F473286

General Info

Members Datasets Scaffolds Average Seq Length
659 364 570 228

Family's Representative Sequence

Representative Sequence 3300049554|Ga0501338_00782|Ga0501338_00782_646_1425
Length 259
Sequence LNEYLGKVLALFYVGGYSAKTTIKEEIKMAKKGKKYLEAAKLVDRSKAYPIGEAVELVKQTSFTKFDASVEAAFRLGVDPKKADQQIRGAVVLPNGTGKTQRVLVFAKGEKVKEAEAAGADYVGDTEYINKISQGWFEFDVIVATPDMMGEVGKLGRTLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEYRVDKAGNIHVPIGKASFETEKLVENFNTIFETMVKVKPAAAKGTYMKNVAVTSTMGPSVKVDPATAGK

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
3 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
4 2554235283 Bacillus safensis VK Isolate Rhizosphere
5 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
6 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
7 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
8 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
9 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
10 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
11 2643221731 Bacillus sp. Root147 Isolate Unclassified
12 2643221732 Bacillus sp. Root239 Isolate Unclassified
13 2643221735 Bacillus sp. Root920 Isolate Unclassified
14 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
15 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
16 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
17 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
18 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
19 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
20 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
21 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
22 2738541295 Bacillus sp. OK085 Isolate Unclassified
23 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
24 2738543010 Bacillus sp. YR335 Isolate Unclassified
25 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
26 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
27 2811994870 Bacillus sp. JB4 Isolate Unclassified
28 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
29 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
30 2818991441 Niallia circulans 3243 Isolate Rhizosphere
31 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
32 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
33 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
34 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
35 2842682962 Bacillus sp. R-72492 Isolate Unclassified
36 2842882022 Bacillus sp. R-71893 Isolate Unclassified
37 2849139964 Bacillus sp. R-71875 Isolate Unclassified
38 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
39 2857581216 Bacillus sp. R-71922 Isolate Unclassified
40 2860837431 Bacillus sp. WR11 Isolate Unclassified
41 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
42 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
43 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
44 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
45 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
46 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
47 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
48 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
49 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
50 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
51 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
52 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
53 2919720352 Priestia megaterium 4340 Isolate Unclassified
54 2919726948 Bacillus pumilus 4489 Isolate Unclassified
55 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
56 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
57 2929004312 Priestia megaterium 1104 Isolate Unclassified
58 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
59 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
60 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
61 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
62 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
63 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
64 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
65 2969141011 Bacillus velezensis MH25 Isolate Unclassified
66 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
67 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
68 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
69 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
70 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
71 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
72 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
73 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
74 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
75 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
76 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
77 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
78 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
79 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
80 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
81 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
82 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
83 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
84 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
85 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
88 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
89 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
95 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
96 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
97 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
100 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
103 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
106 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
107 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
108 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
109 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
110 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
111 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
112 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
113 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
114 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
115 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
189 3300029273 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stno.R1 Metatranscriptome Rhizosphere
190 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
191 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
195 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
196 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
204 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049555 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
337 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
338 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
339 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
342 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
357 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
358 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
359 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
360 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
361 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
362 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
363 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
364 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 54.17
Metatranscriptomes 32.32
Isolates 13.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.91
Rhizoplane 5.46
Rhizosphere 82.55
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000735 3300003187 Bacteria 26974
2 JGI25151J46595_10001136 3300003187 Bacteria 19348
3 JGI25151J46595_10003308 3300003187 Bacteria 8947
4 JGI25151J46595_10012381 3300003187 Bacteria 3883
5 rootH1_10000848 3300003316 Bacteria 58943
6 rootL2_10052955 3300003322 Bacteria 32035
7 Ga0006562J51391_1000046 3300003578 Bacteria 48312
8 Ga0006562J51391_1000677 3300003578 Bacteria 45519
9 Ga0055538_1000081 3300003751 Bacteria 85159
10 Ga0055528_1001614 3300003790 Bacteria 13323
11 Ga0065704_10019174 3300005289 Bacteria 1706
12 Ga0065712_10079230 3300005290 Bacteria 3236
13 Ga0065712_10189397 3300005290 Bacteria 1155
14 Ga0065715_10190587 3300005293 Bacteria 1417
15 Ga0070676_10006452 3300005328 Bacteria 6271
16 Ga0070676_10240833 3300005328 Bacteria 1203
17 Ga0070670_100019013 3300005331 Bacteria 5892
18 Ga0070670_100020078 3300005331 Bacteria 5738
19 Ga0070670_100560597 3300005331 Bacteria 1020
20 Ga0068869_100075173 3300005334 Bacteria 2509
21 Ga0068868_100339119 3300005338 Bacteria 1285
22 Ga0070689_100027530 3300005340 Bacteria 4286
23 Ga0070692_10398912 3300005345 Bacteria 868
24 Ga0070669_100199350 3300005353 Bacteria 1574
25 Ga0070675_100066415 3300005354 Bacteria 2984
26 Ga0070675_100398625 3300005354 Bacteria 1227
27 Ga0070671_100011607 3300005355 Bacteria 7086
28 Ga0070674_100570710 3300005356 Bacteria 952
29 Ga0070688_100026187 3300005365 Bacteria 3462
30 Ga0070659_100814034 3300005366 Bacteria 813
31 Ga0070700_100522998 3300005441 Bacteria 917
32 Ga0070694_100528691 3300005444 Bacteria 942
33 Ga0070708_100715719 3300005445 Bacteria 942
34 Ga0070678_100272510 3300005456 Bacteria 1428
35 Ga0070678_100316314 3300005456 Bacteria 1332
36 Ga0070678_100375143 3300005456 Bacteria 1229
37 Ga0068867_100023582 3300005459 Bacteria 4405
38 Ga0070685_10006863 3300005466 Bacteria 5812
39 Ga0070706_100466541 3300005467 Bacteria 1175
40 Ga0070707_100709667 3300005468 Bacteria 969
41 Ga0070698_100278933 3300005471 Bacteria 1603
42 Ga0070699_100080347 3300005518 Bacteria 2841
43 Ga0070679_100432153 3300005530 Bacteria 1262
44 Ga0070697_100017739 3300005536 Bacteria 5607
45 Ga0070697_100253963 3300005536 Bacteria 1504
46 Ga0070672_100025082 3300005543 Bacteria 4417
47 Ga0070665_101155262 3300005548 Bacteria 785
48 Ga0068857_100013317 3300005577 Bacteria 7161
49 Ga0068859_100028015 3300005617 Bacteria 5649
50 Ga0068862_100128838 3300005844 Bacteria 2237
51 Ga0075364_10006779 3300006051 Bacteria 6755
52 Ga0070715_10058571 3300006163 Bacteria 1682
53 Ga0070715_10065228 3300006163 Bacteria 1611
54 Ga0075367_10195954 3300006178 Bacteria 1261
55 Ga0075428_100063863 3300006844 Bacteria 4031
56 Ga0075428_100542290 3300006844 Bacteria 1243
57 Ga0075431_100177183 3300006847 Bacteria 2189
58 Ga0075434_100062039 3300006871 Bacteria 3720
59 Ga0068865_100123349 3300006881 Bacteria 1930
60 Ga0068865_100450720 3300006881 Bacteria 1064
61 Ga0075436_100041067 3300006914 Bacteria 3192
62 Ga0097620_100028015 3300006931 Bacteria 5649
63 Ga0079104_1001572 3300006946 Bacteria 14942
64 Ga0079104_1009498 3300006946 Bacteria 3287
65 Ga0075435_100148690 3300007076 Bacteria 1968
66 Ga0105244_10026966 3300009036 Bacteria 3103
67 Ga0105244_10094277 3300009036 Bacteria 1470
68 Ga0105250_10018759 3300009092 Bacteria 2800
69 Ga0111539_10042697 3300009094 Bacteria 5443
70 Ga0111539_10076046 3300009094 Bacteria 3954
71 Ga0111539_10741310 3300009094 Bacteria 1143
72 Ga0111539_11101146 3300009094 Bacteria 923
73 Ga0105245_10006900 3300009098 Bacteria 9956
74 Ga0105245_10129583 3300009098 Bacteria 2365
75 Ga0105247_10000354 3300009101 Bacteria 39709
76 Ga0105243_10000301 3300009148 Bacteria 54622
77 Ga0105243_10228729 3300009148 Bacteria 1649
78 Ga0105241_10088992 3300009174 Bacteria 2432
79 Ga0105242_10004076 3300009176 Bacteria 11356
80 Ga0105242_10065634 3300009176 Bacteria 2995
81 Ga0099796_10025844 3300010159 Bacteria 1859
82 Ga0105246_10000077 3300011119 Bacteria 41151
83 Ga0157371_10005050 3300013102 Bacteria 11283
84 Ga0157374_10013578 3300013296 Bacteria 7114
85 Ga0157378_10000237 3300013297 Bacteria 53846
86 Ga0157378_10066150 3300013297 Bacteria 3237
87 Ga0157375_10153511 3300013308 Bacteria 2440
88 Ga0157375_10249039 3300013308 Bacteria 1937
89 Ga0157380_10046726 3300014326 Bacteria 3402
90 Ga0157377_10002894 3300014745 Bacteria 7675
91 Ga0157376_10014258 3300014969 Bacteria 5959
92 Ga0224712_10011825 3300022467 Bacteria 2722
93 Ga0209784_100044 3300025224 Bacteria 206858
94 Ga0209147_100806 3300025229 Bacteria 15071
95 Ga0209673_1001881 3300025273 Bacteria 16921
96 Ga0209676_1057025 3300025292 Bacteria 992
97 Ga0209025_1000639 3300025294 Bacteria 61845
98 Ga0209025_1002868 3300025294 Bacteria 17284
99 Ga0209025_1016387 3300025294 Bacteria 4378
100 Ga0209025_1021451 3300025294 Bacteria 3478
101 Ga0207426_1008659 3300025302 Bacteria 4084
102 Ga0207696_1004774 3300025711 Bacteria 5763
103 Ga0207655_1007619 3300025728 Bacteria 6993
104 Ga0207713_1000405 3300025735 Bacteria 46074
105 Ga0207688_10121887 3300025901 Bacteria 1522
106 Ga0207685_10228621 3300025905 Bacteria 889
107 Ga0207645_10036479 3300025907 Bacteria 3156
108 Ga0207646_10012863 3300025922 Bacteria 8022
109 Ga0207646_10166025 3300025922 Bacteria 1993
110 Ga0207681_10110484 3300025923 Bacteria 1999
111 Ga0207681_10254309 3300025923 Bacteria 1373
112 Ga0207681_10440745 3300025923 Bacteria 1058
113 Ga0207681_10527108 3300025923 Bacteria 970
114 Ga0207650_10013760 3300025925 Bacteria 5611
115 Ga0207659_10053626 3300025926 Bacteria 2876
116 Ga0207659_10274297 3300025926 Bacteria 1377
117 Ga0207687_10006698 3300025927 Bacteria 7599
118 Ga0207687_10095721 3300025927 Bacteria 2175
119 Ga0207644_10001801 3300025931 Bacteria 13903
120 Ga0207686_10004946 3300025934 Bacteria 7173
121 Ga0207686_10169188 3300025934 Bacteria 1539
122 Ga0207709_10000416 3300025935 Bacteria 41461
123 Ga0207709_10374243 3300025935 Bacteria 1082
124 Ga0207670_10059001 3300025936 Bacteria 2609
125 Ga0207669_10074531 3300025937 Bacteria 2147
126 Ga0207669_10475814 3300025937 Bacteria 995
127 Ga0207704_10043139 3300025938 Bacteria 2660
128 Ga0207704_10179121 3300025938 Bacteria 1530
129 Ga0207691_10039329 3300025940 Bacteria 4375
130 Ga0207689_10085506 3300025942 Bacteria 2592
131 Ga0207712_10048314 3300025961 Bacteria 2959
132 Ga0207668_10298490 3300025972 Bacteria 1329
133 Ga0207677_10253818 3300026023 Bacteria 1430
134 Ga0207677_10465257 3300026023 Bacteria 1086
135 Ga0207678_10356877 3300026067 Bacteria 1261
136 Ga0207708_10132970 3300026075 Bacteria 1946
137 Ga0207648_10033930 3300026089 Bacteria 4500
138 Ga0207648_10068016 3300026089 Bacteria 3104
139 Ga0207675_100087087 3300026118 Bacteria 2933
140 Ga0207675_100709680 3300026118 Bacteria 1015
141 Ga0207683_10206718 3300026121 Bacteria 1786
142 Ga0207683_10249025 3300026121 Bacteria 1621
143 Ga0207683_10615407 3300026121 Bacteria 1005
144 Ga0209281_1000059 3300027111 Bacteria 295913
145 Ga0209281_1000435 3300027111 Bacteria 61761
146 Ga0209281_1008199 3300027111 Bacteria 2558
147 Ga0209281_1027375 3300027111 Bacteria 1045
148 Ga0209970_1002684 3300027614 Bacteria 3012
149 Ga0209588_1019099 3300027671 Bacteria 2138
150 Ga0207428_10658161 3300027907 Bacteria 751
151 Ga0268266_10555901 3300028379 Bacteria 1100
152 Ga0268265_10241703 3300028380 Bacteria 1594
153 Ga0265334_10043783 3300028573 Bacteria 1741
154 Ga0311000_121821 3300029272 Bacteria 1739
155 Ga0311008_105417 3300029273 Bacteria 1160
156 Ga0311011_144096 3300029280 Bacteria 1125
157 Ga0316176_1026675 3300030732 Bacteria 1253
158 Ga0265327_10057128 3300031251 Bacteria 2008
159 Ga0265327_10094537 3300031251 Bacteria 1452
160 Ga0307408_100017547 3300031548 Bacteria 4790
161 Ga0307408_100028935 3300031548 Bacteria 3833
162 Ga0316579_10073769 3300031691 Bacteria 1619
163 Ga0316576_10025195 3300031727 Bacteria 4161
164 Ga0316578_10037404 3300031728 Bacteria 2796
165 Ga0307405_10021522 3300031731 Bacteria 3627
166 Ga0307405_10215272 3300031731 Bacteria 1406
167 Ga0316577_10048191 3300031733 Bacteria 2380
168 Ga0307407_10029070 3300031903 Bacteria 2964
169 Ga0307412_10505837 3300031911 Bacteria 1007
170 Ga0307409_100018876 3300031995 Bacteria 4652
171 Ga0307409_100071775 3300031995 Bacteria 2754
172 Ga0307409_100088345 3300031995 Bacteria 2530
173 Ga0307416_100018258 3300032002 Bacteria 4936
174 Ga0307416_100044091 3300032002 Bacteria 3498
175 Ga0307416_100078459 3300032002 Bacteria 2778
176 Ga0307416_100198442 3300032002 Bacteria 1901
177 Ga0316583_10023640 3300032133 Bacteria 2195
178 Ga0316593_10087435 3300032168 Bacteria 1094
179 Ga0316596_1014855 3300033541 Bacteria 1936
180 Ga0373956_0164319 3300035119 Bacteria 1047
181 Ga0373946_0074711 3300035171 Bacteria 1472
182 Ga0316574_0071026 3300035398 Bacteria 2198
183 Ga0373933_0064935 3300035724 Bacteria 2209
184 Ga0373937_0035502 3300036401 Bacteria 4538
185 Ga0373937_0112227 3300036401 Bacteria 2536
186 Ga0373937_0305712 3300036401 Bacteria 1504
187 Ga0373937_0931437 3300036401 Bacteria 818
188 Ga0316584_0056348 3300036712 Bacteria 2942
189 Ga0395901_0400270 3300038443 Bacteria 1411
190 Ga0436363_0569927 3300039450 Bacteria 1027
191 Ga0451837_1797435 3300041494 Bacteria 1347
192 Ga0451849_1220464 3300041505 Bacteria 898
193 Ga0439432_084115 3300042006 Bacteria 962
194 Ga0439434_0016420 3300042435 Bacteria 2212
195 Ga0451577_0000006 3300042876 Bacteria 709265
196 Ga0451577_0003986 3300042876 Bacteria 15905
197 Ga0451577_0013644 3300042876 Bacteria 7597
198 Ga0451577_0044106 3300042876 Bacteria 3992
199 Ga0451577_0049529 3300042876 Bacteria 3751
200 Ga0451577_0406614 3300042876 Bacteria 1235
201 Ga0453683_0000088 3300044673 Bacteria 138620
202 Ga0453683_0054407 3300044673 Bacteria 2504
203 Ga0453683_0060221 3300044673 Bacteria 2374
204 Ga0453683_0061026 3300044673 Bacteria 2358
205 Ga0453683_0120787 3300044673 Bacteria 1649
206 Ga0453684_0000037 3300044712 Bacteria 709327
207 Ga0453684_0014172 3300044712 Bacteria 12805
208 Ga0453684_0041342 3300044712 Bacteria 6238
209 Ga0453684_0084669 3300044712 Bacteria 3942
210 Ga0453684_0111896 3300044712 Bacteria 3315
211 Ga0453684_0354000 3300044712 Bacteria 1655
212 Ga0451576_0005544 3300045051 Bacteria 15765
213 Ga0451576_0046384 3300045051 Bacteria 4576
214 Ga0451576_0047429 3300045051 Bacteria 4517
215 Ga0451576_0125712 3300045051 Bacteria 2672
216 Ga0451576_0132882 3300045051 Bacteria 2594
217 Ga0451576_0167626 3300045051 Bacteria 2292
218 Ga0466967_0495836 3300045976 Bacteria 1198
219 Ga0495592_0070640 3300046454 Bacteria 2543
220 Ga0495603_0087286 3300046455 Bacteria 1825
221 Ga0495591_045300 3300046458 Bacteria 1227
222 Ga0495629_0172448 3300046459 Bacteria 1501
223 Ga0495653_0067992 3300046463 Bacteria 2673
224 Ga0495653_0084133 3300046463 Bacteria 2344
225 Ga0495653_0163694 3300046463 Bacteria 1542
226 Ga0495582_0145586 3300046473 Bacteria 1344
227 Ga0495582_0298656 3300046473 Bacteria 926
228 Ga0495605_0031123 3300046474 Bacteria 2728
229 Ga0495664_0051180 3300046477 Bacteria 2453
230 Ga0495584_0010128 3300046491 Bacteria 4842
231 Ga0495585_0012105 3300046492 Bacteria 5090
232 Ga0495608_0064181 3300046511 Bacteria 2408
233 Ga0495608_0110656 3300046511 Bacteria 1766
234 Ga0495608_0195916 3300046511 Bacteria 1274
235 Ga0495618_0063017 3300046514 Bacteria 2353
236 Ga0495620_0007139 3300046515 Bacteria 6087
237 Ga0495620_0067795 3300046515 Bacteria 1467
238 Ga0495628_0038439 3300046516 Bacteria 3831
239 Ga0495630_0058372 3300046517 Bacteria 2893
240 Ga0495630_0063945 3300046517 Bacteria 2764
241 Ga0495630_0266288 3300046517 Bacteria 1309
242 Ga0495630_0307226 3300046517 Bacteria 1212
243 Ga0495666_0018757 3300046526 Bacteria 3437
244 Ga0495654_0060239 3300046530 Bacteria 1825
245 Ga0495654_0110322 3300046530 Bacteria 1256
246 Ga0495654_0139995 3300046530 Bacteria 1079
247 Ga0495640_0098790 3300046533 Bacteria 1918
248 Ga0495640_0102471 3300046533 Bacteria 1878
249 Ga0495640_0185275 3300046533 Bacteria 1325
250 Ga0495645_0170033 3300046543 Bacteria 1501
251 Ga0495622_0014485 3300046557 Bacteria 3662
252 Ga0495622_0018727 3300046557 Bacteria 3224
253 Ga0495622_0173473 3300046557 Bacteria 969
254 Ga0495633_0262847 3300046558 Bacteria 786
255 Ga0495634_0021845 3300046642 Bacteria 4516
256 Ga0495634_0079214 3300046642 Bacteria 2152
257 Ga0495611_0277620 3300046648 Bacteria 774
258 Ga0495635_0220469 3300046663 Bacteria 1283
259 Ga0495635_0407410 3300046663 Bacteria 903
260 Ga0495661_0071169 3300046665 Bacteria 2033
261 Ga0495661_0090130 3300046665 Bacteria 1746
262 Ga0495661_0100675 3300046665 Bacteria 1627
263 Ga0495661_0193121 3300046665 Bacteria 1071
264 Ga0495657_0057798 3300046675 Bacteria 2578
265 Ga0495657_0194364 3300046675 Bacteria 1239
266 Ga0495658_0135894 3300046683 Bacteria 1500
267 Ga0495613_0001886 3300046689 Bacteria 15917
268 Ga0495613_0113102 3300046689 Bacteria 1955
269 Ga0495624_0316939 3300046690 Bacteria 939
270 Ga0495660_0031747 3300046810 Bacteria 2968
271 Ga0495672_0007452 3300047320 Bacteria 8231
272 Ga0495676_0059397 3300047321 Bacteria 3003
273 Ga0495676_0096860 3300047321 Bacteria 2192
274 Ga0495676_0183628 3300047321 Bacteria 1464
275 Ga0495680_0132020 3300047322 Bacteria 1834
276 Ga0495683_0040440 3300047323 Bacteria 2356
277 Ga0495675_0065031 3300047444 Bacteria 2307
278 Ga0495684_0117934 3300047471 Bacteria 2000
279 Ga0495684_0196949 3300047471 Bacteria 1487
280 Ga0495684_0415683 3300047471 Bacteria 941
281 Ga0495602_0168676 3300048088 Bacteria 1701
282 Ga0495614_0010194 3300048089 Bacteria 4144
283 Ga0495626_0079304 3300048091 Bacteria 1461
284 Ga0496100_0005282 3300048903 Bacteria 6938
285 Ga0496100_0024474 3300048903 Bacteria 3684
286 Ga0496100_0160296 3300048903 Bacteria 1612
287 Ga0496101_0110123 3300048904 Bacteria 2072
288 Ga0496101_0228242 3300048904 Bacteria 1447
289 Ga0496102_0010275 3300048905 Bacteria 8048
290 Ga0496102_0270627 3300048905 Bacteria 1602
291 Ga0496102_0389929 3300048905 Bacteria 1310
292 Ga0496102_0485597 3300048905 Bacteria 1157
293 Ga0496102_0573952 3300048905 Bacteria 1051
294 Ga0496103_0001500 3300048906 Bacteria 15621
295 Ga0496104_0001186 3300048907 Bacteria 22389
296 Ga0496104_0187871 3300048907 Bacteria 1977
297 Ga0496104_0876139 3300048907 Bacteria 803
298 Ga0496105_0000964 3300048908 Bacteria 19760
299 Ga0496105_0053016 3300048908 Bacteria 3350
300 Ga0496105_0248853 3300048908 Bacteria 1440
301 Ga0496106_0000361 3300048909 Bacteria 32313
302 Ga0496106_0476293 3300048909 Bacteria 1003
303 Ga0496107_0000282 3300048910 Bacteria 26883
304 Ga0496108_0000443 3300048911 Bacteria 33208
305 Ga0496109_0000778 3300048912 Bacteria 26502
306 Ga0496109_0013733 3300048912 Bacteria 7037
307 Ga0496109_0827626 3300048912 Bacteria 864
308 Ga0496110_0002382 3300048913 Bacteria 14089
309 Ga0496110_0117605 3300048913 Bacteria 2394
310 Ga0496111_0000191 3300048914 Bacteria 28382
311 Ga0496111_0206802 3300048914 Bacteria 1459
312 Ga0496112_0006179 3300048915 Bacteria 10476
313 Ga0496112_0251313 3300048915 Bacteria 1719
314 Ga0496113_0001366 3300048916 Bacteria 13528
315 Ga0496113_0113068 3300048916 Bacteria 2116
316 Ga0496113_0364520 3300048916 Bacteria 1159
317 Ga0496114_0113786 3300048917 Bacteria 2320
318 Ga0496116_0001671 3300048919 Bacteria 24360
319 Ga0496117_0022031 3300048920 Bacteria 5124
320 Ga0496119_0005613 3300048922 Bacteria 11930
321 Ga0496120_0007962 3300048923 Bacteria 7802
322 Ga0496122_0013343 3300048925 Bacteria 8048
323 Ga0496122_0022454 3300048925 Bacteria 5608
324 Ga0496123_0004637 3300048926 Bacteria 14282
325 Ga0496125_0004215 3300048928 Bacteria 16755
326 Ga0496126_0004639 3300048929 Bacteria 16261
327 Ga0496126_0005295 3300048929 Bacteria 14809
328 Ga0501306_000031 3300049127 Bacteria 7963
329 Ga0501306_000487 3300049127 Bacteria 3061
330 Ga0501306_000497 3300049127 Bacteria 3050
331 Ga0501306_000655 3300049127 Bacteria 2790
332 Ga0501306_000823 3300049127 Bacteria 2631
333 Ga0501306_001717 3300049127 Bacteria 2125
334 Ga0501306_002383 3300049127 Bacteria 1920
335 Ga0501306_002549 3300049127 Bacteria 1881
336 Ga0501306_002657 3300049127 Bacteria 1858
337 Ga0501308_000210 3300049128 Bacteria 3315
338 Ga0501308_000287 3300049128 Bacteria 3046
339 Ga0501308_001173 3300049128 Bacteria 2022
340 Ga0501308_001828 3300049128 Bacteria 1778
341 Ga0501308_003751 3300049128 Bacteria 1427
342 Ga0501308_005283 3300049128 Bacteria 1280
343 Ga0501309_000397 3300049129 Bacteria 3395
344 Ga0501309_000721 3300049129 Bacteria 2871
345 Ga0501309_001124 3300049129 Bacteria 2506
346 Ga0501309_001463 3300049129 Bacteria 2329
347 Ga0501309_010685 3300049129 Bacteria 1187
348 Ga0501310_000371 3300049130 Bacteria 4033
349 Ga0501310_000609 3300049130 Bacteria 3152
350 Ga0501310_001129 3300049130 Bacteria 2402
351 Ga0501310_002486 3300049130 Bacteria 1754
352 Ga0501341_00107 3300049131 Bacteria 2594
353 Ga0501341_00208 3300049131 Bacteria 2141
354 Ga0501341_00221 3300049131 Bacteria 2117
355 Ga0501341_00334 3300049131 Bacteria 1872
356 Ga0501341_00436 3300049131 Bacteria 1746
357 Ga0501341_05480 3300049131 Bacteria 761
358 Ga0501343_000282 3300049132 Bacteria 2803
359 Ga0501343_000822 3300049132 Bacteria 1952
360 Ga0501343_001772 3300049132 Bacteria 1489
361 Ga0501343_005673 3300049132 Bacteria 962
362 Ga0501344_00106 3300049133 Bacteria 2723
363 Ga0501344_00120 3300049133 Bacteria 2644
364 Ga0501344_00965 3300049133 Bacteria 1323
365 Ga0501345_00054 3300049134 Bacteria 2678
366 Ga0501304_000742 3300049160 Bacteria 1845
367 Ga0501304_001331 3300049160 Bacteria 1566
368 Ga0501304_002229 3300049160 Bacteria 1330
369 Ga0501305_000002 3300049161 Bacteria 17524
370 Ga0501305_000036 3300049161 Bacteria 7597
371 Ga0501305_000182 3300049161 Bacteria 4371
372 Ga0501305_000320 3300049161 Bacteria 3757
373 Ga0501305_000675 3300049161 Bacteria 2932
374 Ga0501305_000790 3300049161 Bacteria 2796
375 Ga0501305_001538 3300049161 Bacteria 2283
376 Ga0501305_002447 3300049161 Bacteria 2004
377 Ga0501305_002739 3300049161 Bacteria 1933
378 Ga0501305_003224 3300049161 Bacteria 1834
379 Ga0501305_006283 3300049161 Bacteria 1470
380 Ga0501305_024578 3300049161 Bacteria 909
381 Ga0501307_000012 3300049162 Bacteria 6382
382 Ga0501307_000146 3300049162 Bacteria 3691
383 Ga0501307_000209 3300049162 Bacteria 3392
384 Ga0501307_000398 3300049162 Bacteria 2879
385 Ga0501307_000466 3300049162 Bacteria 2738
386 Ga0501307_000679 3300049162 Bacteria 2494
387 Ga0501307_002114 3300049162 Bacteria 1809
388 Ga0501342_00058 3300049163 Bacteria 2302
389 Ga0501311_000004 3300049527 Bacteria 9566
390 Ga0501311_000007 3300049527 Bacteria 8668
391 Ga0501311_000810 3300049527 Bacteria 2422
392 Ga0501311_001097 3300049527 Bacteria 2240
393 Ga0501311_001468 3300049527 Bacteria 2058
394 Ga0501311_002237 3300049527 Bacteria 1825
395 Ga0501312_000003 3300049528 Bacteria 16850
396 Ga0501312_000006 3300049528 Bacteria 10477
397 Ga0501312_000567 3300049528 Bacteria 3090
398 Ga0501312_000589 3300049528 Bacteria 3053
399 Ga0501312_000598 3300049528 Bacteria 3037
400 Ga0501312_000704 3300049528 Bacteria 2870
401 Ga0501312_000761 3300049528 Bacteria 2807
402 Ga0501312_000887 3300049528 Bacteria 2696
403 Ga0501312_004363 3300049528 Bacteria 1663
404 Ga0501313_000017 3300049529 Bacteria 8074
405 Ga0501313_000080 3300049529 Bacteria 4457
406 Ga0501313_000518 3300049529 Bacteria 2688
407 Ga0501313_000585 3300049529 Bacteria 2623
408 Ga0501313_001232 3300049529 Bacteria 2150
409 Ga0501313_001631 3300049529 Bacteria 2004
410 Ga0501313_006310 3300049529 Bacteria 1281
411 Ga0501313_006820 3300049529 Bacteria 1246
412 Ga0501314_000256 3300049530 Bacteria 3073
413 Ga0501314_000364 3300049530 Bacteria 2732
414 Ga0501314_000376 3300049530 Bacteria 2713
415 Ga0501314_000408 3300049530 Bacteria 2651
416 Ga0501314_000534 3300049530 Bacteria 2405
417 Ga0501314_000966 3300049530 Bacteria 1949
418 Ga0501314_001086 3300049530 Bacteria 1884
419 Ga0501315_000019 3300049531 Bacteria 7980
420 Ga0501315_000121 3300049531 Bacteria 4217
421 Ga0501315_000389 3300049531 Bacteria 2964
422 Ga0501315_000420 3300049531 Bacteria 2887
423 Ga0501315_000455 3300049531 Bacteria 2824
424 Ga0501315_001280 3300049531 Bacteria 2101
425 Ga0501315_001361 3300049531 Bacteria 2067
426 Ga0501315_002350 3300049531 Bacteria 1765
427 Ga0501316_000029 3300049532 Bacteria 5933
428 Ga0501316_000057 3300049532 Bacteria 4894
429 Ga0501316_000077 3300049532 Bacteria 4588
430 Ga0501316_000101 3300049532 Bacteria 4292
431 Ga0501316_000267 3300049532 Bacteria 3270
432 Ga0501316_000578 3300049532 Bacteria 2626
433 Ga0501316_006198 3300049532 Bacteria 1267
434 Ga0501317_000001 3300049533 Bacteria 21405
435 Ga0501317_000015 3300049533 Bacteria 8499
436 Ga0501317_000025 3300049533 Bacteria 7145
437 Ga0501317_000117 3300049533 Bacteria 4257
438 Ga0501317_000283 3300049533 Bacteria 3283
439 Ga0501317_000743 3300049533 Bacteria 2483
440 Ga0501317_001493 3300049533 Bacteria 2026
441 Ga0501318_000001 3300049534 Bacteria 17462
442 Ga0501318_000024 3300049534 Bacteria 6225
443 Ga0501318_000298 3300049534 Bacteria 2899
444 Ga0501318_000737 3300049534 Bacteria 2248
445 Ga0501318_000818 3300049534 Bacteria 2175
446 Ga0501318_001153 3300049534 Bacteria 1990
447 Ga0501318_001644 3300049534 Bacteria 1804
448 Ga0501319_000019 3300049535 Bacteria 5995
449 Ga0501319_000069 3300049535 Bacteria 3482
450 Ga0501319_000142 3300049535 Bacteria 2712
451 Ga0501320_000031 3300049536 Bacteria 7449
452 Ga0501320_000127 3300049536 Bacteria 3488
453 Ga0501320_000269 3300049536 Bacteria 2795
454 Ga0501320_000417 3300049536 Bacteria 2438
455 Ga0501320_001252 3300049536 Bacteria 1810
456 Ga0501320_011413 3300049536 Bacteria 920
457 Ga0501321_000001 3300049537 Bacteria 16207
458 Ga0501321_000032 3300049537 Bacteria 6962
459 Ga0501321_000087 3300049537 Bacteria 4286
460 Ga0501321_000347 3300049537 Bacteria 2848
461 Ga0501321_000491 3300049537 Bacteria 2548
462 Ga0501321_000499 3300049537 Bacteria 2534
463 Ga0501321_005487 3300049537 Bacteria 1256
464 Ga0501321_023432 3300049537 Bacteria 783
465 Ga0501322_000105 3300049538 Bacteria 3214
466 Ga0501322_000132 3300049538 Bacteria 2858
467 Ga0501322_000252 3300049538 Bacteria 2333
468 Ga0501322_000299 3300049538 Bacteria 2191
469 Ga0501322_000543 3300049538 Bacteria 1820
470 Ga0501322_000986 3300049538 Bacteria 1494
471 Ga0501323_000031 3300049539 Bacteria 6387
472 Ga0501323_000123 3300049539 Bacteria 4354
473 Ga0501323_000356 3300049539 Bacteria 3260
474 Ga0501323_000970 3300049539 Bacteria 2369
475 Ga0501323_001243 3300049539 Bacteria 2202
476 Ga0501323_001559 3300049539 Bacteria 2070
477 Ga0501323_001588 3300049539 Bacteria 2058
478 Ga0501323_002019 3300049539 Bacteria 1913
479 Ga0501324_000001 3300049540 Bacteria 20831
480 Ga0501324_000376 3300049540 Bacteria 2340
481 Ga0501324_000524 3300049540 Bacteria 2114
482 Ga0501324_000689 3300049540 Bacteria 1967
483 Ga0501324_000710 3300049540 Bacteria 1950
484 Ga0501324_001015 3300049540 Bacteria 1761
485 Ga0501326_00062 3300049542 Bacteria 3234
486 Ga0501326_00067 3300049542 Bacteria 3110
487 Ga0501326_00091 3300049542 Bacteria 2798
488 Ga0501326_00102 3300049542 Bacteria 2677
489 Ga0501327_00098 3300049543 Bacteria 2655
490 Ga0501327_00117 3300049543 Bacteria 2454
491 Ga0501327_01095 3300049543 Bacteria 1251
492 Ga0501328_00058 3300049544 Bacteria 2566
493 Ga0501328_00120 3300049544 Bacteria 2054
494 Ga0501328_00233 3300049544 Bacteria 1656
495 Ga0501329_00035 3300049545 Bacteria 3186
496 Ga0501330_000008 3300049546 Bacteria 6041
497 Ga0501330_000037 3300049546 Bacteria 3347
498 Ga0501330_000125 3300049546 Bacteria 2480
499 Ga0501330_000173 3300049546 Bacteria 2255
500 Ga0501330_000225 3300049546 Bacteria 2104
501 Ga0501331_00059 3300049547 Bacteria 3195
502 Ga0501332_00020 3300049548 Bacteria 4348
503 Ga0501332_00078 3300049548 Bacteria 2904
504 Ga0501332_00260 3300049548 Bacteria 2144
505 Ga0501333_000285 3300049549 Bacteria 2172
506 Ga0501333_000472 3300049549 Bacteria 1851
507 Ga0501333_000872 3300049549 Bacteria 1520
508 Ga0501334_00027 3300049550 Bacteria 4527
509 Ga0501334_00251 3300049550 Bacteria 2218
510 Ga0501335_000498 3300049551 Bacteria 2548
511 Ga0501335_001188 3300049551 Bacteria 1952
512 Ga0501335_001575 3300049551 Bacteria 1766
513 Ga0501335_001947 3300049551 Bacteria 1638
514 Ga0501335_002815 3300049551 Bacteria 1436
515 Ga0501335_003930 3300049551 Bacteria 1279
516 Ga0501335_006302 3300049551 Bacteria 1078
517 Ga0501336_000091 3300049552 Bacteria 3189
518 Ga0501337_000054 3300049553 Bacteria 3895
519 Ga0501337_000088 3300049553 Bacteria 3392
520 Ga0501337_000691 3300049553 Bacteria 1748
521 Ga0501337_000729 3300049553 Bacteria 1713
522 Ga0501338_00091 3300049554 Bacteria 2839
523 Ga0501338_00103 3300049554 Bacteria 2781
524 Ga0501338_00500 3300049554 Bacteria 1800
525 Ga0501338_00782 3300049554 Bacteria 1547
526 Ga0501338_01785 3300049554 Bacteria 1187
527 Ga0501339_00007 3300049555 Bacteria 2547
528 Ga0501340_000099 3300049556 Bacteria 2752
529 Ga0501340_000108 3300049556 Bacteria 2699
530 Ga0501340_000251 3300049556 Bacteria 2075
531 Ga0501034_0024059 3300049571 Bacteria 6197
532 Ga0501040_0350956 3300049576 Bacteria 1057
533 Ga0501041_0333186 3300049577 Bacteria 958
534 Ga0501043_0094276 3300049579 Bacteria 2353
535 Ga0501046_0049684 3300049580 Bacteria 3317
536 Ga0501047_0063124 3300049581 Bacteria 3573
537 Ga0501070_0011947 3300049586 Bacteria 7333
538 Ga0501072_0170876 3300049588 Bacteria 1735
539 Ga0501072_0209865 3300049588 Bacteria 1552
540 Ga0501072_0266591 3300049588 Bacteria 1363
541 Ga0501073_0118279 3300049589 Bacteria 1837
542 Ga0501075_0236530 3300049591 Bacteria 1393
543 Ga0501202_018425 3300049652 Bacteria 1371
544 Ga0501217_004344 3300049661 Bacteria 2908
545 Ga0501217_005351 3300049661 Bacteria 2679
546 Ga0501227_021242 3300049665 Bacteria 1496
547 Ga0501245_009931 3300049708 Bacteria 1371
548 Ga0501080_0027162 3300049742 Bacteria 5323
549 Ga0501270_001993 3300049767 Bacteria 2040
550 Ga0501212_009766 3300049851 Bacteria 1358
551 nmdc:mga00v17_13821_c1 3300050491 Bacteria 4490
552 nmdc:mga06z11_228180_c1 3300050494 Bacteria 1090
553 nmdc:mga0qj67_472396_c1 3300050509 Bacteria 1009
554 nmdc:mga06r32_62945_c1 3300050510 Bacteria 3574
555 nmdc:mga08y16_109076_c1 3300050511 Bacteria 2882
556 nmdc:mga08y16_128140_c1 3300050511 Bacteria 2640
557 nmdc:mga08y16_3103_c1 3300050511 Bacteria 17195
558 nmdc:mga0n895_950611_c1 3300050512 Bacteria 843
559 nmdc:mga0rr50_42251_c1 3300050513 Bacteria 3328
560 Ga0495601_0010480 3300053077 Bacteria 5518
561 Ga0495601_0160426 3300053077 Bacteria 1469
562 Ga0495612_0040570 3300053078 Bacteria 1897
563 Ga0495595_0020140 3300053084 Bacteria 2901
564 Ga0495619_0021877 3300053085 Bacteria 4086
565 Ga0495619_0025656 3300053085 Bacteria 3787
566 Ga0495619_0152126 3300053085 Bacteria 1596
567 Ga0495619_0296446 3300053085 Bacteria 1120
568 Ga0501084_0000009 3300054114 Bacteria 194961
569 Ga0587111_0017291 3300060346 Bacteria 1342
570 Ga0587111_0077658 3300060346 Bacteria 788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0931437 Ga0373937_0931437_18_668 202
2 3300049551 Ga0501335_001188 Ga0501335_001188_103_849 206
3 3300049554 Ga0501338_01785 Ga0501338_01785_295_921 208
4 3300009094 Ga0111539_10076046 Ga0111539_100760463 209
5 3300036401 Ga0373937_0112227 Ga0373937_0112227_1266_1979 209
6 3300049536 Ga0501320_000417 Ga0501320_000417_631_1323 209
7 3300053084 Ga0495595_0020140 Ga0495595_0020140_612_1325 209
8 3300025294 Ga0209025_1021451 Ga0209025_10214515 210
9 3300031995 Ga0307409_100018876 Ga0307409_1000188766 210
10 3300049127 Ga0501306_000655 Ga0501306_000655_905_1600 210
11 3300049129 Ga0501309_001124 Ga0501309_001124_645_1340 210
12 3300049131 Ga0501341_00208 Ga0501341_00208_467_1162 210
13 3300049161 Ga0501305_000036 Ga0501305_000036_5512_6207 210
14 3300049162 Ga0501307_000679 Ga0501307_000679_645_1340 210
15 3300049527 Ga0501311_000004 Ga0501311_000004_7946_8641 210
16 3300049528 Ga0501312_000006 Ga0501312_000006_8038_8733 210
17 3300049529 Ga0501313_000080 Ga0501313_000080_1070_1765 210
18 3300049530 Ga0501314_000376 Ga0501314_000376_633_1328 210
19 3300049531 Ga0501315_001361 Ga0501315_001361_1240_1935 210
20 3300049532 Ga0501316_000029 Ga0501316_000029_856_1551 210
21 3300049533 Ga0501317_000015 Ga0501317_000015_1237_1932 210
22 3300049534 Ga0501318_000024 Ga0501318_000024_4468_5163 210
23 3300049535 Ga0501319_000019 Ga0501319_000019_903_1598 210
24 3300049537 Ga0501321_000032 Ga0501321_000032_1473_2168 210
25 3300049538 Ga0501322_000132 Ga0501322_000132_1235_1930 210
26 3300049539 Ga0501323_000031 Ga0501323_000031_912_1607 210
27 3300049540 Ga0501324_001015 Ga0501324_001015_91_786 210
28 3300049542 Ga0501326_00091 Ga0501326_00091_894_1589 210
29 3300049543 Ga0501327_00117 Ga0501327_00117_644_1339 210
30 3300049544 Ga0501328_00120 Ga0501328_00120_818_1513 210
31 3300049546 Ga0501330_000008 Ga0501330_000008_965_1660 210
32 3300049548 Ga0501332_00020 Ga0501332_00020_2694_3389 210
33 3300049550 Ga0501334_00027 Ga0501334_00027_2971_3666 210
34 3300049554 Ga0501338_00091 Ga0501338_00091_912_1607 210
35 3300003187 JGI25151J46595_10003308 JGI25151J46595_1000330812 211
36 3300003316 rootH1_10000848 rootH1_1000084821 211
37 3300003322 rootL2_10052955 rootL2_1005295521 211
38 3300003578 Ga0006562J51391_1000046 Ga0006562J51391_100004621 211
39 3300003790 Ga0055528_1001614 Ga0055528_100161414 211
40 3300005328 Ga0070676_10006452 Ga0070676_100064522 211
41 3300005331 Ga0070670_100020078 Ga0070670_1000200784 211
42 3300005353 Ga0070669_100199350 Ga0070669_1001993501 211
43 3300005355 Ga0070671_100011607 Ga0070671_1000116074 211
44 3300005456 Ga0070678_100375143 Ga0070678_1003751432 211
45 3300005543 Ga0070672_100025082 Ga0070672_1000250826 211
46 3300005548 Ga0070665_101155262 Ga0070665_1011552621 211
47 3300006163 Ga0070715_10065228 Ga0070715_100652282 211
48 3300009036 Ga0105244_10026966 Ga0105244_100269663 211
49 3300009092 Ga0105250_10018759 Ga0105250_100187593 211
50 3300009098 Ga0105245_10129583 Ga0105245_101295833 211
51 3300009101 Ga0105247_10000354 Ga0105247_1000035451 211
52 3300009148 Ga0105243_10000301 Ga0105243_1000030150 211
53 3300009176 Ga0105242_10004076 Ga0105242_100040765 211
54 3300011119 Ga0105246_10000077 Ga0105246_1000007714 211
55 3300013296 Ga0157374_10013578 Ga0157374_100135786 211
56 3300013297 Ga0157378_10000237 Ga0157378_1000023749 211
57 3300014745 Ga0157377_10002894 Ga0157377_1000289410 211
58 3300014969 Ga0157376_10014258 Ga0157376_100142581 211
59 3300025229 Ga0209147_100806 Ga0209147_1008068 211
60 3300025273 Ga0209673_1001881 Ga0209673_100188110 211
61 3300025294 Ga0209025_1002868 Ga0209025_100286811 211
62 3300025302 Ga0207426_1008659 Ga0207426_10086595 211
63 3300025711 Ga0207696_1004774 Ga0207696_10047748 211
64 3300025728 Ga0207655_1007619 Ga0207655_10076193 211
65 3300025735 Ga0207713_1000405 Ga0207713_100040556 211
66 3300025901 Ga0207688_10121887 Ga0207688_101218871 211
67 3300025907 Ga0207645_10036479 Ga0207645_100364792 211
68 3300025923 Ga0207681_10110484 Ga0207681_101104842 211
69 3300025925 Ga0207650_10013760 Ga0207650_100137608 211
70 3300025927 Ga0207687_10095721 Ga0207687_100957213 211
71 3300025931 Ga0207644_10001801 Ga0207644_100018017 211
72 3300025934 Ga0207686_10004946 Ga0207686_1000494610 211
73 3300025935 Ga0207709_10000416 Ga0207709_1000041654 211
74 3300025940 Ga0207691_10039329 Ga0207691_100393294 211
75 3300029272 Ga0311000_121821 Ga0311000_1218212 211
76 3300029273 Ga0311008_105417 Ga0311008_1054172 211
77 3300031548 Ga0307408_100028935 Ga0307408_1000289351 211
78 3300031995 Ga0307409_100088345 Ga0307409_1000883452 211
79 3300032002 Ga0307416_100044091 Ga0307416_1000440913 211
80 3300046455 Ga0495603_0087286 Ga0495603_0087286_102_797 211
81 3300046491 Ga0495584_0010128 Ga0495584_0010128_3699_4394 211
82 3300046492 Ga0495585_0012105 Ga0495585_0012105_2991_3686 211
83 3300046557 Ga0495622_0014485 Ga0495622_0014485_2318_3013 211
84 3300046558 Ga0495633_0262847 Ga0495633_0262847_56_751 211
85 3300046648 Ga0495611_0277620 Ga0495611_0277620_54_749 211
86 3300046665 Ga0495661_0071169 Ga0495661_0071169_45_740 211
87 3300047321 Ga0495676_0059397 Ga0495676_0059397_1025_1720 211
88 3300047323 Ga0495683_0040440 Ga0495683_0040440_1199_1894 211
89 3300048903 Ga0496100_0005282 Ga0496100_0005282_4532_5227 211
90 3300048905 Ga0496102_0010275 Ga0496102_0010275_5642_6337 211
91 3300048905 Ga0496102_0389929 Ga0496102_0389929_307_1005 211
92 3300048906 Ga0496103_0001500 Ga0496103_0001500_5770_6465 211
93 3300048907 Ga0496104_0001186 Ga0496104_0001186_8025_8720 211
94 3300048908 Ga0496105_0000964 Ga0496105_0000964_18212_18907 211
95 3300048909 Ga0496106_0000361 Ga0496106_0000361_18211_18906 211
96 3300048910 Ga0496107_0000282 Ga0496107_0000282_8016_8711 211
97 3300048911 Ga0496108_0000443 Ga0496108_0000443_28101_28796 211
98 3300048912 Ga0496109_0000778 Ga0496109_0000778_435_1130 211
99 3300048913 Ga0496110_0002382 Ga0496110_0002382_8863_9558 211
100 3300048914 Ga0496111_0000191 Ga0496111_0000191_25814_26509 211
101 3300048915 Ga0496112_0006179 Ga0496112_0006179_563_1258 211
102 3300048916 Ga0496113_0001366 Ga0496113_0001366_8174_8869 211
103 3300048919 Ga0496116_0001671 Ga0496116_0001671_5281_5976 211
104 3300048920 Ga0496117_0022031 Ga0496117_0022031_590_1285 211
105 3300048922 Ga0496119_0005613 Ga0496119_0005613_5211_5906 211
106 3300048923 Ga0496120_0007962 Ga0496120_0007962_1156_1851 211
107 3300048925 Ga0496122_0013343 Ga0496122_0013343_1712_2407 211
108 3300048926 Ga0496123_0004637 Ga0496123_0004637_3028_3723 211
109 3300048928 Ga0496125_0004215 Ga0496125_0004215_4422_5117 211
110 3300048929 Ga0496126_0005295 Ga0496126_0005295_5243_5938 211
111 3300049127 Ga0501306_000031 Ga0501306_000031_5435_6130 211
112 3300049128 Ga0501308_003751 Ga0501308_003751_644_1339 211
113 3300049129 Ga0501309_000397 Ga0501309_000397_1450_2145 211
114 3300049130 Ga0501310_000609 Ga0501310_000609_1373_2068 211
115 3300049132 Ga0501343_000282 Ga0501343_000282_1262_1957 211
116 3300049161 Ga0501305_000002 Ga0501305_000002_14314_15009 211
117 3300049162 Ga0501307_000146 Ga0501307_000146_1836_2531 211
118 3300049527 Ga0501311_000007 Ga0501311_000007_5452_6147 211
119 3300049528 Ga0501312_000003 Ga0501312_000003_13634_14329 211
120 3300049529 Ga0501313_000017 Ga0501313_000017_5546_6241 211
121 3300049530 Ga0501314_000256 Ga0501314_000256_1241_1936 211
122 3300049531 Ga0501315_000019 Ga0501315_000019_5452_6147 211
123 3300049532 Ga0501316_000077 Ga0501316_000077_2529_3224 211
124 3300049533 Ga0501317_000001 Ga0501317_000001_18877_19572 211
125 3300049534 Ga0501318_000001 Ga0501318_000001_14252_14947 211
126 3300049535 Ga0501319_000069 Ga0501319_000069_1551_2246 211
127 3300049536 Ga0501320_000031 Ga0501320_000031_5486_6181 211
128 3300049537 Ga0501321_000001 Ga0501321_000001_1879_2574 211
129 3300049538 Ga0501322_000105 Ga0501322_000105_1289_1984 211
130 3300049539 Ga0501323_000123 Ga0501323_000123_2552_3247 211
131 3300049540 Ga0501324_000001 Ga0501324_000001_18891_19586 211
132 3300049542 Ga0501326_00067 Ga0501326_00067_1170_1865 211
133 3300049544 Ga0501328_00233 Ga0501328_00233_843_1538 211
134 3300049546 Ga0501330_000037 Ga0501330_000037_1293_1988 211
135 3300049551 Ga0501335_001947 Ga0501335_001947_830_1525 211
136 3300049554 Ga0501338_00103 Ga0501338_00103_1231_1926 211
137 3300049588 Ga0501072_0209865 Ga0501072_0209865_312_1007 211
138 3300049661 Ga0501217_004344 Ga0501217_004344_1403_2098 211
139 3300049131 Ga0501341_00107 Ga0501341_00107_1246_1944 212
140 3300049553 Ga0501337_000691 Ga0501337_000691_177_875 212
141 3300007076 Ga0075435_100148690 Ga0075435_1001486903 215
142 3300050513 nmdc:mga0rr50_42251_c1 nmdc:mga0rr50_42251_c1_1695_2408 215
143 3300046663 Ga0495635_0220469 Ga0495635_0220469_374_1087 216
144 3300047321 Ga0495676_0183628 Ga0495676_0183628_28_738 216
145 3300035398 Ga0316574_0071026 Ga0316574_0071026_110_805 219
146 3300049127 Ga0501306_002549 Ga0501306_002549_92_790 220
147 3300049131 Ga0501341_00221 Ga0501341_00221_121_825 220
148 3300049132 Ga0501343_005673 Ga0501343_005673_36_776 220
149 3300049161 Ga0501305_000675 Ga0501305_000675_1012_1752 220
150 3300049161 Ga0501305_001538 Ga0501305_001538_810_1550 220
151 3300049162 Ga0501307_000012 Ga0501307_000012_127_825 220
152 3300049528 Ga0501312_000567 Ga0501312_000567_1182_1880 220
153 3300049529 Ga0501313_001232 Ga0501313_001232_72_812 220
154 3300049530 Ga0501314_000966 Ga0501314_000966_1176_1880 220
155 3300049531 Ga0501315_000389 Ga0501315_000389_1550_2254 220
156 3300049532 Ga0501316_000267 Ga0501316_000267_1196_1936 220
157 3300049533 Ga0501317_000117 Ga0501317_000117_1176_1916 220
158 3300049537 Ga0501321_000491 Ga0501321_000491_729_1427 220
159 3300049538 Ga0501322_000252 Ga0501322_000252_1161_1859 220
160 3300049539 Ga0501323_002019 Ga0501323_002019_53_793 220
161 3300005456 Ga0070678_100316314 Ga0070678_1003163141 222
162 3300013297 Ga0157378_10066150 Ga0157378_100661505 222
163 3300022467 Ga0224712_10011825 Ga0224712_100118253 222
164 3300046459 Ga0495629_0172448 Ga0495629_0172448_599_1309 222
165 3300046463 Ga0495653_0084133 Ga0495653_0084133_512_1222 222
166 3300046473 Ga0495582_0145586 Ga0495582_0145586_139_855 222
167 3300046473 Ga0495582_0298656 Ga0495582_0298656_32_742 222
168 3300046511 Ga0495608_0110656 Ga0495608_0110656_835_1545 222
169 3300046517 Ga0495630_0307226 Ga0495630_0307226_386_1096 222
170 3300046689 Ga0495613_0113102 Ga0495613_0113102_1024_1734 222
171 3300047471 Ga0495684_0415683 Ga0495684_0415683_56_766 222
172 3300048088 Ga0495602_0168676 Ga0495602_0168676_225_935 222
173 3300048089 Ga0495614_0010194 Ga0495614_0010194_2165_2881 222
174 3300053085 Ga0495619_0025656 Ga0495619_0025656_2927_3637 222
175 3300047321 Ga0495676_0096860 Ga0495676_0096860_1180_1878 223
176 iso_pu_bacteria 8007375930 8007379869 224
177 3300049530 Ga0501314_000364 Ga0501314_000364_758_1498 225
178 3300049539 Ga0501323_000356 Ga0501323_000356_1375_2115 225
179 3300049556 Ga0501340_000099 Ga0501340_000099_629_1369 225
180 iso_pu_bacteria 2818991441 2819571014 225
181 iso_pu_bacteria 3001267043 3001271854 225
182 iso_pu_bacteria 3001272096 3001275940 225
183 iso_pu_bacteria 3006988479 3006993231 225
184 3300049528 Ga0501312_000589 Ga0501312_000589_1133_1831 226
185 iso_pu_bacteria 2554235469 2556065810 226
186 iso_pu_bacteria 2600255229 2601444987 226
187 iso_pu_bacteria 2711768088 2712198852 226
188 iso_pu_bacteria 2816332186 2816866395 226
189 iso_pu_bacteria 2842682962 2842688259 226
190 iso_pu_bacteria 2849139964 2849144953 226
191 iso_pu_bacteria 2857581216 2857586499 226
192 iso_pu_bacteria 3006969106 3006973796 226
193 3300005290 Ga0065712_10189397 Ga0065712_101893971 227
194 3300005366 Ga0070659_100814034 Ga0070659_1008140341 227
195 3300005456 Ga0070678_100272510 Ga0070678_1002725102 227
196 3300006844 Ga0075428_100063863 Ga0075428_1000638634 227
197 3300009094 Ga0111539_11101146 Ga0111539_111011462 227
198 3300026023 Ga0207677_10465257 Ga0207677_104652572 227
199 3300026118 Ga0207675_100087087 Ga0207675_1000870874 227
200 3300026121 Ga0207683_10249025 Ga0207683_102490252 227
201 3300027907 Ga0207428_10658161 Ga0207428_106581611 227
202 3300030732 Ga0316176_1026675 Ga0316176_10266752 227
203 3300044673 Ga0453683_0060221 Ga0453683_0060221_844_1527 227
204 3300048905 Ga0496102_0485597 Ga0496102_0485597_424_1107 227
205 3300050511 nmdc:mga08y16_109076_c1 nmdc:mga08y16_109076_c1_2177_2860 227
206 iso_pu_bacteria 2599185353 2600199857 227
207 iso_pu_bacteria 2600254943 2600402889 227
208 iso_pu_bacteria 2643221731 2644721357 227
209 iso_pu_bacteria 2643221732 2644723342 227
210 iso_pu_bacteria 2671180330 2672333572 227
211 iso_pu_bacteria 2818991465 2819711982 227
212 iso_pu_bacteria 2842882022 2842887740 227
213 iso_pu_bacteria 2904524088 2904530150 227
214 iso_pu_bacteria 2919143609 2919149619 227
215 iso_pu_bacteria 2919517244 2919523208 227
216 iso_pu_bacteria 2919720352 2919726429 227
217 iso_pu_bacteria 2928093941 2928099898 227
218 iso_pu_bacteria 2929004312 2929009919 227
219 iso_pu_bacteria 2960319331 2960324300 227
220 iso_pu_bacteria 2960375949 2960378877 227
221 iso_pu_bacteria 8022893055 8022893418 227
222 iso_pu_bacteria 8022914991 8022917932 227
223 3300006946 Ga0079104_1001572 Ga0079104_10015726 228
224 3300006946 Ga0079104_1009498 Ga0079104_10094982 228
225 3300027111 Ga0209281_1000059 Ga0209281_100005937 228
226 3300027111 Ga0209281_1000435 Ga0209281_100043538 228
227 3300027111 Ga0209281_1008199 Ga0209281_10081992 228
228 3300027111 Ga0209281_1027375 Ga0209281_10273751 228
229 3300032168 Ga0316593_10087435 Ga0316593_100874352 228
230 3300042876 Ga0451577_0044106 Ga0451577_0044106_1176_1865 228
231 3300044673 Ga0453683_0061026 Ga0453683_0061026_602_1291 228
232 3300044712 Ga0453684_0354000 Ga0453684_0354000_475_1164 228
233 3300045051 Ga0451576_0046384 Ga0451576_0046384_3158_3847 228
234 3300045051 Ga0451576_0125712 Ga0451576_0125712_1865_2554 228
235 3300046458 Ga0495591_045300 Ga0495591_045300_52_741 228
236 3300046515 Ga0495620_0007139 Ga0495620_0007139_3774_4463 228
237 3300046515 Ga0495620_0067795 Ga0495620_0067795_100_789 228
238 3300046517 Ga0495630_0266288 Ga0495630_0266288_582_1268 228
239 3300046530 Ga0495654_0060239 Ga0495654_0060239_721_1410 228
240 3300046530 Ga0495654_0110322 Ga0495654_0110322_203_892 228
241 3300047320 Ga0495672_0007452 Ga0495672_0007452_3674_4363 228
242 3300048925 Ga0496122_0022454 Ga0496122_0022454_3108_3797 228
243 3300048929 Ga0496126_0004639 Ga0496126_0004639_2321_3010 228
244 iso_pu_bacteria 2511231119 2511697986 228
245 iso_pu_bacteria 2540341094 2540605210 228
246 iso_pu_bacteria 2545555800 2545559776 228
247 iso_pu_bacteria 2554235283 2555470864 228
248 iso_pu_bacteria 2576861599 2578930732 228
249 iso_pu_bacteria 2630968484 2631982480 228
250 iso_pu_bacteria 2643221735 2644741844 228
251 iso_pu_bacteria 2648501850 2651530344 228
252 iso_pu_bacteria 2671180844 2674421101 228
253 iso_pu_bacteria 2684623153 2686995308 228
254 iso_pu_bacteria 2687453109 2687496557 228
255 iso_pu_bacteria 2695420354 2695629905 228
256 iso_pu_bacteria 2716884898 2717918195 228
257 iso_pu_bacteria 2738541295 2738817086 228
258 iso_pu_bacteria 2738541299 2738838978 228
259 iso_pu_bacteria 2738543010 2739234652 228
260 iso_pu_bacteria 2788500588 2791215898 228
261 iso_pu_bacteria 2808606399 2809057202 228
262 iso_pu_bacteria 2811994870 2812314447 228
263 iso_pu_bacteria 2816332295 2817478174 228
264 iso_pu_bacteria 2818991451 2819627568 228
265 iso_pu_bacteria 2818991468 2819726084 228
266 iso_pu_bacteria 2823526263 2823526400 228
267 iso_pu_bacteria 2852673933 2852676601 228
268 iso_pu_bacteria 2860837431 2860837564 228
269 iso_pu_bacteria 2877768649 2877768783 228
270 iso_pu_bacteria 2880169592 2880169725 228
271 iso_pu_bacteria 2881644220 2881646618 228
272 iso_pu_bacteria 2897109615 2897109752 228
273 iso_pu_bacteria 2904560550 2904564574 228
274 iso_pu_bacteria 2904606771 2904610110 228
275 iso_pu_bacteria 2908665501 2908669335 228
276 iso_pu_bacteria 2919093281 2919097093 228
277 iso_pu_bacteria 2919414237 2919419338 228
278 iso_pu_bacteria 2919726948 2919730750 228
279 iso_pu_bacteria 2928510474 2928513064 228
280 iso_pu_bacteria 2936361878 2936363677 228
281 iso_pu_bacteria 2939593269 2939596162 228
282 iso_pu_bacteria 2954773129 2954776096 228
283 iso_pu_bacteria 2962290636 2962290775 228
284 iso_pu_bacteria 2969136845 2969136982 228
285 iso_pu_bacteria 2969141011 2969141151 228
286 iso_pu_bacteria 2969765954 2969766269 228
287 iso_pu_bacteria 2969770375 2969774937 228
288 iso_pu_bacteria 2971893375 2971893512 228
289 iso_pu_bacteria 2977254563 2977254710 228
290 iso_pu_bacteria 2980492589 2980492726 228
291 iso_pu_bacteria 2990275345 2990275713 228
292 iso_pu_bacteria 3001892409 3001898811 228
293 iso_pu_bacteria 3006858327 3006858502 228
294 iso_pu_bacteria 3006879489 3006883613 228
295 iso_pu_bacteria 3006973921 3006978373 228
296 iso_pu_bacteria 3006984091 3006988366 228
297 iso_pu_bacteria 8022630665 8022631656 228
298 iso_pu_bacteria 8051952484 8051956495 228
299 iso_pu_bacteria 8052174270 8052174971 228
300 iso_pu_bacteria 8054280661 8054282848 228
301 iso_pu_bacteria 8055531788 8055537116 228
302 iso_pu_bacteria 8057632132 8057632267 228
303 3300038443 Ga0395901_0400270 Ga0395901_0400270_269_1003 229
304 3300049577 Ga0501041_0333186 Ga0501041_0333186_83_775 229
305 3300005331 Ga0070670_100560597 Ga0070670_1005605972 230
306 3300005356 Ga0070674_100570710 Ga0070674_1005707101 230
307 3300005844 Ga0068862_100128838 Ga0068862_1001288384 230
308 3300006881 Ga0068865_100450720 Ga0068865_1004507202 230
309 3300025937 Ga0207669_10475814 Ga0207669_104758141 230
310 3300026089 Ga0207648_10068016 Ga0207648_100680165 230
311 3300026121 Ga0207683_10206718 Ga0207683_102067181 230
312 3300027614 Ga0209970_1002684 Ga0209970_10026844 230
313 3300028380 Ga0268265_10241703 Ga0268265_102417031 230
314 3300031251 Ga0265327_10057128 Ga0265327_100571282 230
315 3300041494 Ga0451837_1797435 Ga0451837_1797435_620_1315 230
316 3300048917 Ga0496114_0113786 Ga0496114_0113786_1155_1859 230
317 3300049529 Ga0501313_006310 Ga0501313_006310_424_1116 230
318 3300049576 Ga0501040_0350956 Ga0501040_0350956_204_902 230
319 3300049591 Ga0501075_0236530 Ga0501075_0236530_526_1224 230
320 3300050494 nmdc:mga06z11_228180_c1 nmdc:mga06z11_228180_c1_63_761 230
321 3300060346 Ga0587111_0017291 Ga0587111_0017291_335_1027 230
322 3300060346 Ga0587111_0077658 Ga0587111_0077658_34_726 230
323 3300005290 Ga0065712_10079230 Ga0065712_100792303 231
324 3300005293 Ga0065715_10190587 Ga0065715_101905872 231
325 3300005328 Ga0070676_10240833 Ga0070676_102408332 231
326 3300005331 Ga0070670_100019013 Ga0070670_1000190137 231
327 3300005334 Ga0068869_100075173 Ga0068869_1000751733 231
328 3300005340 Ga0070689_100027530 Ga0070689_1000275303 231
329 3300005345 Ga0070692_10398912 Ga0070692_103989121 231
330 3300005354 Ga0070675_100066415 Ga0070675_1000664156 231
331 3300005354 Ga0070675_100398625 Ga0070675_1003986252 231
332 3300005365 Ga0070688_100026187 Ga0070688_1000261877 231
333 3300005441 Ga0070700_100522998 Ga0070700_1005229981 231
334 3300005445 Ga0070708_100715719 Ga0070708_1007157191 231
335 3300005459 Ga0068867_100023582 Ga0068867_1000235827 231
336 3300005466 Ga0070685_10006863 Ga0070685_100068635 231
337 3300005577 Ga0068857_100013317 Ga0068857_1000133178 231
338 3300005617 Ga0068859_100028015 Ga0068859_1000280155 231
339 3300006051 Ga0075364_10006779 Ga0075364_100067793 231
340 3300006178 Ga0075367_10195954 Ga0075367_101959541 231
341 3300006931 Ga0097620_100028015 Ga0097620_1000280154 231
342 3300009094 Ga0111539_10042697 Ga0111539_100426979 231
343 3300009148 Ga0105243_10228729 Ga0105243_102287292 231
344 3300009176 Ga0105242_10065634 Ga0105242_100656342 231
345 3300010159 Ga0099796_10025844 Ga0099796_100258442 231
346 3300013102 Ga0157371_10005050 Ga0157371_100050509 231
347 3300013308 Ga0157375_10153511 Ga0157375_101535113 231
348 3300013308 Ga0157375_10249039 Ga0157375_102490392 231
349 3300014326 Ga0157380_10046726 Ga0157380_100467267 231
350 3300025922 Ga0207646_10166025 Ga0207646_101660252 231
351 3300025923 Ga0207681_10254309 Ga0207681_102543092 231
352 3300025923 Ga0207681_10440745 Ga0207681_104407451 231
353 3300025923 Ga0207681_10527108 Ga0207681_105271081 231
354 3300025926 Ga0207659_10053626 Ga0207659_100536262 231
355 3300025926 Ga0207659_10274297 Ga0207659_102742972 231
356 3300025934 Ga0207686_10169188 Ga0207686_101691882 231
357 3300025935 Ga0207709_10374243 Ga0207709_103742432 231
358 3300025936 Ga0207670_10059001 Ga0207670_100590013 231
359 3300025937 Ga0207669_10074531 Ga0207669_100745312 231
360 3300025942 Ga0207689_10085506 Ga0207689_100855063 231
361 3300025961 Ga0207712_10048314 Ga0207712_100483143 231
362 3300025972 Ga0207668_10298490 Ga0207668_102984902 231
363 3300026067 Ga0207678_10356877 Ga0207678_103568772 231
364 3300026075 Ga0207708_10132970 Ga0207708_101329703 231
365 3300026089 Ga0207648_10033930 Ga0207648_100339307 231
366 3300026118 Ga0207675_100709680 Ga0207675_1007096802 231
367 3300031691 Ga0316579_10073769 Ga0316579_100737692 231
368 3300031727 Ga0316576_10025195 Ga0316576_100251954 231
369 3300031728 Ga0316578_10037404 Ga0316578_100374043 231
370 3300031733 Ga0316577_10048191 Ga0316577_100481913 231
371 3300032133 Ga0316583_10023640 Ga0316583_100236403 231
372 3300033541 Ga0316596_1014855 Ga0316596_10148551 231
373 3300036712 Ga0316584_0056348 Ga0316584_0056348_1102_1815 231
374 3300039450 Ga0436363_0569927 Ga0436363_0569927_228_938 231
375 3300046463 Ga0495653_0067992 Ga0495653_0067992_1618_2334 231
376 3300046514 Ga0495618_0063017 Ga0495618_0063017_1187_1903 231
377 3300046526 Ga0495666_0018757 Ga0495666_0018757_599_1315 231
378 3300046533 Ga0495640_0185275 Ga0495640_0185275_150_866 231
379 3300046675 Ga0495657_0057798 Ga0495657_0057798_852_1568 231
380 3300047322 Ga0495680_0132020 Ga0495680_0132020_787_1503 231
381 3300047471 Ga0495684_0117934 Ga0495684_0117934_755_1471 231
382 3300048912 Ga0496109_0827626 Ga0496109_0827626_32_748 231
383 3300049131 Ga0501341_05480 Ga0501341_05480_13_711 231
384 3300049132 Ga0501343_000822 Ga0501343_000822_94_789 231
385 3300049528 Ga0501312_004363 Ga0501312_004363_38_799 231
386 3300049531 Ga0501315_000455 Ga0501315_000455_1927_2688 231
387 3300049532 Ga0501316_000057 Ga0501316_000057_1480_2175 231
388 3300049551 Ga0501335_003930 Ga0501335_003930_126_824 231
389 3300049554 Ga0501338_00782 Ga0501338_00782_646_1425 231
390 3300050491 nmdc:mga00v17_13821_c1 nmdc:mga00v17_13821_c1_1540_2256 231
391 3300050511 nmdc:mga08y16_128140_c1 nmdc:mga08y16_128140_c1_128_829 231
392 3300050511 nmdc:mga08y16_3103_c1 nmdc:mga08y16_3103_c1_7857_8558 231
393 3300003187 JGI25151J46595_10000735 JGI25151J46595_1000073533 232
394 3300003187 JGI25151J46595_10001136 JGI25151J46595_100011362 232
395 3300003187 JGI25151J46595_10012381 JGI25151J46595_100123814 232
396 3300003578 Ga0006562J51391_1000677 Ga0006562J51391_100067721 232
397 3300003751 Ga0055538_1000081 Ga0055538_100008116 232
398 3300005289 Ga0065704_10019174 Ga0065704_100191743 232
399 3300005338 Ga0068868_100339119 Ga0068868_1003391192 232
400 3300005444 Ga0070694_100528691 Ga0070694_1005286911 232
401 3300005467 Ga0070706_100466541 Ga0070706_1004665412 232
402 3300005468 Ga0070707_100709667 Ga0070707_1007096671 232
403 3300005471 Ga0070698_100278933 Ga0070698_1002789331 232
404 3300005518 Ga0070699_100080347 Ga0070699_1000803475 232
405 3300005530 Ga0070679_100432153 Ga0070679_1004321532 232
406 3300005536 Ga0070697_100017739 Ga0070697_1000177394 232
407 3300005536 Ga0070697_100253963 Ga0070697_1002539632 232
408 3300006163 Ga0070715_10058571 Ga0070715_100585713 232
409 3300006844 Ga0075428_100542290 Ga0075428_1005422902 232
410 3300006847 Ga0075431_100177183 Ga0075431_1001771833 232
411 3300006871 Ga0075434_100062039 Ga0075434_1000620391 232
412 3300006881 Ga0068865_100123349 Ga0068865_1001233493 232
413 3300006914 Ga0075436_100041067 Ga0075436_10004106710 232
414 3300009036 Ga0105244_10094277 Ga0105244_100942771 232
415 3300009094 Ga0111539_10741310 Ga0111539_107413102 232
416 3300009098 Ga0105245_10006900 Ga0105245_100069006 232
417 3300009174 Ga0105241_10088992 Ga0105241_100889921 232
418 3300025224 Ga0209784_100044 Ga0209784_100044165 232
419 3300025292 Ga0209676_1057025 Ga0209676_10570251 232
420 3300025294 Ga0209025_1000639 Ga0209025_100063959 232
421 3300025294 Ga0209025_1016387 Ga0209025_10163874 232
422 3300025905 Ga0207685_10228621 Ga0207685_102286212 232
423 3300025922 Ga0207646_10012863 Ga0207646_1001286316 232
424 3300025927 Ga0207687_10006698 Ga0207687_100066985 232
425 3300025938 Ga0207704_10043139 Ga0207704_100431393 232
426 3300025938 Ga0207704_10179121 Ga0207704_101791212 232
427 3300026023 Ga0207677_10253818 Ga0207677_102538182 232
428 3300026121 Ga0207683_10615407 Ga0207683_106154071 232
429 3300027671 Ga0209588_1019099 Ga0209588_10190991 232
430 3300028379 Ga0268266_10555901 Ga0268266_105559012 232
431 3300028573 Ga0265334_10043783 Ga0265334_100437833 232
432 3300029280 Ga0311011_144096 Ga0311011_1440961 232
433 3300031251 Ga0265327_10094537 Ga0265327_100945372 232
434 3300031548 Ga0307408_100017547 Ga0307408_1000175474 232
435 3300031731 Ga0307405_10021522 Ga0307405_100215222 232
436 3300031731 Ga0307405_10215272 Ga0307405_102152722 232
437 3300031903 Ga0307407_10029070 Ga0307407_100290702 232
438 3300031911 Ga0307412_10505837 Ga0307412_105058371 232
439 3300031995 Ga0307409_100071775 Ga0307409_1000717754 232
440 3300032002 Ga0307416_100018258 Ga0307416_1000182585 232
441 3300032002 Ga0307416_100078459 Ga0307416_1000784594 232
442 3300032002 Ga0307416_100198442 Ga0307416_1001984422 232
443 3300035119 Ga0373956_0164319 Ga0373956_0164319_163_876 232
444 3300035171 Ga0373946_0074711 Ga0373946_0074711_466_1179 232
445 3300035724 Ga0373933_0064935 Ga0373933_0064935_16_729 232
446 3300036401 Ga0373937_0035502 Ga0373937_0035502_2812_3525 232
447 3300036401 Ga0373937_0305712 Ga0373937_0305712_184_906 232
448 3300041505 Ga0451849_1220464 Ga0451849_1220464_144_863 232
449 3300042006 Ga0439432_084115 Ga0439432_084115_150_872 232
450 3300042435 Ga0439434_0016420 Ga0439434_0016420_398_1120 232
451 3300042876 Ga0451577_0000006 Ga0451577_0000006_444238_444945 232
452 3300042876 Ga0451577_0003986 Ga0451577_0003986_908_1606 232
453 3300042876 Ga0451577_0013644 Ga0451577_0013644_1010_1708 232
454 3300042876 Ga0451577_0049529 Ga0451577_0049529_1924_2622 232
455 3300042876 Ga0451577_0406614 Ga0451577_0406614_523_1221 232
456 3300044673 Ga0453683_0000088 Ga0453683_0000088_112162_112869 232
457 3300044673 Ga0453683_0054407 Ga0453683_0054407_1632_2357 232
458 3300044673 Ga0453683_0120787 Ga0453683_0120787_787_1485 232
459 3300044712 Ga0453684_0000037 Ga0453684_0000037_444233_444940 232
460 3300044712 Ga0453684_0014172 Ga0453684_0014172_1932_2630 232
461 3300044712 Ga0453684_0041342 Ga0453684_0041342_249_947 232
462 3300044712 Ga0453684_0084669 Ga0453684_0084669_1329_2027 232
463 3300044712 Ga0453684_0111896 Ga0453684_0111896_1856_2554 232
464 3300045051 Ga0451576_0005544 Ga0451576_0005544_13136_13834 232
465 3300045051 Ga0451576_0047429 Ga0451576_0047429_3291_3989 232
466 3300045051 Ga0451576_0132882 Ga0451576_0132882_1179_1886 232
467 3300045051 Ga0451576_0167626 Ga0451576_0167626_387_1112 232
468 3300045976 Ga0466967_0495836 Ga0466967_0495836_307_1005 232
469 3300046454 Ga0495592_0070640 Ga0495592_0070640_1527_2243 232
470 3300046463 Ga0495653_0163694 Ga0495653_0163694_12_728 232
471 3300046474 Ga0495605_0031123 Ga0495605_0031123_1264_1962 232
472 3300046477 Ga0495664_0051180 Ga0495664_0051180_523_1239 232
473 3300046511 Ga0495608_0064181 Ga0495608_0064181_1174_1893 232
474 3300046511 Ga0495608_0195916 Ga0495608_0195916_47_763 232
475 3300046516 Ga0495628_0038439 Ga0495628_0038439_531_1247 232
476 3300046517 Ga0495630_0058372 Ga0495630_0058372_979_1695 232
477 3300046517 Ga0495630_0063945 Ga0495630_0063945_1115_1825 232
478 3300046530 Ga0495654_0139995 Ga0495654_0139995_70_768 232
479 3300046533 Ga0495640_0098790 Ga0495640_0098790_429_1145 232
480 3300046533 Ga0495640_0102471 Ga0495640_0102471_163_873 232
481 3300046543 Ga0495645_0170033 Ga0495645_0170033_150_866 232
482 3300046557 Ga0495622_0018727 Ga0495622_0018727_362_1060 232
483 3300046557 Ga0495622_0173473 Ga0495622_0173473_259_957 232
484 3300046642 Ga0495634_0021845 Ga0495634_0021845_2629_3339 232
485 3300046642 Ga0495634_0079214 Ga0495634_0079214_855_1571 232
486 3300046663 Ga0495635_0407410 Ga0495635_0407410_28_747 232
487 3300046665 Ga0495661_0090130 Ga0495661_0090130_441_1139 232
488 3300046665 Ga0495661_0100675 Ga0495661_0100675_868_1566 232
489 3300046665 Ga0495661_0193121 Ga0495661_0193121_120_818 232
490 3300046675 Ga0495657_0194364 Ga0495657_0194364_204_920 232
491 3300046683 Ga0495658_0135894 Ga0495658_0135894_367_1083 232
492 3300046689 Ga0495613_0001886 Ga0495613_0001886_12512_13222 232
493 3300046690 Ga0495624_0316939 Ga0495624_0316939_74_790 232
494 3300046810 Ga0495660_0031747 Ga0495660_0031747_67_765 232
495 3300047444 Ga0495675_0065031 Ga0495675_0065031_304_1020 232
496 3300047471 Ga0495684_0196949 Ga0495684_0196949_69_785 232
497 3300048091 Ga0495626_0079304 Ga0495626_0079304_53_751 232
498 3300048903 Ga0496100_0024474 Ga0496100_0024474_1865_2563 232
499 3300048903 Ga0496100_0160296 Ga0496100_0160296_68_787 232
500 3300048904 Ga0496101_0110123 Ga0496101_0110123_1038_1757 232
501 3300048904 Ga0496101_0228242 Ga0496101_0228242_709_1428 232
502 3300048905 Ga0496102_0270627 Ga0496102_0270627_815_1513 232
503 3300048905 Ga0496102_0573952 Ga0496102_0573952_162_884 232
504 3300048907 Ga0496104_0187871 Ga0496104_0187871_941_1660 232
505 3300048907 Ga0496104_0876139 Ga0496104_0876139_25_744 232
506 3300048908 Ga0496105_0053016 Ga0496105_0053016_1828_2547 232
507 3300048908 Ga0496105_0248853 Ga0496105_0248853_268_990 232
508 3300048909 Ga0496106_0476293 Ga0496106_0476293_37_756 232
509 3300048912 Ga0496109_0013733 Ga0496109_0013733_1297_2019 232
510 3300048913 Ga0496110_0117605 Ga0496110_0117605_1532_2251 232
511 3300048914 Ga0496111_0206802 Ga0496111_0206802_233_931 232
512 3300048915 Ga0496112_0251313 Ga0496112_0251313_907_1626 232
513 3300048916 Ga0496113_0113068 Ga0496113_0113068_134_853 232
514 3300048916 Ga0496113_0364520 Ga0496113_0364520_66_764 232
515 3300049127 Ga0501306_000487 Ga0501306_000487_2226_2924 232
516 3300049127 Ga0501306_000497 Ga0501306_000497_885_1583 232
517 3300049127 Ga0501306_000823 Ga0501306_000823_706_1404 232
518 3300049127 Ga0501306_001717 Ga0501306_001717_718_1416 232
519 3300049127 Ga0501306_002383 Ga0501306_002383_515_1213 232
520 3300049127 Ga0501306_002657 Ga0501306_002657_331_1071 232
521 3300049128 Ga0501308_000210 Ga0501308_000210_1226_1924 232
522 3300049128 Ga0501308_000287 Ga0501308_000287_1177_1917 232
523 3300049128 Ga0501308_001173 Ga0501308_001173_234_932 232
524 3300049128 Ga0501308_001828 Ga0501308_001828_570_1268 232
525 3300049128 Ga0501308_005283 Ga0501308_005283_32_730 232
526 3300049129 Ga0501309_000721 Ga0501309_000721_1438_2178 232
527 3300049129 Ga0501309_001463 Ga0501309_001463_1310_2008 232
528 3300049129 Ga0501309_010685 Ga0501309_010685_441_1139 232
529 3300049130 Ga0501310_000371 Ga0501310_000371_1911_2609 232
530 3300049130 Ga0501310_001129 Ga0501310_001129_1127_1825 232
531 3300049130 Ga0501310_002486 Ga0501310_002486_483_1181 232
532 3300049131 Ga0501341_00334 Ga0501341_00334_245_943 232
533 3300049131 Ga0501341_00436 Ga0501341_00436_548_1246 232
534 3300049132 Ga0501343_001772 Ga0501343_001772_220_918 232
535 3300049133 Ga0501344_00106 Ga0501344_00106_561_1259 232
536 3300049133 Ga0501344_00120 Ga0501344_00120_1369_2067 232
537 3300049133 Ga0501344_00965 Ga0501344_00965_50_748 232
538 3300049134 Ga0501345_00054 Ga0501345_00054_1405_2103 232
539 3300049160 Ga0501304_000742 Ga0501304_000742_569_1267 232
540 3300049160 Ga0501304_001331 Ga0501304_001331_291_989 232
541 3300049160 Ga0501304_002229 Ga0501304_002229_59_757 232
542 3300049161 Ga0501305_000182 Ga0501305_000182_1375_2115 232
543 3300049161 Ga0501305_000320 Ga0501305_000320_1448_2146 232
544 3300049161 Ga0501305_000790 Ga0501305_000790_785_1483 232
545 3300049161 Ga0501305_002447 Ga0501305_002447_570_1268 232
546 3300049161 Ga0501305_002739 Ga0501305_002739_501_1199 232
547 3300049161 Ga0501305_003224 Ga0501305_003224_165_863 232
548 3300049161 Ga0501305_006283 Ga0501305_006283_614_1312 232
549 3300049161 Ga0501305_024578 Ga0501305_024578_158_856 232
550 3300049162 Ga0501307_000209 Ga0501307_000209_1261_2001 232
551 3300049162 Ga0501307_000398 Ga0501307_000398_737_1435 232
552 3300049162 Ga0501307_000466 Ga0501307_000466_1463_2161 232
553 3300049162 Ga0501307_002114 Ga0501307_002114_377_1075 232
554 3300049163 Ga0501342_00058 Ga0501342_00058_1023_1721 232
555 3300049527 Ga0501311_000810 Ga0501311_000810_243_941 232
556 3300049527 Ga0501311_001097 Ga0501311_001097_377_1075 232
557 3300049527 Ga0501311_001468 Ga0501311_001468_459_1157 232
558 3300049527 Ga0501311_002237 Ga0501311_002237_379_1077 232
559 3300049528 Ga0501312_000598 Ga0501312_000598_1281_1979 232
560 3300049528 Ga0501312_000704 Ga0501312_000704_718_1416 232
561 3300049528 Ga0501312_000761 Ga0501312_000761_1439_2179 232
562 3300049528 Ga0501312_000887 Ga0501312_000887_1484_2182 232
563 3300049529 Ga0501313_000518 Ga0501313_000518_1543_2241 232
564 3300049529 Ga0501313_000585 Ga0501313_000585_1588_2328 232
565 3300049529 Ga0501313_001631 Ga0501313_001631_570_1268 232
566 3300049529 Ga0501313_006820 Ga0501313_006820_48_746 232
567 3300049530 Ga0501314_000408 Ga0501314_000408_1453_2151 232
568 3300049530 Ga0501314_000534 Ga0501314_000534_924_1622 232
569 3300049530 Ga0501314_001086 Ga0501314_001086_569_1267 232
570 3300049531 Ga0501315_000121 Ga0501315_000121_2076_2816 232
571 3300049531 Ga0501315_000420 Ga0501315_000420_1453_2151 232
572 3300049531 Ga0501315_001280 Ga0501315_001280_711_1409 232
573 3300049531 Ga0501315_002350 Ga0501315_002350_333_1031 232
574 3300049532 Ga0501316_000101 Ga0501316_000101_2093_2833 232
575 3300049532 Ga0501316_000578 Ga0501316_000578_771_1469 232
576 3300049532 Ga0501316_006198 Ga0501316_006198_25_723 232
577 3300049533 Ga0501317_000025 Ga0501317_000025_2097_2837 232
578 3300049533 Ga0501317_000283 Ga0501317_000283_1119_1817 232
579 3300049533 Ga0501317_000743 Ga0501317_000743_899_1597 232
580 3300049533 Ga0501317_001493 Ga0501317_001493_578_1276 232
581 3300049534 Ga0501318_000298 Ga0501318_000298_357_1055 232
582 3300049534 Ga0501318_000737 Ga0501318_000737_578_1276 232
583 3300049534 Ga0501318_000818 Ga0501318_000818_1351_2091 232
584 3300049534 Ga0501318_001153 Ga0501318_001153_576_1274 232
585 3300049534 Ga0501318_001644 Ga0501318_001644_1071_1769 232
586 3300049535 Ga0501319_000142 Ga0501319_000142_1439_2137 232
587 3300049536 Ga0501320_000127 Ga0501320_000127_2224_2922 232
588 3300049536 Ga0501320_000269 Ga0501320_000269_1229_1969 232
589 3300049536 Ga0501320_001252 Ga0501320_001252_501_1199 232
590 3300049536 Ga0501320_011413 Ga0501320_011413_125_826 232
591 3300049537 Ga0501321_000087 Ga0501321_000087_2087_2827 232
592 3300049537 Ga0501321_000347 Ga0501321_000347_1095_1793 232
593 3300049537 Ga0501321_000499 Ga0501321_000499_694_1392 232
594 3300049537 Ga0501321_005487 Ga0501321_005487_259_957 232
595 3300049537 Ga0501321_023432 Ga0501321_023432_11_709 232
596 3300049538 Ga0501322_000299 Ga0501322_000299_207_947 232
597 3300049538 Ga0501322_000543 Ga0501322_000543_758_1456 232
598 3300049538 Ga0501322_000986 Ga0501322_000986_592_1290 232
599 3300049539 Ga0501323_000970 Ga0501323_000970_693_1391 232
600 3300049539 Ga0501323_001243 Ga0501323_001243_89_787 232
601 3300049539 Ga0501323_001559 Ga0501323_001559_578_1276 232
602 3300049539 Ga0501323_001588 Ga0501323_001588_626_1324 232
603 3300049540 Ga0501324_000376 Ga0501324_000376_697_1437 232
604 3300049540 Ga0501324_000524 Ga0501324_000524_570_1268 232
605 3300049540 Ga0501324_000689 Ga0501324_000689_769_1467 232
606 3300049540 Ga0501324_000710 Ga0501324_000710_862_1560 232
607 3300049542 Ga0501326_00062 Ga0501326_00062_1172_1912 232
608 3300049542 Ga0501326_00102 Ga0501326_00102_566_1264 232
609 3300049543 Ga0501327_00098 Ga0501327_00098_1383_2081 232
610 3300049543 Ga0501327_01095 Ga0501327_01095_40_738 232
611 3300049544 Ga0501328_00058 Ga0501328_00058_1304_2002 232
612 3300049545 Ga0501329_00035 Ga0501329_00035_1163_1861 232
613 3300049546 Ga0501330_000125 Ga0501330_000125_1050_1790 232
614 3300049546 Ga0501330_000173 Ga0501330_000173_1406_2104 232
615 3300049546 Ga0501330_000225 Ga0501330_000225_90_788 232
616 3300049547 Ga0501331_00059 Ga0501331_00059_1422_2120 232
617 3300049548 Ga0501332_00078 Ga0501332_00078_783_1523 232
618 3300049548 Ga0501332_00260 Ga0501332_00260_781_1479 232
619 3300049549 Ga0501333_000285 Ga0501333_000285_752_1450 232
620 3300049549 Ga0501333_000472 Ga0501333_000472_948_1646 232
621 3300049549 Ga0501333_000872 Ga0501333_000872_621_1319 232
622 3300049550 Ga0501334_00251 Ga0501334_00251_739_1437 232
623 3300049551 Ga0501335_000498 Ga0501335_000498_1141_1839 232
624 3300049551 Ga0501335_001575 Ga0501335_001575_581_1279 232
625 3300049551 Ga0501335_002815 Ga0501335_002815_649_1347 232
626 3300049551 Ga0501335_006302 Ga0501335_006302_48_746 232
627 3300049552 Ga0501336_000091 Ga0501336_000091_1046_1744 232
628 3300049553 Ga0501337_000054 Ga0501337_000054_2025_2723 232
629 3300049553 Ga0501337_000088 Ga0501337_000088_1374_2114 232
630 3300049553 Ga0501337_000729 Ga0501337_000729_446_1144 232
631 3300049554 Ga0501338_00500 Ga0501338_00500_510_1208 232
632 3300049555 Ga0501339_00007 Ga0501339_00007_771_1469 232
633 3300049556 Ga0501340_000108 Ga0501340_000108_1396_2094 232
634 3300049556 Ga0501340_000251 Ga0501340_000251_284_982 232
635 3300049571 Ga0501034_0024059 Ga0501034_0024059_2489_3208 232
636 3300049579 Ga0501043_0094276 Ga0501043_0094276_386_1105 232
637 3300049580 Ga0501046_0049684 Ga0501046_0049684_77_796 232
638 3300049581 Ga0501047_0063124 Ga0501047_0063124_766_1485 232
639 3300049586 Ga0501070_0011947 Ga0501070_0011947_1953_2672 232
640 3300049588 Ga0501072_0170876 Ga0501072_0170876_167_877 232
641 3300049588 Ga0501072_0266591 Ga0501072_0266591_154_873 232
642 3300049589 Ga0501073_0118279 Ga0501073_0118279_576_1295 232
643 3300049652 Ga0501202_018425 Ga0501202_018425_597_1295 232
644 3300049661 Ga0501217_005351 Ga0501217_005351_597_1295 232
645 3300049665 Ga0501227_021242 Ga0501227_021242_227_925 232
646 3300049708 Ga0501245_009931 Ga0501245_009931_279_977 232
647 3300049742 Ga0501080_0027162 Ga0501080_0027162_1863_2582 232
648 3300049767 Ga0501270_001993 Ga0501270_001993_513_1211 232
649 3300049851 Ga0501212_009766 Ga0501212_009766_72_770 232
650 3300050509 nmdc:mga0qj67_472396_c1 nmdc:mga0qj67_472396_c1_235_951 232
651 3300050510 nmdc:mga06r32_62945_c1 nmdc:mga06r32_62945_c1_1891_2607 232
652 3300050512 nmdc:mga0n895_950611_c1 nmdc:mga0n895_950611_c1_23_727 232
653 3300053077 Ga0495601_0010480 Ga0495601_0010480_1403_2119 232
654 3300053077 Ga0495601_0160426 Ga0495601_0160426_725_1444 232
655 3300053078 Ga0495612_0040570 Ga0495612_0040570_1022_1738 232
656 3300053085 Ga0495619_0021877 Ga0495619_0021877_2898_3614 232
657 3300053085 Ga0495619_0152126 Ga0495619_0152126_837_1556 232
658 3300053085 Ga0495619_0296446 Ga0495619_0296446_25_744 232
659 3300054114 Ga0501084_0000009 Ga0501084_0000009_50533_51255 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

58

248

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.9826 19 225
4v5f-assembly1.cif.gz_BC error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9764 5 225
4qg3-assembly1.cif.gz_A crystal structure of mutant ribosomal protein g219v tthl1 in complex with 80nt 23s rna from thermus thermophilus 0.9754 5 225
4v9h-assembly1.cif.gz_BC crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state 0.9728 3 225
4v8y-assembly1.cif.gz_CL cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex 0.9727 3 225
ID Description Score Start End Superfamily
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9896 16 226 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.984 18 227 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9825 74 159 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9713 16 226 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.9605 74 159 3.40.50.790
ID Description Score Start End GO Terms
AF-A0A0B0HUE2-F1-model_v4 deleted 0.9968 1 197
AF-Q88YW9-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.994 1 228 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A380GR85-F1-model_v4 Large ribosomal subunit protein uL1 0.9939 1 228 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A523HGB8-F1-model_v4 Ribosomal protein 0.9936 36 224 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A0R2N9K1-F1-model_v4 Large ribosomal subunit protein uL1 0.9934 1 228 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843

Feature Viewer

pLDDT pTM Quality
88.74 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map