501212_009766 | 3300049851 | Bacteria | 1358 |
| 551 | nmdc:mga00v17_13821_c1 | 3300050491 | Bacteria | 4490 |
| 552 | nmdc:mga06z11_228180_c1 | 3300050494 | Bacteria | 1090 |
| 553 | nmdc:mga0qj67_472396_c1 | 3300050509 | Bacteria | 1009 |
| 554 | nmdc:mga06r32_62945_c1 | 3300050510 | Bacteria | 3574 |
| 555 | nmdc:mga08y16_109076_c1 | 3300050511 | Bacteria | 2882 |
| 556 | nmdc:mga08y16_128140_c1 | 3300050511 | Bacteria | 2640 |
| 557 | nmdc:mga08y16_3103_c1 | 3300050511 | Bacteria | 17195 |
| 558 | nmdc:mga0n895_950611_c1 | 3300050512 | Bacteria | 843 |
| 559 | nmdc:mga0rr50_42251_c1 | 3300050513 | Bacteria | 3328 |
| 560 | Ga0495601_0010480 | 3300053077 | Bacteria | 5518 |
| 561 | Ga0495601_0160426 | 3300053077 | Bacteria | 1469 |
| 562 | Ga0495612_0040570 | 3300053078 | Bacteria | 1897 |
| 563 | Ga0495595_0020140 | 3300053084 | Bacteria | 2901 |
| 564 | Ga0495619_0021877 | 3300053085 | Bacteria | 4086 |
| 565 | Ga0495619_0025656 | 3300053085 | Bacteria | 3787 |
| 566 | Ga0495619_0152126 | 3300053085 | Bacteria | 1596 |
| 567 | Ga0495619_0296446 | 3300053085 | Bacteria | 1120 |
| 568 | Ga0501084_0000009 | 3300054114 | Bacteria | 194961 |
| 569 | Ga0587111_0017291 | 3300060346 | Bacteria | 1342 |
| 570 | Ga0587111_0077658 | 3300060346 | Bacteria | 788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0931437 | Ga0373937_0931437_18_668 | 202 |
| 2 | 3300049551 | Ga0501335_001188 | Ga0501335_001188_103_849 | 206 |
| 3 | 3300049554 | Ga0501338_01785 | Ga0501338_01785_295_921 | 208 |
| 4 | 3300009094 | Ga0111539_10076046 | Ga0111539_100760463 | 209 |
| 5 | 3300036401 | Ga0373937_0112227 | Ga0373937_0112227_1266_1979 | 209 |
| 6 | 3300049536 | Ga0501320_000417 | Ga0501320_000417_631_1323 | 209 |
| 7 | 3300053084 | Ga0495595_0020140 | Ga0495595_0020140_612_1325 | 209 |
| 8 | 3300025294 | Ga0209025_1021451 | Ga0209025_10214515 | 210 |
| 9 | 3300031995 | Ga0307409_100018876 | Ga0307409_1000188766 | 210 |
| 10 | 3300049127 | Ga0501306_000655 | Ga0501306_000655_905_1600 | 210 |
| 11 | 3300049129 | Ga0501309_001124 | Ga0501309_001124_645_1340 | 210 |
| 12 | 3300049131 | Ga0501341_00208 | Ga0501341_00208_467_1162 | 210 |
| 13 | 3300049161 | Ga0501305_000036 | Ga0501305_000036_5512_6207 | 210 |
| 14 | 3300049162 | Ga0501307_000679 | Ga0501307_000679_645_1340 | 210 |
| 15 | 3300049527 | Ga0501311_000004 | Ga0501311_000004_7946_8641 | 210 |
| 16 | 3300049528 | Ga0501312_000006 | Ga0501312_000006_8038_8733 | 210 |
| 17 | 3300049529 | Ga0501313_000080 | Ga0501313_000080_1070_1765 | 210 |
| 18 | 3300049530 | Ga0501314_000376 | Ga0501314_000376_633_1328 | 210 |
| 19 | 3300049531 | Ga0501315_001361 | Ga0501315_001361_1240_1935 | 210 |
| 20 | 3300049532 | Ga0501316_000029 | Ga0501316_000029_856_1551 | 210 |
| 21 | 3300049533 | Ga0501317_000015 | Ga0501317_000015_1237_1932 | 210 |
| 22 | 3300049534 | Ga0501318_000024 | Ga0501318_000024_4468_5163 | 210 |
| 23 | 3300049535 | Ga0501319_000019 | Ga0501319_000019_903_1598 | 210 |
| 24 | 3300049537 | Ga0501321_000032 | Ga0501321_000032_1473_2168 | 210 |
| 25 | 3300049538 | Ga0501322_000132 | Ga0501322_000132_1235_1930 | 210 |
| 26 | 3300049539 | Ga0501323_000031 | Ga0501323_000031_912_1607 | 210 |
| 27 | 3300049540 | Ga0501324_001015 | Ga0501324_001015_91_786 | 210 |
| 28 | 3300049542 | Ga0501326_00091 | Ga0501326_00091_894_1589 | 210 |
| 29 | 3300049543 | Ga0501327_00117 | Ga0501327_00117_644_1339 | 210 |
| 30 | 3300049544 | Ga0501328_00120 | Ga0501328_00120_818_1513 | 210 |
| 31 | 3300049546 | Ga0501330_000008 | Ga0501330_000008_965_1660 | 210 |
| 32 | 3300049548 | Ga0501332_00020 | Ga0501332_00020_2694_3389 | 210 |
| 33 | 3300049550 | Ga0501334_00027 | Ga0501334_00027_2971_3666 | 210 |
| 34 | 3300049554 | Ga0501338_00091 | Ga0501338_00091_912_1607 | 210 |
| 35 | 3300003187 | JGI25151J46595_10003308 | JGI25151J46595_1000330812 | 211 |
| 36 | 3300003316 | rootH1_10000848 | rootH1_1000084821 | 211 |
| 37 | 3300003322 | rootL2_10052955 | rootL2_1005295521 | 211 |
| 38 | 3300003578 | Ga0006562J51391_1000046 | Ga0006562J51391_100004621 | 211 |
| 39 | 3300003790 | Ga0055528_1001614 | Ga0055528_100161414 | 211 |
| 40 | 3300005328 | Ga0070676_10006452 | Ga0070676_100064522 | 211 |
| 41 | 3300005331 | Ga0070670_100020078 | Ga0070670_1000200784 | 211 |
| 42 | 3300005353 | Ga0070669_100199350 | Ga0070669_1001993501 | 211 |
| 43 | 3300005355 | Ga0070671_100011607 | Ga0070671_1000116074 | 211 |
| 44 | 3300005456 | Ga0070678_100375143 | Ga0070678_1003751432 | 211 |
| 45 | 3300005543 | Ga0070672_100025082 | Ga0070672_1000250826 | 211 |
| 46 | 3300005548 | Ga0070665_101155262 | Ga0070665_1011552621 | 211 |
| 47 | 3300006163 | Ga0070715_10065228 | Ga0070715_100652282 | 211 |
| 48 | 3300009036 | Ga0105244_10026966 | Ga0105244_100269663 | 211 |
| 49 | 3300009092 | Ga0105250_10018759 | Ga0105250_100187593 | 211 |
| 50 | 3300009098 | Ga0105245_10129583 | Ga0105245_101295833 | 211 |
| 51 | 3300009101 | Ga0105247_10000354 | Ga0105247_1000035451 | 211 |
| 52 | 3300009148 | Ga0105243_10000301 | Ga0105243_1000030150 | 211 |
| 53 | 3300009176 | Ga0105242_10004076 | Ga0105242_100040765 | 211 |
| 54 | 3300011119 | Ga0105246_10000077 | Ga0105246_1000007714 | 211 |
| 55 | 3300013296 | Ga0157374_10013578 | Ga0157374_100135786 | 211 |
| 56 | 3300013297 | Ga0157378_10000237 | Ga0157378_1000023749 | 211 |
| 57 | 3300014745 | Ga0157377_10002894 | Ga0157377_1000289410 | 211 |
| 58 | 3300014969 | Ga0157376_10014258 | Ga0157376_100142581 | 211 |
| 59 | 3300025229 | Ga0209147_100806 | Ga0209147_1008068 | 211 |
| 60 | 3300025273 | Ga0209673_1001881 | Ga0209673_100188110 | 211 |
| 61 | 3300025294 | Ga0209025_1002868 | Ga0209025_100286811 | 211 |
| 62 | 3300025302 | Ga0207426_1008659 | Ga0207426_10086595 | 211 |
| 63 | 3300025711 | Ga0207696_1004774 | Ga0207696_10047748 | 211 |
| 64 | 3300025728 | Ga0207655_1007619 | Ga0207655_10076193 | 211 |
| 65 | 3300025735 | Ga0207713_1000405 | Ga0207713_100040556 | 211 |
| 66 | 3300025901 | Ga0207688_10121887 | Ga0207688_101218871 | 211 |
| 67 | 3300025907 | Ga0207645_10036479 | Ga0207645_100364792 | 211 |
| 68 | 3300025923 | Ga0207681_10110484 | Ga0207681_101104842 | 211 |
| 69 | 3300025925 | Ga0207650_10013760 | Ga0207650_100137608 | 211 |
| 70 | 3300025927 | Ga0207687_10095721 | Ga0207687_100957213 | 211 |
| 71 | 3300025931 | Ga0207644_10001801 | Ga0207644_100018017 | 211 |
| 72 | 3300025934 | Ga0207686_10004946 | Ga0207686_1000494610 | 211 |
| 73 | 3300025935 | Ga0207709_10000416 | Ga0207709_1000041654 | 211 |
| 74 | 3300025940 | Ga0207691_10039329 | Ga0207691_100393294 | 211 |
| 75 | 3300029272 | Ga0311000_121821 | Ga0311000_1218212 | 211 |
| 76 | 3300029273 | Ga0311008_105417 | Ga0311008_1054172 | 211 |
| 77 | 3300031548 | Ga0307408_100028935 | Ga0307408_1000289351 | 211 |
| 78 | 3300031995 | Ga0307409_100088345 | Ga0307409_1000883452 | 211 |
| 79 | 3300032002 | Ga0307416_100044091 | Ga0307416_1000440913 | 211 |
| 80 | 3300046455 | Ga0495603_0087286 | Ga0495603_0087286_102_797 | 211 |
| 81 | 3300046491 | Ga0495584_0010128 | Ga0495584_0010128_3699_4394 | 211 |
| 82 | 3300046492 | Ga0495585_0012105 | Ga0495585_0012105_2991_3686 | 211 |
| 83 | 3300046557 | Ga0495622_0014485 | Ga0495622_0014485_2318_3013 | 211 |
| 84 | 3300046558 | Ga0495633_0262847 | Ga0495633_0262847_56_751 | 211 |
| 85 | 3300046648 | Ga0495611_0277620 | Ga0495611_0277620_54_749 | 211 |
| 86 | 3300046665 | Ga0495661_0071169 | Ga0495661_0071169_45_740 | 211 |
| 87 | 3300047321 | Ga0495676_0059397 | Ga0495676_0059397_1025_1720 | 211 |
| 88 | 3300047323 | Ga0495683_0040440 | Ga0495683_0040440_1199_1894 | 211 |
| 89 | 3300048903 | Ga0496100_0005282 | Ga0496100_0005282_4532_5227 | 211 |
| 90 | 3300048905 | Ga0496102_0010275 | Ga0496102_0010275_5642_6337 | 211 |
| 91 | 3300048905 | Ga0496102_0389929 | Ga0496102_0389929_307_1005 | 211 |
| 92 | 3300048906 | Ga0496103_0001500 | Ga0496103_0001500_5770_6465 | 211 |
| 93 | 3300048907 | Ga0496104_0001186 | Ga0496104_0001186_8025_8720 | 211 |
| 94 | 3300048908 | Ga0496105_0000964 | Ga0496105_0000964_18212_18907 | 211 |
| 95 | 3300048909 | Ga0496106_0000361 | Ga0496106_0000361_18211_18906 | 211 |
| 96 | 3300048910 | Ga0496107_0000282 | Ga0496107_0000282_8016_8711 | 211 |
| 97 | 3300048911 | Ga0496108_0000443 | Ga0496108_0000443_28101_28796 | 211 |
| 98 | 3300048912 | Ga0496109_0000778 | Ga0496109_0000778_435_1130 | 211 |
| 99 | 3300048913 | Ga0496110_0002382 | Ga0496110_0002382_8863_9558 | 211 |
| 100 | 3300048914 | Ga0496111_0000191 | Ga0496111_0000191_25814_26509 | 211 |
| 101 | 3300048915 | Ga0496112_0006179 | Ga0496112_0006179_563_1258 | 211 |
| 102 | 3300048916 | Ga0496113_0001366 | Ga0496113_0001366_8174_8869 | 211 |
| 103 | 3300048919 | Ga0496116_0001671 | Ga0496116_0001671_5281_5976 | 211 |
| 104 | 3300048920 | Ga0496117_0022031 | Ga0496117_0022031_590_1285 | 211 |
| 105 | 3300048922 | Ga0496119_0005613 | Ga0496119_0005613_5211_5906 | 211 |
| 106 | 3300048923 | Ga0496120_0007962 | Ga0496120_0007962_1156_1851 | 211 |
| 107 | 3300048925 | Ga0496122_0013343 | Ga0496122_0013343_1712_2407 | 211 |
| 108 | 3300048926 | Ga0496123_0004637 | Ga0496123_0004637_3028_3723 | 211 |
| 109 | 3300048928 | Ga0496125_0004215 | Ga0496125_0004215_4422_5117 | 211 |
| 110 | 3300048929 | Ga0496126_0005295 | Ga0496126_0005295_5243_5938 | 211 |
| 111 | 3300049127 | Ga0501306_000031 | Ga0501306_000031_5435_6130 | 211 |
| 112 | 3300049128 | Ga0501308_003751 | Ga0501308_003751_644_1339 | 211 |
| 113 | 3300049129 | Ga0501309_000397 | Ga0501309_000397_1450_2145 | 211 |
| 114 | 3300049130 | Ga0501310_000609 | Ga0501310_000609_1373_2068 | 211 |
| 115 | 3300049132 | Ga0501343_000282 | Ga0501343_000282_1262_1957 | 211 |
| 116 | 3300049161 | Ga0501305_000002 | Ga0501305_000002_14314_15009 | 211 |
| 117 | 3300049162 | Ga0501307_000146 | Ga0501307_000146_1836_2531 | 211 |
| 118 | 3300049527 | Ga0501311_000007 | Ga0501311_000007_5452_6147 | 211 |
| 119 | 3300049528 | Ga0501312_000003 | Ga0501312_000003_13634_14329 | 211 |
| 120 | 3300049529 | Ga0501313_000017 | Ga0501313_000017_5546_6241 | 211 |
| 121 | 3300049530 | Ga0501314_000256 | Ga0501314_000256_1241_1936 | 211 |
| 122 | 3300049531 | Ga0501315_000019 | Ga0501315_000019_5452_6147 | 211 |
| 123 | 3300049532 | Ga0501316_000077 | Ga0501316_000077_2529_3224 | 211 |
| 124 | 3300049533 | Ga0501317_000001 | Ga0501317_000001_18877_19572 | 211 |
| 125 | 3300049534 | Ga0501318_000001 | Ga0501318_000001_14252_14947 | 211 |
| 126 | 3300049535 | Ga0501319_000069 | Ga0501319_000069_1551_2246 | 211 |
| 127 | 3300049536 | Ga0501320_000031 | Ga0501320_000031_5486_6181 | 211 |
| 128 | 3300049537 | Ga0501321_000001 | Ga0501321_000001_1879_2574 | 211 |
| 129 | 3300049538 | Ga0501322_000105 | Ga0501322_000105_1289_1984 | 211 |
| 130 | 3300049539 | Ga0501323_000123 | Ga0501323_000123_2552_3247 | 211 |
| 131 | 3300049540 | Ga0501324_000001 | Ga0501324_000001_18891_19586 | 211 |
| 132 | 3300049542 | Ga0501326_00067 | Ga0501326_00067_1170_1865 | 211 |
| 133 | 3300049544 | Ga0501328_00233 | Ga0501328_00233_843_1538 | 211 |
| 134 | 3300049546 | Ga0501330_000037 | Ga0501330_000037_1293_1988 | 211 |
| 135 | 3300049551 | Ga0501335_001947 | Ga0501335_001947_830_1525 | 211 |
| 136 | 3300049554 | Ga0501338_00103 | Ga0501338_00103_1231_1926 | 211 |
| 137 | 3300049588 | Ga0501072_0209865 | Ga0501072_0209865_312_1007 | 211 |
| 138 | 3300049661 | Ga0501217_004344 | Ga0501217_004344_1403_2098 | 211 |
| 139 | 3300049131 | Ga0501341_00107 | Ga0501341_00107_1246_1944 | 212 |
| 140 | 3300049553 | Ga0501337_000691 | Ga0501337_000691_177_875 | 212 |
| 141 | 3300007076 | Ga0075435_100148690 | Ga0075435_1001486903 | 215 |
| 142 | 3300050513 | nmdc:mga0rr50_42251_c1 | nmdc:mga0rr50_42251_c1_1695_2408 | 215 |
| 143 | 3300046663 | Ga0495635_0220469 | Ga0495635_0220469_374_1087 | 216 |
| 144 | 3300047321 | Ga0495676_0183628 | Ga0495676_0183628_28_738 | 216 |
| 145 | 3300035398 | Ga0316574_0071026 | Ga0316574_0071026_110_805 | 219 |
| 146 | 3300049127 | Ga0501306_002549 | Ga0501306_002549_92_790 | 220 |
| 147 | 3300049131 | Ga0501341_00221 | Ga0501341_00221_121_825 | 220 |
| 148 | 3300049132 | Ga0501343_005673 | Ga0501343_005673_36_776 | 220 |
| 149 | 3300049161 | Ga0501305_000675 | Ga0501305_000675_1012_1752 | 220 |
| 150 | 3300049161 | Ga0501305_001538 | Ga0501305_001538_810_1550 | 220 |
| 151 | 3300049162 | Ga0501307_000012 | Ga0501307_000012_127_825 | 220 |
| 152 | 3300049528 | Ga0501312_000567 | Ga0501312_000567_1182_1880 | 220 |
| 153 | 3300049529 | Ga0501313_001232 | Ga0501313_001232_72_812 | 220 |
| 154 | 3300049530 | Ga0501314_000966 | Ga0501314_000966_1176_1880 | 220 |
| 155 | 3300049531 | Ga0501315_000389 | Ga0501315_000389_1550_2254 | 220 |
| 156 | 3300049532 | Ga0501316_000267 | Ga0501316_000267_1196_1936 | 220 |
| 157 | 3300049533 | Ga0501317_000117 | Ga0501317_000117_1176_1916 | 220 |
| 158 | 3300049537 | Ga0501321_000491 | Ga0501321_000491_729_1427 | 220 |
| 159 | 3300049538 | Ga0501322_000252 | Ga0501322_000252_1161_1859 | 220 |
| 160 | 3300049539 | Ga0501323_002019 | Ga0501323_002019_53_793 | 220 |
| 161 | 3300005456 | Ga0070678_100316314 | Ga0070678_1003163141 | 222 |
| 162 | 3300013297 | Ga0157378_10066150 | Ga0157378_100661505 | 222 |
| 163 | 3300022467 | Ga0224712_10011825 | Ga0224712_100118253 | 222 |
| 164 | 3300046459 | Ga0495629_0172448 | Ga0495629_0172448_599_1309 | 222 |
| 165 | 3300046463 | Ga0495653_0084133 | Ga0495653_0084133_512_1222 | 222 |
| 166 | 3300046473 | Ga0495582_0145586 | Ga0495582_0145586_139_855 | 222 |
| 167 | 3300046473 | Ga0495582_0298656 | Ga0495582_0298656_32_742 | 222 |
| 168 | 3300046511 | Ga0495608_0110656 | Ga0495608_0110656_835_1545 | 222 |
| 169 | 3300046517 | Ga0495630_0307226 | Ga0495630_0307226_386_1096 | 222 |
| 170 | 3300046689 | Ga0495613_0113102 | Ga0495613_0113102_1024_1734 | 222 |
| 171 | 3300047471 | Ga0495684_0415683 | Ga0495684_0415683_56_766 | 222 |
| 172 | 3300048088 | Ga0495602_0168676 | Ga0495602_0168676_225_935 | 222 |
| 173 | 3300048089 | Ga0495614_0010194 | Ga0495614_0010194_2165_2881 | 222 |
| 174 | 3300053085 | Ga0495619_0025656 | Ga0495619_0025656_2927_3637 | 222 |
| 175 | 3300047321 | Ga0495676_0096860 | Ga0495676_0096860_1180_1878 | 223 |
| 176 | iso_pu_bacteria | 8007375930 | 8007379869 | 224 |
| 177 | 3300049530 | Ga0501314_000364 | Ga0501314_000364_758_1498 | 225 |
| 178 | 3300049539 | Ga0501323_000356 | Ga0501323_000356_1375_2115 | 225 |
| 179 | 3300049556 | Ga0501340_000099 | Ga0501340_000099_629_1369 | 225 |
| 180 | iso_pu_bacteria | 2818991441 | 2819571014 | 225 |
| 181 | iso_pu_bacteria | 3001267043 | 3001271854 | 225 |
| 182 | iso_pu_bacteria | 3001272096 | 3001275940 | 225 |
| 183 | iso_pu_bacteria | 3006988479 | 3006993231 | 225 |
| 184 | 3300049528 | Ga0501312_000589 | Ga0501312_000589_1133_1831 | 226 |
| 185 | iso_pu_bacteria | 2554235469 | 2556065810 | 226 |
| 186 | iso_pu_bacteria | 2600255229 | 2601444987 | 226 |
| 187 | iso_pu_bacteria | 2711768088 | 2712198852 | 226 |
| 188 | iso_pu_bacteria | 2816332186 | 2816866395 | 226 |
| 189 | iso_pu_bacteria | 2842682962 | 2842688259 | 226 |
| 190 | iso_pu_bacteria | 2849139964 | 2849144953 | 226 |
| 191 | iso_pu_bacteria | 2857581216 | 2857586499 | 226 |
| 192 | iso_pu_bacteria | 3006969106 | 3006973796 | 226 |
| 193 | 3300005290 | Ga0065712_10189397 | Ga0065712_101893971 | 227 |
| 194 | 3300005366 | Ga0070659_100814034 | Ga0070659_1008140341 | 227 |
| 195 | 3300005456 | Ga0070678_100272510 | Ga0070678_1002725102 | 227 |
| 196 | 3300006844 | Ga0075428_100063863 | Ga0075428_1000638634 | 227 |
| 197 | 3300009094 | Ga0111539_11101146 | Ga0111539_111011462 | 227 |
| 198 | 3300026023 | Ga0207677_10465257 | Ga0207677_104652572 | 227 |
| 199 | 3300026118 | Ga0207675_100087087 | Ga0207675_1000870874 | 227 |
| 200 | 3300026121 | Ga0207683_10249025 | Ga0207683_102490252 | 227 |
| 201 | 3300027907 | Ga0207428_10658161 | Ga0207428_106581611 | 227 |
| 202 | 3300030732 | Ga0316176_1026675 | Ga0316176_10266752 | 227 |
| 203 | 3300044673 | Ga0453683_0060221 | Ga0453683_0060221_844_1527 | 227 |
| 204 | 3300048905 | Ga0496102_0485597 | Ga0496102_0485597_424_1107 | 227 |
| 205 | 3300050511 | nmdc:mga08y16_109076_c1 | nmdc:mga08y16_109076_c1_2177_2860 | 227 |
| 206 | iso_pu_bacteria | 2599185353 | 2600199857 | 227 |
| 207 | iso_pu_bacteria | 2600254943 | 2600402889 | 227 |
| 208 | iso_pu_bacteria | 2643221731 | 2644721357 | 227 |
| 209 | iso_pu_bacteria | 2643221732 | 2644723342 | 227 |
| 210 | iso_pu_bacteria | 2671180330 | 2672333572 | 227 |
| 211 | iso_pu_bacteria | 2818991465 | 2819711982 | 227 |
| 212 | iso_pu_bacteria | 2842882022 | 2842887740 | 227 |
| 213 | iso_pu_bacteria | 2904524088 | 2904530150 | 227 |
| 214 | iso_pu_bacteria | 2919143609 | 2919149619 | 227 |
| 215 | iso_pu_bacteria | 2919517244 | 2919523208 | 227 |
| 216 | iso_pu_bacteria | 2919720352 | 2919726429 | 227 |
| 217 | iso_pu_bacteria | 2928093941 | 2928099898 | 227 |
| 218 | iso_pu_bacteria | 2929004312 | 2929009919 | 227 |
| 219 | iso_pu_bacteria | 2960319331 | 2960324300 | 227 |
| 220 | iso_pu_bacteria | 2960375949 | 2960378877 | 227 |
| 221 | iso_pu_bacteria | 8022893055 | 8022893418 | 227 |
| 222 | iso_pu_bacteria | 8022914991 | 8022917932 | 227 |
| 223 | 3300006946 | Ga0079104_1001572 | Ga0079104_10015726 | 228 |
| 224 | 3300006946 | Ga0079104_1009498 | Ga0079104_10094982 | 228 |
| 225 | 3300027111 | Ga0209281_1000059 | Ga0209281_100005937 | 228 |
| 226 | 3300027111 | Ga0209281_1000435 | Ga0209281_100043538 | 228 |
| 227 | 3300027111 | Ga0209281_1008199 | Ga0209281_10081992 | 228 |
| 228 | 3300027111 | Ga0209281_1027375 | Ga0209281_10273751 | 228 |
| 229 | 3300032168 | Ga0316593_10087435 | Ga0316593_100874352 | 228 |
| 230 | 3300042876 | Ga0451577_0044106 | Ga0451577_0044106_1176_1865 | 228 |
| 231 | 3300044673 | Ga0453683_0061026 | Ga0453683_0061026_602_1291 | 228 |
| 232 | 3300044712 | Ga0453684_0354000 | Ga0453684_0354000_475_1164 | 228 |
| 233 | 3300045051 | Ga0451576_0046384 | Ga0451576_0046384_3158_3847 | 228 |
| 234 | 3300045051 | Ga0451576_0125712 | Ga0451576_0125712_1865_2554 | 228 |
| 235 | 3300046458 | Ga0495591_045300 | Ga0495591_045300_52_741 | 228 |
| 236 | 3300046515 | Ga0495620_0007139 | Ga0495620_0007139_3774_4463 | 228 |
| 237 | 3300046515 | Ga0495620_0067795 | Ga0495620_0067795_100_789 | 228 |
| 238 | 3300046517 | Ga0495630_0266288 | Ga0495630_0266288_582_1268 | 228 |
| 239 | 3300046530 | Ga0495654_0060239 | Ga0495654_0060239_721_1410 | 228 |
| 240 | 3300046530 | Ga0495654_0110322 | Ga0495654_0110322_203_892 | 228 |
| 241 | 3300047320 | Ga0495672_0007452 | Ga0495672_0007452_3674_4363 | 228 |
| 242 | 3300048925 | Ga0496122_0022454 | Ga0496122_0022454_3108_3797 | 228 |
| 243 | 3300048929 | Ga0496126_0004639 | Ga0496126_0004639_2321_3010 | 228 |
| 244 | iso_pu_bacteria | 2511231119 | 2511697986 | 228 |
| 245 | iso_pu_bacteria | 2540341094 | 2540605210 | 228 |
| 246 | iso_pu_bacteria | 2545555800 | 2545559776 | 228 |
| 247 | iso_pu_bacteria | 2554235283 | 2555470864 | 228 |
| 248 | iso_pu_bacteria | 2576861599 | 2578930732 | 228 |
| 249 | iso_pu_bacteria | 2630968484 | 2631982480 | 228 |
| 250 | iso_pu_bacteria | 2643221735 | 2644741844 | 228 |
| 251 | iso_pu_bacteria | 2648501850 | 2651530344 | 228 |
| 252 | iso_pu_bacteria | 2671180844 | 2674421101 | 228 |
| 253 | iso_pu_bacteria | 2684623153 | 2686995308 | 228 |
| 254 | iso_pu_bacteria | 2687453109 | 2687496557 | 228 |
| 255 | iso_pu_bacteria | 2695420354 | 2695629905 | 228 |
| 256 | iso_pu_bacteria | 2716884898 | 2717918195 | 228 |
| 257 | iso_pu_bacteria | 2738541295 | 2738817086 | 228 |
| 258 | iso_pu_bacteria | 2738541299 | 2738838978 | 228 |
| 259 | iso_pu_bacteria | 2738543010 | 2739234652 | 228 |
| 260 | iso_pu_bacteria | 2788500588 | 2791215898 | 228 |
| 261 | iso_pu_bacteria | 2808606399 | 2809057202 | 228 |
| 262 | iso_pu_bacteria | 2811994870 | 2812314447 | 228 |
| 263 | iso_pu_bacteria | 2816332295 | 2817478174 | 228 |
| 264 | iso_pu_bacteria | 2818991451 | 2819627568 | 228 |
| 265 | iso_pu_bacteria | 2818991468 | 2819726084 | 228 |
| 266 | iso_pu_bacteria | 2823526263 | 2823526400 | 228 |
| 267 | iso_pu_bacteria | 2852673933 | 2852676601 | 228 |
| 268 | iso_pu_bacteria | 2860837431 | 2860837564 | 228 |
| 269 | iso_pu_bacteria | 2877768649 | 2877768783 | 228 |
| 270 | iso_pu_bacteria | 2880169592 | 2880169725 | 228 |
| 271 | iso_pu_bacteria | 2881644220 | 2881646618 | 228 |
| 272 | iso_pu_bacteria | 2897109615 | 2897109752 | 228 |
| 273 | iso_pu_bacteria | 2904560550 | 2904564574 | 228 |
| 274 | iso_pu_bacteria | 2904606771 | 2904610110 | 228 |
| 275 | iso_pu_bacteria | 2908665501 | 2908669335 | 228 |
| 276 | iso_pu_bacteria | 2919093281 | 2919097093 | 228 |
| 277 | iso_pu_bacteria | 2919414237 | 2919419338 | 228 |
| 278 | iso_pu_bacteria | 2919726948 | 2919730750 | 228 |
| 279 | iso_pu_bacteria | 2928510474 | 2928513064 | 228 |
| 280 | iso_pu_bacteria | 2936361878 | 2936363677 | 228 |
| 281 | iso_pu_bacteria | 2939593269 | 2939596162 | 228 |
| 282 | iso_pu_bacteria | 2954773129 | 2954776096 | 228 |
| 283 | iso_pu_bacteria | 2962290636 | 2962290775 | 228 |
| 284 | iso_pu_bacteria | 2969136845 | 2969136982 | 228 |
| 285 | iso_pu_bacteria | 2969141011 | 2969141151 | 228 |
| 286 | iso_pu_bacteria | 2969765954 | 2969766269 | 228 |
| 287 | iso_pu_bacteria | 2969770375 | 2969774937 | 228 |
| 288 | iso_pu_bacteria | 2971893375 | 2971893512 | 228 |
| 289 | iso_pu_bacteria | 2977254563 | 2977254710 | 228 |
| 290 | iso_pu_bacteria | 2980492589 | 2980492726 | 228 |
| 291 | iso_pu_bacteria | 2990275345 | 2990275713 | 228 |
| 292 | iso_pu_bacteria | 3001892409 | 3001898811 | 228 |
| 293 | iso_pu_bacteria | 3006858327 | 3006858502 | 228 |
| 294 | iso_pu_bacteria | 3006879489 | 3006883613 | 228 |
| 295 | iso_pu_bacteria | 3006973921 | 3006978373 | 228 |
| 296 | iso_pu_bacteria | 3006984091 | 3006988366 | 228 |
| 297 | iso_pu_bacteria | 8022630665 | 8022631656 | 228 |
| 298 | iso_pu_bacteria | 8051952484 | 8051956495 | 228 |
| 299 | iso_pu_bacteria | 8052174270 | 8052174971 | 228 |
| 300 | iso_pu_bacteria | 8054280661 | 8054282848 | 228 |
| 301 | iso_pu_bacteria | 8055531788 | 8055537116 | 228 |
| 302 | iso_pu_bacteria | 8057632132 | 8057632267 | 228 |
| 303 | 3300038443 | Ga0395901_0400270 | Ga0395901_0400270_269_1003 | 229 |
| 304 | 3300049577 | Ga0501041_0333186 | Ga0501041_0333186_83_775 | 229 |
| 305 | 3300005331 | Ga0070670_100560597 | Ga0070670_1005605972 | 230 |
| 306 | 3300005356 | Ga0070674_100570710 | Ga0070674_1005707101 | 230 |
| 307 | 3300005844 | Ga0068862_100128838 | Ga0068862_1001288384 | 230 |
| 308 | 3300006881 | Ga0068865_100450720 | Ga0068865_1004507202 | 230 |
| 309 | 3300025937 | Ga0207669_10475814 | Ga0207669_104758141 | 230 |
| 310 | 3300026089 | Ga0207648_10068016 | Ga0207648_100680165 | 230 |
| 311 | 3300026121 | Ga0207683_10206718 | Ga0207683_102067181 | 230 |
| 312 | 3300027614 | Ga0209970_1002684 | Ga0209970_10026844 | 230 |
| 313 | 3300028380 | Ga0268265_10241703 | Ga0268265_102417031 | 230 |
| 314 | 3300031251 | Ga0265327_10057128 | Ga0265327_100571282 | 230 |
| 315 | 3300041494 | Ga0451837_1797435 | Ga0451837_1797435_620_1315 | 230 |
| 316 | 3300048917 | Ga0496114_0113786 | Ga0496114_0113786_1155_1859 | 230 |
| 317 | 3300049529 | Ga0501313_006310 | Ga0501313_006310_424_1116 | 230 |
| 318 | 3300049576 | Ga0501040_0350956 | Ga0501040_0350956_204_902 | 230 |
| 319 | 3300049591 | Ga0501075_0236530 | Ga0501075_0236530_526_1224 | 230 |
| 320 | 3300050494 | nmdc:mga06z11_228180_c1 | nmdc:mga06z11_228180_c1_63_761 | 230 |
| 321 | 3300060346 | Ga0587111_0017291 | Ga0587111_0017291_335_1027 | 230 |
| 322 | 3300060346 | Ga0587111_0077658 | Ga0587111_0077658_34_726 | 230 |
| 323 | 3300005290 | Ga0065712_10079230 | Ga0065712_100792303 | 231 |
| 324 | 3300005293 | Ga0065715_10190587 | Ga0065715_101905872 | 231 |
| 325 | 3300005328 | Ga0070676_10240833 | Ga0070676_102408332 | 231 |
| 326 | 3300005331 | Ga0070670_100019013 | Ga0070670_1000190137 | 231 |
| 327 | 3300005334 | Ga0068869_100075173 | Ga0068869_1000751733 | 231 |
| 328 | 3300005340 | Ga0070689_100027530 | Ga0070689_1000275303 | 231 |
| 329 | 3300005345 | Ga0070692_10398912 | Ga0070692_103989121 | 231 |
| 330 | 3300005354 | Ga0070675_100066415 | Ga0070675_1000664156 | 231 |
| 331 | 3300005354 | Ga0070675_100398625 | Ga0070675_1003986252 | 231 |
| 332 | 3300005365 | Ga0070688_100026187 | Ga0070688_1000261877 | 231 |
| 333 | 3300005441 | Ga0070700_100522998 | Ga0070700_1005229981 | 231 |
| 334 | 3300005445 | Ga0070708_100715719 | Ga0070708_1007157191 | 231 |
| 335 | 3300005459 | Ga0068867_100023582 | Ga0068867_1000235827 | 231 |
| 336 | 3300005466 | Ga0070685_10006863 | Ga0070685_100068635 | 231 |
| 337 | 3300005577 | Ga0068857_100013317 | Ga0068857_1000133178 | 231 |
| 338 | 3300005617 | Ga0068859_100028015 | Ga0068859_1000280155 | 231 |
| 339 | 3300006051 | Ga0075364_10006779 | Ga0075364_100067793 | 231 |
| 340 | 3300006178 | Ga0075367_10195954 | Ga0075367_101959541 | 231 |
| 341 | 3300006931 | Ga0097620_100028015 | Ga0097620_1000280154 | 231 |
| 342 | 3300009094 | Ga0111539_10042697 | Ga0111539_100426979 | 231 |
| 343 | 3300009148 | Ga0105243_10228729 | Ga0105243_102287292 | 231 |
| 344 | 3300009176 | Ga0105242_10065634 | Ga0105242_100656342 | 231 |
| 345 | 3300010159 | Ga0099796_10025844 | Ga0099796_100258442 | 231 |
| 346 | 3300013102 | Ga0157371_10005050 | Ga0157371_100050509 | 231 |
| 347 | 3300013308 | Ga0157375_10153511 | Ga0157375_101535113 | 231 |
| 348 | 3300013308 | Ga0157375_10249039 | Ga0157375_102490392 | 231 |
| 349 | 3300014326 | Ga0157380_10046726 | Ga0157380_100467267 | 231 |
| 350 | 3300025922 | Ga0207646_10166025 | Ga0207646_101660252 | 231 |
| 351 | 3300025923 | Ga0207681_10254309 | Ga0207681_102543092 | 231 |
| 352 | 3300025923 | Ga0207681_10440745 | Ga0207681_104407451 | 231 |
| 353 | 3300025923 | Ga0207681_10527108 | Ga0207681_105271081 | 231 |
| 354 | 3300025926 | Ga0207659_10053626 | Ga0207659_100536262 | 231 |
| 355 | 3300025926 | Ga0207659_10274297 | Ga0207659_102742972 | 231 |
| 356 | 3300025934 | Ga0207686_10169188 | Ga0207686_101691882 | 231 |
| 357 | 3300025935 | Ga0207709_10374243 | Ga0207709_103742432 | 231 |
| 358 | 3300025936 | Ga0207670_10059001 | Ga0207670_100590013 | 231 |
| 359 | 3300025937 | Ga0207669_10074531 | Ga0207669_100745312 | 231 |
| 360 | 3300025942 | Ga0207689_10085506 | Ga0207689_100855063 | 231 |
| 361 | 3300025961 | Ga0207712_10048314 | Ga0207712_100483143 | 231 |
| 362 | 3300025972 | Ga0207668_10298490 | Ga0207668_102984902 | 231 |
| 363 | 3300026067 | Ga0207678_10356877 | Ga0207678_103568772 | 231 |
| 364 | 3300026075 | Ga0207708_10132970 | Ga0207708_101329703 | 231 |
| 365 | 3300026089 | Ga0207648_10033930 | Ga0207648_100339307 | 231 |
| 366 | 3300026118 | Ga0207675_100709680 | Ga0207675_1007096802 | 231 |
| 367 | 3300031691 | Ga0316579_10073769 | Ga0316579_100737692 | 231 |
| 368 | 3300031727 | Ga0316576_10025195 | Ga0316576_100251954 | 231 |
| 369 | 3300031728 | Ga0316578_10037404 | Ga0316578_100374043 | 231 |
| 370 | 3300031733 | Ga0316577_10048191 | Ga0316577_100481913 | 231 |
| 371 | 3300032133 | Ga0316583_10023640 | Ga0316583_100236403 | 231 |
| 372 | 3300033541 | Ga0316596_1014855 | Ga0316596_10148551 | 231 |
| 373 | 3300036712 | Ga0316584_0056348 | Ga0316584_0056348_1102_1815 | 231 |
| 374 | 3300039450 | Ga0436363_0569927 | Ga0436363_0569927_228_938 | 231 |
| 375 | 3300046463 | Ga0495653_0067992 | Ga0495653_0067992_1618_2334 | 231 |
| 376 | 3300046514 | Ga0495618_0063017 | Ga0495618_0063017_1187_1903 | 231 |
| 377 | 3300046526 | Ga0495666_0018757 | Ga0495666_0018757_599_1315 | 231 |
| 378 | 3300046533 | Ga0495640_0185275 | Ga0495640_0185275_150_866 | 231 |
| 379 | 3300046675 | Ga0495657_0057798 | Ga0495657_0057798_852_1568 | 231 |
| 380 | 3300047322 | Ga0495680_0132020 | Ga0495680_0132020_787_1503 | 231 |
| 381 | 3300047471 | Ga0495684_0117934 | Ga0495684_0117934_755_1471 | 231 |
| 382 | 3300048912 | Ga0496109_0827626 | Ga0496109_0827626_32_748 | 231 |
| 383 | 3300049131 | Ga0501341_05480 | Ga0501341_05480_13_711 | 231 |
| 384 | 3300049132 | Ga0501343_000822 | Ga0501343_000822_94_789 | 231 |
| 385 | 3300049528 | Ga0501312_004363 | Ga0501312_004363_38_799 | 231 |
| 386 | 3300049531 | Ga0501315_000455 | Ga0501315_000455_1927_2688 | 231 |
| 387 | 3300049532 | Ga0501316_000057 | Ga0501316_000057_1480_2175 | 231 |
| 388 | 3300049551 | Ga0501335_003930 | Ga0501335_003930_126_824 | 231 |
| 389 | 3300049554 | Ga0501338_00782 | Ga0501338_00782_646_1425 | 231 |
| 390 | 3300050491 | nmdc:mga00v17_13821_c1 | nmdc:mga00v17_13821_c1_1540_2256 | 231 |
| 391 | 3300050511 | nmdc:mga08y16_128140_c1 | nmdc:mga08y16_128140_c1_128_829 | 231 |
| 392 | 3300050511 | nmdc:mga08y16_3103_c1 | nmdc:mga08y16_3103_c1_7857_8558 | 231 |
| 393 | 3300003187 | JGI25151J46595_10000735 | JGI25151J46595_1000073533 | 232 |
| 394 | 3300003187 | JGI25151J46595_10001136 | JGI25151J46595_100011362 | 232 |
| 395 | 3300003187 | JGI25151J46595_10012381 | JGI25151J46595_100123814 | 232 |
| 396 | 3300003578 | Ga0006562J51391_1000677 | Ga0006562J51391_100067721 | 232 |
| 397 | 3300003751 | Ga0055538_1000081 | Ga0055538_100008116 | 232 |
| 398 | 3300005289 | Ga0065704_10019174 | Ga0065704_100191743 | 232 |
| 399 | 3300005338 | Ga0068868_100339119 | Ga0068868_1003391192 | 232 |
| 400 | 3300005444 | Ga0070694_100528691 | Ga0070694_1005286911 | 232 |
| 401 | 3300005467 | Ga0070706_100466541 | Ga0070706_1004665412 | 232 |
| 402 | 3300005468 | Ga0070707_100709667 | Ga0070707_1007096671 | 232 |
| 403 | 3300005471 | Ga0070698_100278933 | Ga0070698_1002789331 | 232 |
| 404 | 3300005518 | Ga0070699_100080347 | Ga0070699_1000803475 | 232 |
| 405 | 3300005530 | Ga0070679_100432153 | Ga0070679_1004321532 | 232 |
| 406 | 3300005536 | Ga0070697_100017739 | Ga0070697_1000177394 | 232 |
| 407 | 3300005536 | Ga0070697_100253963 | Ga0070697_1002539632 | 232 |
| 408 | 3300006163 | Ga0070715_10058571 | Ga0070715_100585713 | 232 |
| 409 | 3300006844 | Ga0075428_100542290 | Ga0075428_1005422902 | 232 |
| 410 | 3300006847 | Ga0075431_100177183 | Ga0075431_1001771833 | 232 |
| 411 | 3300006871 | Ga0075434_100062039 | Ga0075434_1000620391 | 232 |
| 412 | 3300006881 | Ga0068865_100123349 | Ga0068865_1001233493 | 232 |
| 413 | 3300006914 | Ga0075436_100041067 | Ga0075436_10004106710 | 232 |
| 414 | 3300009036 | Ga0105244_10094277 | Ga0105244_100942771 | 232 |
| 415 | 3300009094 | Ga0111539_10741310 | Ga0111539_107413102 | 232 |
| 416 | 3300009098 | Ga0105245_10006900 | Ga0105245_100069006 | 232 |
| 417 | 3300009174 | Ga0105241_10088992 | Ga0105241_100889921 | 232 |
| 418 | 3300025224 | Ga0209784_100044 | Ga0209784_100044165 | 232 |
| 419 | 3300025292 | Ga0209676_1057025 | Ga0209676_10570251 | 232 |
| 420 | 3300025294 | Ga0209025_1000639 | Ga0209025_100063959 | 232 |
| 421 | 3300025294 | Ga0209025_1016387 | Ga0209025_10163874 | 232 |
| 422 | 3300025905 | Ga0207685_10228621 | Ga0207685_102286212 | 232 |
| 423 | 3300025922 | Ga0207646_10012863 | Ga0207646_1001286316 | 232 |
| 424 | 3300025927 | Ga0207687_10006698 | Ga0207687_100066985 | 232 |
| 425 | 3300025938 | Ga0207704_10043139 | Ga0207704_100431393 | 232 |
| 426 | 3300025938 | Ga0207704_10179121 | Ga0207704_101791212 | 232 |
| 427 | 3300026023 | Ga0207677_10253818 | Ga0207677_102538182 | 232 |
| 428 | 3300026121 | Ga0207683_10615407 | Ga0207683_106154071 | 232 |
| 429 | 3300027671 | Ga0209588_1019099 | Ga0209588_10190991 | 232 |
| 430 | 3300028379 | Ga0268266_10555901 | Ga0268266_105559012 | 232 |
| 431 | 3300028573 | Ga0265334_10043783 | Ga0265334_100437833 | 232 |
| 432 | 3300029280 | Ga0311011_144096 | Ga0311011_1440961 | 232 |
| 433 | 3300031251 | Ga0265327_10094537 | Ga0265327_100945372 | 232 |
| 434 | 3300031548 | Ga0307408_100017547 | Ga0307408_1000175474 | 232 |
| 435 | 3300031731 | Ga0307405_10021522 | Ga0307405_100215222 | 232 |
| 436 | 3300031731 | Ga0307405_10215272 | Ga0307405_102152722 | 232 |
| 437 | 3300031903 | Ga0307407_10029070 | Ga0307407_100290702 | 232 |
| 438 | 3300031911 | Ga0307412_10505837 | Ga0307412_105058371 | 232 |
| 439 | 3300031995 | Ga0307409_100071775 | Ga0307409_1000717754 | 232 |
| 440 | 3300032002 | Ga0307416_100018258 | Ga0307416_1000182585 | 232 |
| 441 | 3300032002 | Ga0307416_100078459 | Ga0307416_1000784594 | 232 |
| 442 | 3300032002 | Ga0307416_100198442 | Ga0307416_1001984422 | 232 |
| 443 | 3300035119 | Ga0373956_0164319 | Ga0373956_0164319_163_876 | 232 |
| 444 | 3300035171 | Ga0373946_0074711 | Ga0373946_0074711_466_1179 | 232 |
| 445 | 3300035724 | Ga0373933_0064935 | Ga0373933_0064935_16_729 | 232 |
| 446 | 3300036401 | Ga0373937_0035502 | Ga0373937_0035502_2812_3525 | 232 |
| 447 | 3300036401 | Ga0373937_0305712 | Ga0373937_0305712_184_906 | 232 |
| 448 | 3300041505 | Ga0451849_1220464 | Ga0451849_1220464_144_863 | 232 |
| 449 | 3300042006 | Ga0439432_084115 | Ga0439432_084115_150_872 | 232 |
| 450 | 3300042435 | Ga0439434_0016420 | Ga0439434_0016420_398_1120 | 232 |
| 451 | 3300042876 | Ga0451577_0000006 | Ga0451577_0000006_444238_444945 | 232 |
| 452 | 3300042876 | Ga0451577_0003986 | Ga0451577_0003986_908_1606 | 232 |
| 453 | 3300042876 | Ga0451577_0013644 | Ga0451577_0013644_1010_1708 | 232 |
| 454 | 3300042876 | Ga0451577_0049529 | Ga0451577_0049529_1924_2622 | 232 |
| 455 | 3300042876 | Ga0451577_0406614 | Ga0451577_0406614_523_1221 | 232 |
| 456 | 3300044673 | Ga0453683_0000088 | Ga0453683_0000088_112162_112869 | 232 |
| 457 | 3300044673 | Ga0453683_0054407 | Ga0453683_0054407_1632_2357 | 232 |
| 458 | 3300044673 | Ga0453683_0120787 | Ga0453683_0120787_787_1485 | 232 |
| 459 | 3300044712 | Ga0453684_0000037 | Ga0453684_0000037_444233_444940 | 232 |
| 460 | 3300044712 | Ga0453684_0014172 | Ga0453684_0014172_1932_2630 | 232 |
| 461 | 3300044712 | Ga0453684_0041342 | Ga0453684_0041342_249_947 | 232 |
| 462 | 3300044712 | Ga0453684_0084669 | Ga0453684_0084669_1329_2027 | 232 |
| 463 | 3300044712 | Ga0453684_0111896 | Ga0453684_0111896_1856_2554 | 232 |
| 464 | 3300045051 | Ga0451576_0005544 | Ga0451576_0005544_13136_13834 | 232 |
| 465 | 3300045051 | Ga0451576_0047429 | Ga0451576_0047429_3291_3989 | 232 |
| 466 | 3300045051 | Ga0451576_0132882 | Ga0451576_0132882_1179_1886 | 232 |
| 467 | 3300045051 | Ga0451576_0167626 | Ga0451576_0167626_387_1112 | 232 |
| 468 | 3300045976 | Ga0466967_0495836 | Ga0466967_0495836_307_1005 | 232 |
| 469 | 3300046454 | Ga0495592_0070640 | Ga0495592_0070640_1527_2243 | 232 |
| 470 | 3300046463 | Ga0495653_0163694 | Ga0495653_0163694_12_728 | 232 |
| 471 | 3300046474 | Ga0495605_0031123 | Ga0495605_0031123_1264_1962 | 232 |
| 472 | 3300046477 | Ga0495664_0051180 | Ga0495664_0051180_523_1239 | 232 |
| 473 | 3300046511 | Ga0495608_0064181 | Ga0495608_0064181_1174_1893 | 232 |
| 474 | 3300046511 | Ga0495608_0195916 | Ga0495608_0195916_47_763 | 232 |
| 475 | 3300046516 | Ga0495628_0038439 | Ga0495628_0038439_531_1247 | 232 |
| 476 | 3300046517 | Ga0495630_0058372 | Ga0495630_0058372_979_1695 | 232 |
| 477 | 3300046517 | Ga0495630_0063945 | Ga0495630_0063945_1115_1825 | 232 |
| 478 | 3300046530 | Ga0495654_0139995 | Ga0495654_0139995_70_768 | 232 |
| 479 | 3300046533 | Ga0495640_0098790 | Ga0495640_0098790_429_1145 | 232 |
| 480 | 3300046533 | Ga0495640_0102471 | Ga0495640_0102471_163_873 | 232 |
| 481 | 3300046543 | Ga0495645_0170033 | Ga0495645_0170033_150_866 | 232 |
| 482 | 3300046557 | Ga0495622_0018727 | Ga0495622_0018727_362_1060 | 232 |
| 483 | 3300046557 | Ga0495622_0173473 | Ga0495622_0173473_259_957 | 232 |
| 484 | 3300046642 | Ga0495634_0021845 | Ga0495634_0021845_2629_3339 | 232 |
| 485 | 3300046642 | Ga0495634_0079214 | Ga0495634_0079214_855_1571 | 232 |
| 486 | 3300046663 | Ga0495635_0407410 | Ga0495635_0407410_28_747 | 232 |
| 487 | 3300046665 | Ga0495661_0090130 | Ga0495661_0090130_441_1139 | 232 |
| 488 | 3300046665 | Ga0495661_0100675 | Ga0495661_0100675_868_1566 | 232 |
| 489 | 3300046665 | Ga0495661_0193121 | Ga0495661_0193121_120_818 | 232 |
| 490 | 3300046675 | Ga0495657_0194364 | Ga0495657_0194364_204_920 | 232 |
| 491 | 3300046683 | Ga0495658_0135894 | Ga0495658_0135894_367_1083 | 232 |
| 492 | 3300046689 | Ga0495613_0001886 | Ga0495613_0001886_12512_13222 | 232 |
| 493 | 3300046690 | Ga0495624_0316939 | Ga0495624_0316939_74_790 | 232 |
| 494 | 3300046810 | Ga0495660_0031747 | Ga0495660_0031747_67_765 | 232 |
| 495 | 3300047444 | Ga0495675_0065031 | Ga0495675_0065031_304_1020 | 232 |
| 496 | 3300047471 | Ga0495684_0196949 | Ga0495684_0196949_69_785 | 232 |
| 497 | 3300048091 | Ga0495626_0079304 | Ga0495626_0079304_53_751 | 232 |
| 498 | 3300048903 | Ga0496100_0024474 | Ga0496100_0024474_1865_2563 | 232 |
| 499 | 3300048903 | Ga0496100_0160296 | Ga0496100_0160296_68_787 | 232 |
| 500 | 3300048904 | Ga0496101_0110123 | Ga0496101_0110123_1038_1757 | 232 |
| 501 | 3300048904 | Ga0496101_0228242 | Ga0496101_0228242_709_1428 | 232 |
| 502 | 3300048905 | Ga0496102_0270627 | Ga0496102_0270627_815_1513 | 232 |
| 503 | 3300048905 | Ga0496102_0573952 | Ga0496102_0573952_162_884 | 232 |
| 504 | 3300048907 | Ga0496104_0187871 | Ga0496104_0187871_941_1660 | 232 |
| 505 | 3300048907 | Ga0496104_0876139 | Ga0496104_0876139_25_744 | 232 |
| 506 | 3300048908 | Ga0496105_0053016 | Ga0496105_0053016_1828_2547 | 232 |
| 507 | 3300048908 | Ga0496105_0248853 | Ga0496105_0248853_268_990 | 232 |
| 508 | 3300048909 | Ga0496106_0476293 | Ga0496106_0476293_37_756 | 232 |
| 509 | 3300048912 | Ga0496109_0013733 | Ga0496109_0013733_1297_2019 | 232 |
| 510 | 3300048913 | Ga0496110_0117605 | Ga0496110_0117605_1532_2251 | 232 |
| 511 | 3300048914 | Ga0496111_0206802 | Ga0496111_0206802_233_931 | 232 |
| 512 | 3300048915 | Ga0496112_0251313 | Ga0496112_0251313_907_1626 | 232 |
| 513 | 3300048916 | Ga0496113_0113068 | Ga0496113_0113068_134_853 | 232 |
| 514 | 3300048916 | Ga0496113_0364520 | Ga0496113_0364520_66_764 | 232 |
| 515 | 3300049127 | Ga0501306_000487 | Ga0501306_000487_2226_2924 | 232 |
| 516 | 3300049127 | Ga0501306_000497 | Ga0501306_000497_885_1583 | 232 |
| 517 | 3300049127 | Ga0501306_000823 | Ga0501306_000823_706_1404 | 232 |
| 518 | 3300049127 | Ga0501306_001717 | Ga0501306_001717_718_1416 | 232 |
| 519 | 3300049127 | Ga0501306_002383 | Ga0501306_002383_515_1213 | 232 |
| 520 | 3300049127 | Ga0501306_002657 | Ga0501306_002657_331_1071 | 232 |
| 521 | 3300049128 | Ga0501308_000210 | Ga0501308_000210_1226_1924 | 232 |
| 522 | 3300049128 | Ga0501308_000287 | Ga0501308_000287_1177_1917 | 232 |
| 523 | 3300049128 | Ga0501308_001173 | Ga0501308_001173_234_932 | 232 |
| 524 | 3300049128 | Ga0501308_001828 | Ga0501308_001828_570_1268 | 232 |
| 525 | 3300049128 | Ga0501308_005283 | Ga0501308_005283_32_730 | 232 |
| 526 | 3300049129 | Ga0501309_000721 | Ga0501309_000721_1438_2178 | 232 |
| 527 | 3300049129 | Ga0501309_001463 | Ga0501309_001463_1310_2008 | 232 |
| 528 | 3300049129 | Ga0501309_010685 | Ga0501309_010685_441_1139 | 232 |
| 529 | 3300049130 | Ga0501310_000371 | Ga0501310_000371_1911_2609 | 232 |
| 530 | 3300049130 | Ga0501310_001129 | Ga0501310_001129_1127_1825 | 232 |
| 531 | 3300049130 | Ga0501310_002486 | Ga0501310_002486_483_1181 | 232 |
| 532 | 3300049131 | Ga0501341_00334 | Ga0501341_00334_245_943 | 232 |
| 533 | 3300049131 | Ga0501341_00436 | Ga0501341_00436_548_1246 | 232 |
| 534 | 3300049132 | Ga0501343_001772 | Ga0501343_001772_220_918 | 232 |
| 535 | 3300049133 | Ga0501344_00106 | Ga0501344_00106_561_1259 | 232 |
| 536 | 3300049133 | Ga0501344_00120 | Ga0501344_00120_1369_2067 | 232 |
| 537 | 3300049133 | Ga0501344_00965 | Ga0501344_00965_50_748 | 232 |
| 538 | 3300049134 | Ga0501345_00054 | Ga0501345_00054_1405_2103 | 232 |
| 539 | 3300049160 | Ga0501304_000742 | Ga0501304_000742_569_1267 | 232 |
| 540 | 3300049160 | Ga0501304_001331 | Ga0501304_001331_291_989 | 232 |
| 541 | 3300049160 | Ga0501304_002229 | Ga0501304_002229_59_757 | 232 |
| 542 | 3300049161 | Ga0501305_000182 | Ga0501305_000182_1375_2115 | 232 |
| 543 | 3300049161 | Ga0501305_000320 | Ga0501305_000320_1448_2146 | 232 |
| 544 | 3300049161 | Ga0501305_000790 | Ga0501305_000790_785_1483 | 232 |
| 545 | 3300049161 | Ga0501305_002447 | Ga0501305_002447_570_1268 | 232 |
| 546 | 3300049161 | Ga0501305_002739 | Ga0501305_002739_501_1199 | 232 |
| 547 | 3300049161 | Ga0501305_003224 | Ga0501305_003224_165_863 | 232 |
| 548 | 3300049161 | Ga0501305_006283 | Ga0501305_006283_614_1312 | 232 |
| 549 | 3300049161 | Ga0501305_024578 | Ga0501305_024578_158_856 | 232 |
| 550 | 3300049162 | Ga0501307_000209 | Ga0501307_000209_1261_2001 | 232 |
| 551 | 3300049162 | Ga0501307_000398 | Ga0501307_000398_737_1435 | 232 |
| 552 | 3300049162 | Ga0501307_000466 | Ga0501307_000466_1463_2161 | 232 |
| 553 | 3300049162 | Ga0501307_002114 | Ga0501307_002114_377_1075 | 232 |
| 554 | 3300049163 | Ga0501342_00058 | Ga0501342_00058_1023_1721 | 232 |
| 555 | 3300049527 | Ga0501311_000810 | Ga0501311_000810_243_941 | 232 |
| 556 | 3300049527 | Ga0501311_001097 | Ga0501311_001097_377_1075 | 232 |
| 557 | 3300049527 | Ga0501311_001468 | Ga0501311_001468_459_1157 | 232 |
| 558 | 3300049527 | Ga0501311_002237 | Ga0501311_002237_379_1077 | 232 |
| 559 | 3300049528 | Ga0501312_000598 | Ga0501312_000598_1281_1979 | 232 |
| 560 | 3300049528 | Ga0501312_000704 | Ga0501312_000704_718_1416 | 232 |
| 561 | 3300049528 | Ga0501312_000761 | Ga0501312_000761_1439_2179 | 232 |
| 562 | 3300049528 | Ga0501312_000887 | Ga0501312_000887_1484_2182 | 232 |
| 563 | 3300049529 | Ga0501313_000518 | Ga0501313_000518_1543_2241 | 232 |
| 564 | 3300049529 | Ga0501313_000585 | Ga0501313_000585_1588_2328 | 232 |
| 565 | 3300049529 | Ga0501313_001631 | Ga0501313_001631_570_1268 | 232 |
| 566 | 3300049529 | Ga0501313_006820 | Ga0501313_006820_48_746 | 232 |
| 567 | 3300049530 | Ga0501314_000408 | Ga0501314_000408_1453_2151 | 232 |
| 568 | 3300049530 | Ga0501314_000534 | Ga0501314_000534_924_1622 | 232 |
| 569 | 3300049530 | Ga0501314_001086 | Ga0501314_001086_569_1267 | 232 |
| 570 | 3300049531 | Ga0501315_000121 | Ga0501315_000121_2076_2816 | 232 |
| 571 | 3300049531 | Ga0501315_000420 | Ga0501315_000420_1453_2151 | 232 |
| 572 | 3300049531 | Ga0501315_001280 | Ga0501315_001280_711_1409 | 232 |
| 573 | 3300049531 | Ga0501315_002350 | Ga0501315_002350_333_1031 | 232 |
| 574 | 3300049532 | Ga0501316_000101 | Ga0501316_000101_2093_2833 | 232 |
| 575 | 3300049532 | Ga0501316_000578 | Ga0501316_000578_771_1469 | 232 |
| 576 | 3300049532 | Ga0501316_006198 | Ga0501316_006198_25_723 | 232 |
| 577 | 3300049533 | Ga0501317_000025 | Ga0501317_000025_2097_2837 | 232 |
| 578 | 3300049533 | Ga0501317_000283 | Ga0501317_000283_1119_1817 | 232 |
| 579 | 3300049533 | Ga0501317_000743 | Ga0501317_000743_899_1597 | 232 |
| 580 | 3300049533 | Ga0501317_001493 | Ga0501317_001493_578_1276 | 232 |
| 581 | 3300049534 | Ga0501318_000298 | Ga0501318_000298_357_1055 | 232 |
| 582 | 3300049534 | Ga0501318_000737 | Ga0501318_000737_578_1276 | 232 |
| 583 | 3300049534 | Ga0501318_000818 | Ga0501318_000818_1351_2091 | 232 |
| 584 | 3300049534 | Ga0501318_001153 | Ga0501318_001153_576_1274 | 232 |
| 585 | 3300049534 | Ga0501318_001644 | Ga0501318_001644_1071_1769 | 232 |
| 586 | 3300049535 | Ga0501319_000142 | Ga0501319_000142_1439_2137 | 232 |
| 587 | 3300049536 | Ga0501320_000127 | Ga0501320_000127_2224_2922 | 232 |
| 588 | 3300049536 | Ga0501320_000269 | Ga0501320_000269_1229_1969 | 232 |
| 589 | 3300049536 | Ga0501320_001252 | Ga0501320_001252_501_1199 | 232 |
| 590 | 3300049536 | Ga0501320_011413 | Ga0501320_011413_125_826 | 232 |
| 591 | 3300049537 | Ga0501321_000087 | Ga0501321_000087_2087_2827 | 232 |
| 592 | 3300049537 | Ga0501321_000347 | Ga0501321_000347_1095_1793 | 232 |
| 593 | 3300049537 | Ga0501321_000499 | Ga0501321_000499_694_1392 | 232 |
| 594 | 3300049537 | Ga0501321_005487 | Ga0501321_005487_259_957 | 232 |
| 595 | 3300049537 | Ga0501321_023432 | Ga0501321_023432_11_709 | 232 |
| 596 | 3300049538 | Ga0501322_000299 | Ga0501322_000299_207_947 | 232 |
| 597 | 3300049538 | Ga0501322_000543 | Ga0501322_000543_758_1456 | 232 |
| 598 | 3300049538 | Ga0501322_000986 | Ga0501322_000986_592_1290 | 232 |
| 599 | 3300049539 | Ga0501323_000970 | Ga0501323_000970_693_1391 | 232 |
| 600 | 3300049539 | Ga0501323_001243 | Ga0501323_001243_89_787 | 232 |
| 601 | 3300049539 | Ga0501323_001559 | Ga0501323_001559_578_1276 | 232 |
| 602 | 3300049539 | Ga0501323_001588 | Ga0501323_001588_626_1324 | 232 |
| 603 | 3300049540 | Ga0501324_000376 | Ga0501324_000376_697_1437 | 232 |
| 604 | 3300049540 | Ga0501324_000524 | Ga0501324_000524_570_1268 | 232 |
| 605 | 3300049540 | Ga0501324_000689 | Ga0501324_000689_769_1467 | 232 |
| 606 | 3300049540 | Ga0501324_000710 | Ga0501324_000710_862_1560 | 232 |
| 607 | 3300049542 | Ga0501326_00062 | Ga0501326_00062_1172_1912 | 232 |
| 608 | 3300049542 | Ga0501326_00102 | Ga0501326_00102_566_1264 | 232 |
| 609 | 3300049543 | Ga0501327_00098 | Ga0501327_00098_1383_2081 | 232 |
| 610 | 3300049543 | Ga0501327_01095 | Ga0501327_01095_40_738 | 232 |
| 611 | 3300049544 | Ga0501328_00058 | Ga0501328_00058_1304_2002 | 232 |
| 612 | 3300049545 | Ga0501329_00035 | Ga0501329_00035_1163_1861 | 232 |
| 613 | 3300049546 | Ga0501330_000125 | Ga0501330_000125_1050_1790 | 232 |
| 614 | 3300049546 | Ga0501330_000173 | Ga0501330_000173_1406_2104 | 232 |
| 615 | 3300049546 | Ga0501330_000225 | Ga0501330_000225_90_788 | 232 |
| 616 | 3300049547 | Ga0501331_00059 | Ga0501331_00059_1422_2120 | 232 |
| 617 | 3300049548 | Ga0501332_00078 | Ga0501332_00078_783_1523 | 232 |
| 618 | 3300049548 | Ga0501332_00260 | Ga0501332_00260_781_1479 | 232 |
| 619 | 3300049549 | Ga0501333_000285 | Ga0501333_000285_752_1450 | 232 |
| 620 | 3300049549 | Ga0501333_000472 | Ga0501333_000472_948_1646 | 232 |
| 621 | 3300049549 | Ga0501333_000872 | Ga0501333_000872_621_1319 | 232 |
| 622 | 3300049550 | Ga0501334_00251 | Ga0501334_00251_739_1437 | 232 |
| 623 | 3300049551 | Ga0501335_000498 | Ga0501335_000498_1141_1839 | 232 |
| 624 | 3300049551 | Ga0501335_001575 | Ga0501335_001575_581_1279 | 232 |
| 625 | 3300049551 | Ga0501335_002815 | Ga0501335_002815_649_1347 | 232 |
| 626 | 3300049551 | Ga0501335_006302 | Ga0501335_006302_48_746 | 232 |
| 627 | 3300049552 | Ga0501336_000091 | Ga0501336_000091_1046_1744 | 232 |
| 628 | 3300049553 | Ga0501337_000054 | Ga0501337_000054_2025_2723 | 232 |
| 629 | 3300049553 | Ga0501337_000088 | Ga0501337_000088_1374_2114 | 232 |
| 630 | 3300049553 | Ga0501337_000729 | Ga0501337_000729_446_1144 | 232 |
| 631 | 3300049554 | Ga0501338_00500 | Ga0501338_00500_510_1208 | 232 |
| 632 | 3300049555 | Ga0501339_00007 | Ga0501339_00007_771_1469 | 232 |
| 633 | 3300049556 | Ga0501340_000108 | Ga0501340_000108_1396_2094 | 232 |
| 634 | 3300049556 | Ga0501340_000251 | Ga0501340_000251_284_982 | 232 |
| 635 | 3300049571 | Ga0501034_0024059 | Ga0501034_0024059_2489_3208 | 232 |
| 636 | 3300049579 | Ga0501043_0094276 | Ga0501043_0094276_386_1105 | 232 |
| 637 | 3300049580 | Ga0501046_0049684 | Ga0501046_0049684_77_796 | 232 |
| 638 | 3300049581 | Ga0501047_0063124 | Ga0501047_0063124_766_1485 | 232 |
| 639 | 3300049586 | Ga0501070_0011947 | Ga0501070_0011947_1953_2672 | 232 |
| 640 | 3300049588 | Ga0501072_0170876 | Ga0501072_0170876_167_877 | 232 |
| 641 | 3300049588 | Ga0501072_0266591 | Ga0501072_0266591_154_873 | 232 |
| 642 | 3300049589 | Ga0501073_0118279 | Ga0501073_0118279_576_1295 | 232 |
| 643 | 3300049652 | Ga0501202_018425 | Ga0501202_018425_597_1295 | 232 |
| 644 | 3300049661 | Ga0501217_005351 | Ga0501217_005351_597_1295 | 232 |
| 645 | 3300049665 | Ga0501227_021242 | Ga0501227_021242_227_925 | 232 |
| 646 | 3300049708 | Ga0501245_009931 | Ga0501245_009931_279_977 | 232 |
| 647 | 3300049742 | Ga0501080_0027162 | Ga0501080_0027162_1863_2582 | 232 |
| 648 | 3300049767 | Ga0501270_001993 | Ga0501270_001993_513_1211 | 232 |
| 649 | 3300049851 | Ga0501212_009766 | Ga0501212_009766_72_770 | 232 |
| 650 | 3300050509 | nmdc:mga0qj67_472396_c1 | nmdc:mga0qj67_472396_c1_235_951 | 232 |
| 651 | 3300050510 | nmdc:mga06r32_62945_c1 | nmdc:mga06r32_62945_c1_1891_2607 | 232 |
| 652 | 3300050512 | nmdc:mga0n895_950611_c1 | nmdc:mga0n895_950611_c1_23_727 | 232 |
| 653 | 3300053077 | Ga0495601_0010480 | Ga0495601_0010480_1403_2119 | 232 |
| 654 | 3300053077 | Ga0495601_0160426 | Ga0495601_0160426_725_1444 | 232 |
| 655 | 3300053078 | Ga0495612_0040570 | Ga0495612_0040570_1022_1738 | 232 |
| 656 | 3300053085 | Ga0495619_0021877 | Ga0495619_0021877_2898_3614 | 232 |
| 657 | 3300053085 | Ga0495619_0152126 | Ga0495619_0152126_837_1556 | 232 |
| 658 | 3300053085 | Ga0495619_0296446 | Ga0495619_0296446_25_744 | 232 |
| 659 | 3300054114 | Ga0501084_0000009 | Ga0501084_0000009_50533_51255 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.9826 | 19 | 225 |
| 4v5f-assembly1.cif.gz_BC | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9764 | 5 | 225 |
| 4qg3-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus | 0.9754 | 5 | 225 |
| 4v9h-assembly1.cif.gz_BC | crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state | 0.9728 | 3 | 225 |
| 4v8y-assembly1.cif.gz_CL | cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex | 0.9727 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9896 | 16 | 226 | 3.30.190.20 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.984 | 18 | 227 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9825 | 74 | 159 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9713 | 16 | 226 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.9605 | 74 | 159 | 3.40.50.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B0HUE2-F1-model_v4 | deleted | 0.9968 | 1 | 197 |
|
| AF-Q88YW9-F1-model_v4 | Large ribosomal subunit protein uL1 (50S ribosomal protein L1) | 0.994 | 1 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A380GR85-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9939 | 1 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A523HGB8-F1-model_v4 | Ribosomal protein | 0.9936 | 36 | 224 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A0R2N9K1-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9934 | 1 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar