F473329
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 276 | 661 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10376695|Ga0105248_103766952 |
| Length | 154 |
| Sequence | MSERREVHMAETRSQSFENHGQYRPEYHIVVFFILLANFLWAGYQLFQGLTGGAVVAFLMSVALIVMFFSVRVQILTVQDRVIRLEMRQRFRSVLAADLANRASSLPLRQIIALRFASDEELPSLVSEVVSGQVTAPKEIKQKVRDWQADHLRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 185 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 208 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 209 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.12 |
| Nodule | 0 |
| Rhizoplane | 3.18 |
| Rhizosphere | 94.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10076471 | 3300003316 | Bacteria | 7886 |
| 2 | rootH1_10076471 | 3300003323 | Bacteria | 4360 |
| 3 | Ga0065704_10109235 | 3300005289 | Bacteria | 2008 |
| 4 | Ga0065712_10791296 | 3300005290 | Unclassified | 515 |
| 5 | Ga0065715_10266221 | 3300005293 | Bacteria | 1121 |
| 6 | Ga0065715_10382998 | 3300005293 | Bacteria | 905 |
| 7 | Ga0065715_10513686 | 3300005293 | Bacteria | 769 |
| 8 | Ga0065715_10622608 | 3300005293 | Bacteria | 694 |
| 9 | Ga0070658_10948661 | 3300005327 | Bacteria | 748 |
| 10 | Ga0070676_10264070 | 3300005328 | Bacteria | 1154 |
| 11 | Ga0070676_10449532 | 3300005328 | Bacteria | 906 |
| 12 | Ga0070683_100316938 | 3300005329 | Bacteria | 1484 |
| 13 | Ga0070690_100314059 | 3300005330 | Bacteria | 1127 |
| 14 | Ga0070690_100382182 | 3300005330 | Bacteria | 1030 |
| 15 | Ga0070690_100643807 | 3300005330 | Bacteria | 809 |
| 16 | Ga0070670_100009375 | 3300005331 | Bacteria | 8356 |
| 17 | Ga0070670_100014551 | 3300005331 | Bacteria | 6755 |
| 18 | Ga0070670_100047394 | 3300005331 | Bacteria | 3698 |
| 19 | Ga0070670_100163400 | 3300005331 | Bacteria | 1930 |
| 20 | Ga0070670_100467902 | 3300005331 | Bacteria | 1118 |
| 21 | Ga0070670_100531684 | 3300005331 | Bacteria | 1048 |
| 22 | Ga0070670_100562322 | 3300005331 | Bacteria | 1018 |
| 23 | Ga0070677_10066906 | 3300005333 | Bacteria | 1499 |
| 24 | Ga0070677_10088607 | 3300005333 | Bacteria | 1341 |
| 25 | Ga0068869_100054687 | 3300005334 | Bacteria | 2907 |
| 26 | Ga0068869_100077034 | 3300005334 | Bacteria | 2480 |
| 27 | Ga0068869_100574364 | 3300005334 | Bacteria | 950 |
| 28 | Ga0068869_100884767 | 3300005334 | Bacteria | 772 |
| 29 | Ga0070666_10315140 | 3300005335 | Bacteria | 1115 |
| 30 | Ga0070666_10408260 | 3300005335 | Unclassified | 977 |
| 31 | Ga0070666_10581630 | 3300005335 | Bacteria | 816 |
| 32 | Ga0070680_100100391 | 3300005336 | Bacteria | 2402 |
| 33 | Ga0070680_100192659 | 3300005336 | Bacteria | 1718 |
| 34 | Ga0070680_100887199 | 3300005336 | Bacteria | 769 |
| 35 | Ga0068868_100014509 | 3300005338 | Bacteria | 5808 |
| 36 | Ga0068868_100219258 | 3300005338 | Bacteria | 1592 |
| 37 | Ga0068868_100231602 | 3300005338 | Bacteria | 1550 |
| 38 | Ga0068868_100431206 | 3300005338 | Bacteria | 1143 |
| 39 | Ga0068868_101621920 | 3300005338 | Unclassified | 608 |
| 40 | Ga0070689_100003333 | 3300005340 | Bacteria | 10671 |
| 41 | Ga0070689_100562615 | 3300005340 | Bacteria | 984 |
| 42 | Ga0070689_100594899 | 3300005340 | Bacteria | 958 |
| 43 | Ga0070689_100600633 | 3300005340 | Unclassified | 953 |
| 44 | Ga0070691_10025029 | 3300005341 | Bacteria | 2778 |
| 45 | Ga0070691_10189877 | 3300005341 | Unclassified | 1074 |
| 46 | Ga0070691_10541967 | 3300005341 | Bacteria | 679 |
| 47 | Ga0070687_100034188 | 3300005343 | Bacteria | 2515 |
| 48 | Ga0070661_100204768 | 3300005344 | Bacteria | 1509 |
| 49 | Ga0070692_10053084 | 3300005345 | Unclassified | 2113 |
| 50 | Ga0070668_100006903 | 3300005347 | Bacteria | 8416 |
| 51 | Ga0070668_100115454 | 3300005347 | Bacteria | 2140 |
| 52 | Ga0070668_100862997 | 3300005347 | Bacteria | 807 |
| 53 | Ga0070669_100005999 | 3300005353 | Bacteria | 8764 |
| 54 | Ga0070669_100009468 | 3300005353 | Bacteria | 6938 |
| 55 | Ga0070669_100085548 | 3300005353 | Bacteria | 2354 |
| 56 | Ga0070669_100346644 | 3300005353 | Bacteria | 1205 |
| 57 | Ga0070675_100004565 | 3300005354 | Bacteria | 10568 |
| 58 | Ga0070675_100186100 | 3300005354 | Unclassified | 1797 |
| 59 | Ga0070675_100197198 | 3300005354 | Bacteria | 1746 |
| 60 | Ga0070675_100444907 | 3300005354 | Bacteria | 1161 |
| 61 | Ga0070671_100063375 | 3300005355 | Bacteria | 3078 |
| 62 | Ga0070671_100124237 | 3300005355 | Bacteria | 2172 |
| 63 | Ga0070671_100303478 | 3300005355 | Bacteria | 1360 |
| 64 | Ga0070671_100326498 | 3300005355 | Bacteria | 1308 |
| 65 | Ga0070671_100731449 | 3300005355 | Bacteria | 859 |
| 66 | Ga0070674_100079871 | 3300005356 | Bacteria | 2334 |
| 67 | Ga0070674_100624990 | 3300005356 | Bacteria | 913 |
| 68 | Ga0070674_100782503 | 3300005356 | Bacteria | 822 |
| 69 | Ga0070673_100027570 | 3300005364 | Bacteria | 4212 |
| 70 | Ga0070673_100052628 | 3300005364 | Bacteria | 3195 |
| 71 | Ga0070673_100102851 | 3300005364 | Bacteria | 2356 |
| 72 | Ga0070673_100632236 | 3300005364 | Bacteria | 978 |
| 73 | Ga0070673_100863396 | 3300005364 | Archaea | 838 |
| 74 | Ga0070673_101049826 | 3300005364 | Bacteria | 760 |
| 75 | Ga0070688_100036177 | 3300005365 | Unclassified | 3002 |
| 76 | Ga0070688_100331297 | 3300005365 | Unclassified | 1109 |
| 77 | Ga0070688_101605933 | 3300005365 | Bacteria | 531 |
| 78 | Ga0070659_100765813 | 3300005366 | Unclassified | 838 |
| 79 | Ga0070667_100014018 | 3300005367 | Bacteria | 6626 |
| 80 | Ga0070667_100059796 | 3300005367 | Bacteria | 3224 |
| 81 | Ga0070667_100924853 | 3300005367 | Bacteria | 812 |
| 82 | Ga0070667_100954696 | 3300005367 | Unclassified | 799 |
| 83 | Ga0070667_101036043 | 3300005367 | Unclassified | 766 |
| 84 | Ga0070709_10020457 | 3300005434 | Bacteria | 3839 |
| 85 | Ga0070709_10138767 | 3300005434 | Bacteria | 1668 |
| 86 | Ga0070713_100028665 | 3300005436 | Bacteria | 4398 |
| 87 | Ga0070701_10002357 | 3300005438 | Bacteria | 7254 |
| 88 | Ga0070701_10158003 | 3300005438 | Unclassified | 1311 |
| 89 | Ga0070701_10290527 | 3300005438 | Unclassified | 1001 |
| 90 | Ga0070701_10514434 | 3300005438 | Unclassified | 779 |
| 91 | Ga0070711_101069735 | 3300005439 | Archaea | 694 |
| 92 | Ga0070705_100000037 | 3300005440 | Bacteria | 66783 |
| 93 | Ga0070705_101339951 | 3300005440 | Bacteria | 595 |
| 94 | Ga0070700_100051603 | 3300005441 | Bacteria | 2561 |
| 95 | Ga0070700_100069990 | 3300005441 | Bacteria | 2236 |
| 96 | Ga0070700_100245856 | 3300005441 | Bacteria | 1281 |
| 97 | Ga0070700_100570034 | 3300005441 | Bacteria | 882 |
| 98 | Ga0070700_101129841 | 3300005441 | Unclassified | 651 |
| 99 | Ga0070694_100005480 | 3300005444 | Bacteria | 7688 |
| 100 | Ga0070694_100135736 | 3300005444 | Bacteria | 1783 |
| 101 | Ga0070694_100150397 | 3300005444 | Bacteria | 1700 |
| 102 | Ga0070694_100228084 | 3300005444 | Bacteria | 1400 |
| 103 | Ga0070694_100376059 | 3300005444 | Unclassified | 1107 |
| 104 | Ga0070694_100462243 | 3300005444 | Bacteria | 1004 |
| 105 | Ga0070694_100532433 | 3300005444 | Unclassified | 939 |
| 106 | Ga0070694_100602804 | 3300005444 | Bacteria | 885 |
| 107 | Ga0070708_100042068 | 3300005445 | Bacteria | 4008 |
| 108 | Ga0070708_101149493 | 3300005445 | Unclassified | 727 |
| 109 | Ga0070663_100889066 | 3300005455 | Bacteria | 769 |
| 110 | Ga0070678_100028655 | 3300005456 | Bacteria | 3801 |
| 111 | Ga0070678_100090163 | 3300005456 | Bacteria | 2349 |
| 112 | Ga0070678_101864115 | 3300005456 | Unclassified | 567 |
| 113 | Ga0070662_100041354 | 3300005457 | Bacteria | 3288 |
| 114 | Ga0070662_100206567 | 3300005457 | Bacteria | 1561 |
| 115 | Ga0070662_100623348 | 3300005457 | Bacteria | 908 |
| 116 | Ga0070681_10027374 | 3300005458 | Bacteria | 5732 |
| 117 | Ga0068867_100000265 | 3300005459 | Bacteria | 34503 |
| 118 | Ga0068867_100130170 | 3300005459 | Bacteria | 1954 |
| 119 | Ga0070685_10249553 | 3300005466 | Bacteria | 1175 |
| 120 | Ga0070685_10844433 | 3300005466 | Bacteria | 678 |
| 121 | Ga0070685_11048592 | 3300005466 | Bacteria | 614 |
| 122 | Ga0070706_100003738 | 3300005467 | Bacteria | 14874 |
| 123 | Ga0070706_100269592 | 3300005467 | Bacteria | 1589 |
| 124 | Ga0070706_100605121 | 3300005467 | Bacteria | 1018 |
| 125 | Ga0070707_100001201 | 3300005468 | Bacteria | 25483 |
| 126 | Ga0070707_100688457 | 3300005468 | Bacteria | 985 |
| 127 | Ga0070707_101029950 | 3300005468 | Unclassified | 789 |
| 128 | Ga0070707_101263492 | 3300005468 | Bacteria | 705 |
| 129 | Ga0070698_100020353 | 3300005471 | Bacteria | 6954 |
| 130 | Ga0070698_100718544 | 3300005471 | Bacteria | 942 |
| 131 | Ga0070699_100181207 | 3300005518 | Bacteria | 1869 |
| 132 | Ga0070699_100437039 | 3300005518 | Bacteria | 1186 |
| 133 | Ga0070699_102041868 | 3300005518 | Bacteria | 524 |
| 134 | Ga0070679_100020171 | 3300005530 | Bacteria | 6496 |
| 135 | Ga0070679_101653619 | 3300005530 | Unclassified | 588 |
| 136 | Ga0070684_100055686 | 3300005535 | Bacteria | 3449 |
| 137 | Ga0070684_101600719 | 3300005535 | Unclassified | 614 |
| 138 | Ga0070697_100025013 | 3300005536 | Bacteria | 4758 |
| 139 | Ga0070697_100035381 | 3300005536 | Unclassified | 4028 |
| 140 | Ga0070697_100233130 | 3300005536 | Unclassified | 1570 |
| 141 | Ga0070697_100491683 | 3300005536 | Unclassified | 1072 |
| 142 | Ga0068853_100475661 | 3300005539 | Bacteria | 1177 |
| 143 | Ga0070672_100056393 | 3300005543 | Bacteria | 3081 |
| 144 | Ga0070672_100078985 | 3300005543 | Bacteria | 2633 |
| 145 | Ga0070672_100098450 | 3300005543 | Unclassified | 2369 |
| 146 | Ga0070672_100118866 | 3300005543 | Bacteria | 2161 |
| 147 | Ga0070672_100156607 | 3300005543 | Unclassified | 1887 |
| 148 | Ga0070672_100277346 | 3300005543 | Bacteria | 1416 |
| 149 | Ga0070686_100798685 | 3300005544 | Unclassified | 760 |
| 150 | Ga0070695_100001493 | 3300005545 | Bacteria | 12980 |
| 151 | Ga0070695_100142118 | 3300005545 | Unclassified | 1666 |
| 152 | Ga0070695_100186564 | 3300005545 | Bacteria | 1473 |
| 153 | Ga0070695_100957812 | 3300005545 | Unclassified | 694 |
| 154 | Ga0070695_101592368 | 3300005545 | Bacteria | 545 |
| 155 | Ga0070696_100000139 | 3300005546 | Bacteria | 39687 |
| 156 | Ga0070693_100719677 | 3300005547 | Bacteria | 733 |
| 157 | Ga0070665_100002281 | 3300005548 | Bacteria | 21328 |
| 158 | Ga0070665_100157101 | 3300005548 | Bacteria | 2276 |
| 159 | Ga0070665_101790414 | 3300005548 | Unclassified | 621 |
| 160 | Ga0070704_100058662 | 3300005549 | Unclassified | 2742 |
| 161 | Ga0070704_100236602 | 3300005549 | Bacteria | 1493 |
| 162 | Ga0070704_100725711 | 3300005549 | Bacteria | 883 |
| 163 | Ga0070704_101252564 | 3300005549 | Bacteria | 678 |
| 164 | Ga0068855_101144913 | 3300005563 | Bacteria | 811 |
| 165 | Ga0070664_100011848 | 3300005564 | Bacteria | 7076 |
| 166 | Ga0070664_100338092 | 3300005564 | Bacteria | 1367 |
| 167 | Ga0070664_100898856 | 3300005564 | Bacteria | 830 |
| 168 | Ga0068857_100030919 | 3300005577 | Bacteria | 4731 |
| 169 | Ga0068857_100442222 | 3300005577 | Unclassified | 1215 |
| 170 | Ga0068854_100048700 | 3300005578 | Bacteria | 3024 |
| 171 | Ga0070702_100001352 | 3300005615 | Bacteria | 9992 |
| 172 | Ga0070702_100014861 | 3300005615 | Bacteria | 3961 |
| 173 | Ga0070702_100080529 | 3300005615 | Bacteria | 1949 |
| 174 | Ga0068852_100212705 | 3300005616 | Bacteria | 1835 |
| 175 | Ga0068852_100395631 | 3300005616 | Unclassified | 1358 |
| 176 | Ga0068852_100626788 | 3300005616 | Bacteria | 1081 |
| 177 | Ga0068852_100752774 | 3300005616 | Bacteria | 986 |
| 178 | Ga0068859_100008136 | 3300005617 | Bacteria | 10632 |
| 179 | Ga0068859_100061047 | 3300005617 | Bacteria | 3799 |
| 180 | Ga0068859_100139918 | 3300005617 | Bacteria | 2494 |
| 181 | Ga0068859_100149513 | 3300005617 | Bacteria | 2411 |
| 182 | Ga0068859_100266103 | 3300005617 | Bacteria | 1806 |
| 183 | Ga0068859_100282822 | 3300005617 | Unclassified | 1751 |
| 184 | Ga0068859_100586155 | 3300005617 | Bacteria | 1208 |
| 185 | Ga0068859_100853168 | 3300005617 | Bacteria | 997 |
| 186 | Ga0068859_101110656 | 3300005617 | Unclassified | 870 |
| 187 | Ga0068859_101203199 | 3300005617 | Archaea | 834 |
| 188 | Ga0068864_100024466 | 3300005618 | Bacteria | 5081 |
| 189 | Ga0068864_100139734 | 3300005618 | Bacteria | 2184 |
| 190 | Ga0068864_100220586 | 3300005618 | Bacteria | 1749 |
| 191 | Ga0068864_100224395 | 3300005618 | Bacteria | 1735 |
| 192 | Ga0068864_100411615 | 3300005618 | Unclassified | 1287 |
| 193 | Ga0068866_10014712 | 3300005718 | Bacteria | 3461 |
| 194 | Ga0068866_10816868 | 3300005718 | Archaea | 649 |
| 195 | Ga0068861_100003999 | 3300005719 | Bacteria | 9872 |
| 196 | Ga0068861_100575608 | 3300005719 | Bacteria | 1030 |
| 197 | Ga0068861_100595739 | 3300005719 | Unclassified | 1014 |
| 198 | Ga0068851_10073785 | 3300005834 | Bacteria | 1770 |
| 199 | Ga0068851_10632961 | 3300005834 | Bacteria | 653 |
| 200 | Ga0068870_10002276 | 3300005840 | Bacteria | 7974 |
| 201 | Ga0068870_10021401 | 3300005840 | Bacteria | 3163 |
| 202 | Ga0068870_10116139 | 3300005840 | Bacteria | 1535 |
| 203 | Ga0068863_100008012 | 3300005841 | Bacteria | 10322 |
| 204 | Ga0068863_100065528 | 3300005841 | Bacteria | 3437 |
| 205 | Ga0068863_100137664 | 3300005841 | Bacteria | 2333 |
| 206 | Ga0068863_100330393 | 3300005841 | Bacteria | 1482 |
| 207 | Ga0068863_100378544 | 3300005841 | Bacteria | 1382 |
| 208 | Ga0068863_101073862 | 3300005841 | Unclassified | 809 |
| 209 | Ga0068858_100017955 | 3300005842 | Bacteria | 6624 |
| 210 | Ga0068858_100044696 | 3300005842 | Bacteria | 4105 |
| 211 | Ga0068858_100109092 | 3300005842 | Bacteria | 2584 |
| 212 | Ga0068858_100562876 | 3300005842 | Bacteria | 1104 |
| 213 | Ga0068860_100027062 | 3300005843 | Bacteria | 5525 |
| 214 | Ga0068860_100156293 | 3300005843 | Bacteria | 2198 |
| 215 | Ga0068860_100177629 | 3300005843 | Bacteria | 2058 |
| 216 | Ga0068860_100582643 | 3300005843 | Bacteria | 1123 |
| 217 | Ga0068860_102144439 | 3300005843 | Unclassified | 580 |
| 218 | Ga0068862_100047227 | 3300005844 | Bacteria | 3674 |
| 219 | Ga0068862_100279952 | 3300005844 | Unclassified | 1528 |
| 220 | Ga0068862_100368737 | 3300005844 | Bacteria | 1336 |
| 221 | Ga0068862_101915203 | 3300005844 | Bacteria | 603 |
| 222 | Ga0081455_10049151 | 3300005937 | Bacteria | 3638 |
| 223 | Ga0081455_11025349 | 3300005937 | Unclassified | 510 |
| 224 | Ga0075365_10579676 | 3300006038 | Bacteria | 793 |
| 225 | Ga0075368_10136287 | 3300006042 | Bacteria | 1022 |
| 226 | Ga0075363_100460400 | 3300006048 | Bacteria | 752 |
| 227 | Ga0075364_10021461 | 3300006051 | Bacteria | 4070 |
| 228 | Ga0075432_10236886 | 3300006058 | Unclassified | 736 |
| 229 | Ga0070715_10865485 | 3300006163 | Unclassified | 554 |
| 230 | Ga0070716_100143342 | 3300006173 | Unclassified | 1527 |
| 231 | Ga0075367_10049319 | 3300006178 | Bacteria | 2481 |
| 232 | Ga0075369_10210019 | 3300006186 | Bacteria | 900 |
| 233 | Ga0097621_100064160 | 3300006237 | Bacteria | 3020 |
| 234 | Ga0097621_100148642 | 3300006237 | Bacteria | 2008 |
| 235 | Ga0097621_100208888 | 3300006237 | Bacteria | 1698 |
| 236 | Ga0097621_101183110 | 3300006237 | Archaea | 720 |
| 237 | Ga0075370_10305278 | 3300006353 | Bacteria | 947 |
| 238 | Ga0068871_100436581 | 3300006358 | Bacteria | 1171 |
| 239 | Ga0068871_100455679 | 3300006358 | Bacteria | 1147 |
| 240 | Ga0068871_100559085 | 3300006358 | Unclassified | 1037 |
| 241 | Ga0068871_100562861 | 3300006358 | Unclassified | 1033 |
| 242 | Ga0068871_100831364 | 3300006358 | Unclassified | 853 |
| 243 | Ga0075428_100015340 | 3300006844 | Bacteria | 8497 |
| 244 | Ga0075428_101279264 | 3300006844 | Unclassified | 772 |
| 245 | Ga0075433_10010141 | 3300006852 | Bacteria | 7553 |
| 246 | Ga0075433_10072163 | 3300006852 | Bacteria | 3035 |
| 247 | Ga0075433_10137458 | 3300006852 | Unclassified | 2172 |
| 248 | Ga0075433_10562128 | 3300006852 | Bacteria | 1002 |
| 249 | Ga0075434_100010589 | 3300006871 | Bacteria | 8653 |
| 250 | Ga0075434_100116584 | 3300006871 | Bacteria | 2684 |
| 251 | Ga0075434_100120821 | 3300006871 | Bacteria | 2635 |
| 252 | Ga0075434_100209203 | 3300006871 | Unclassified | 1971 |
| 253 | Ga0075434_100876875 | 3300006871 | Unclassified | 912 |
| 254 | Ga0075429_100096236 | 3300006880 | Bacteria | 2582 |
| 255 | Ga0068865_100129755 | 3300006881 | Bacteria | 1887 |
| 256 | Ga0068865_100273617 | 3300006881 | Bacteria | 1342 |
| 257 | Ga0068865_100529034 | 3300006881 | Bacteria | 987 |
| 258 | Ga0075436_100092788 | 3300006914 | Bacteria | 2099 |
| 259 | Ga0075436_101343189 | 3300006914 | Unclassified | 541 |
| 260 | Ga0097620_100008136 | 3300006931 | Bacteria | 10632 |
| 261 | Ga0097620_100061048 | 3300006931 | Bacteria | 3799 |
| 262 | Ga0097620_100139921 | 3300006931 | Bacteria | 2494 |
| 263 | Ga0097620_100149501 | 3300006931 | Bacteria | 2411 |
| 264 | Ga0097620_100266113 | 3300006931 | Bacteria | 1806 |
| 265 | Ga0097620_100282827 | 3300006931 | Unclassified | 1751 |
| 266 | Ga0097620_100586157 | 3300006931 | Bacteria | 1208 |
| 267 | Ga0097620_100853201 | 3300006931 | Bacteria | 997 |
| 268 | Ga0097620_101055297 | 3300006931 | Unclassified | 893 |
| 269 | Ga0097620_101110545 | 3300006931 | Unclassified | 870 |
| 270 | Ga0097620_101203189 | 3300006931 | Archaea | 834 |
| 271 | Ga0075435_100003148 | 3300007076 | Bacteria | 11155 |
| 272 | Ga0075435_100246914 | 3300007076 | Unclassified | 1519 |
| 273 | Ga0099795_10212859 | 3300007788 | Unclassified | 820 |
| 274 | Ga0099795_10266669 | 3300007788 | Unclassified | 743 |
| 275 | Ga0105240_10039765 | 3300009093 | Bacteria | 6020 |
| 276 | Ga0105240_10886558 | 3300009093 | Bacteria | 961 |
| 277 | Ga0111539_10038271 | 3300009094 | Bacteria | 5786 |
| 278 | Ga0111539_10076896 | 3300009094 | Bacteria | 3930 |
| 279 | Ga0111539_10098220 | 3300009094 | Bacteria | 3440 |
| 280 | Ga0111539_10290994 | 3300009094 | Bacteria | 1901 |
| 281 | Ga0111539_10795095 | 3300009094 | Bacteria | 1101 |
| 282 | Ga0111539_11292240 | 3300009094 | Bacteria | 847 |
| 283 | Ga0105245_10021070 | 3300009098 | Bacteria | 5718 |
| 284 | Ga0105245_10087577 | 3300009098 | Bacteria | 2858 |
| 285 | Ga0105245_10105160 | 3300009098 | Bacteria | 2618 |
| 286 | Ga0105247_10011072 | 3300009101 | Bacteria | 5443 |
| 287 | Ga0114129_10152136 | 3300009147 | Unclassified | 3166 |
| 288 | Ga0114129_10560789 | 3300009147 | Bacteria | 1484 |
| 289 | Ga0114129_11499005 | 3300009147 | Unclassified | 829 |
| 290 | Ga0114129_11670967 | 3300009147 | Unclassified | 778 |
| 291 | Ga0114129_12337654 | 3300009147 | Unclassified | 641 |
| 292 | Ga0105243_10392677 | 3300009148 | Unclassified | 1286 |
| 293 | Ga0105243_10480418 | 3300009148 | Bacteria | 1172 |
| 294 | Ga0105243_11808069 | 3300009148 | Archaea | 642 |
| 295 | Ga0105241_10443791 | 3300009174 | Bacteria | 1147 |
| 296 | Ga0105241_11351626 | 3300009174 | Bacteria | 680 |
| 297 | Ga0105242_10040109 | 3300009176 | Bacteria | 3772 |
| 298 | Ga0105242_10081955 | 3300009176 | Bacteria | 2699 |
| 299 | Ga0105242_10873901 | 3300009176 | Bacteria | 897 |
| 300 | Ga0105248_10012713 | 3300009177 | Bacteria | 9288 |
| 301 | Ga0105248_10016697 | 3300009177 | Bacteria | 8081 |
| 302 | Ga0105248_10147607 | 3300009177 | Unclassified | 2654 |
| 303 | Ga0105248_10343732 | 3300009177 | Archaea | 1680 |
| 304 | Ga0105248_10376695 | 3300009177 | Bacteria | 1598 |
| 305 | Ga0105248_10749130 | 3300009177 | Bacteria | 1102 |
| 306 | Ga0105248_12788511 | 3300009177 | Unclassified | 557 |
| 307 | Ga0105238_10630599 | 3300009551 | Bacteria | 1081 |
| 308 | Ga0105238_11405115 | 3300009551 | Bacteria | 725 |
| 309 | Ga0105249_10000182 | 3300009553 | Bacteria | 73467 |
| 310 | Ga0105249_10013317 | 3300009553 | Bacteria | 7262 |
| 311 | Ga0105249_11282879 | 3300009553 | Bacteria | 804 |
| 312 | Ga0099796_10567216 | 3300010159 | Bacteria | 511 |
| 313 | Ga0105239_12204528 | 3300010375 | Bacteria | 641 |
| 314 | Ga0105246_10133502 | 3300011119 | Bacteria | 1857 |
| 315 | Ga0105246_10140078 | 3300011119 | Bacteria | 1818 |
| 316 | Ga0105246_10154402 | 3300011119 | Bacteria | 1742 |
| 317 | Ga0105246_10528273 | 3300011119 | Bacteria | 1007 |
| 318 | Ga0157369_10073719 | 3300013105 | Bacteria | 3662 |
| 319 | Ga0157374_10005772 | 3300013296 | Bacteria | 10447 |
| 320 | Ga0157374_10524731 | 3300013296 | Unclassified | 1190 |
| 321 | Ga0157374_11114785 | 3300013296 | Bacteria | 810 |
| 322 | Ga0157378_10481020 | 3300013297 | Unclassified | 1237 |
| 323 | Ga0157378_10578753 | 3300013297 | Unclassified | 1132 |
| 324 | Ga0157378_10940107 | 3300013297 | Bacteria | 897 |
| 325 | Ga0157378_11714476 | 3300013297 | Unclassified | 675 |
| 326 | Ga0157378_12152645 | 3300013297 | Unclassified | 609 |
| 327 | Ga0163162_10091980 | 3300013306 | Bacteria | 3116 |
| 328 | Ga0163162_10300998 | 3300013306 | Bacteria | 1736 |
| 329 | Ga0163162_10358670 | 3300013306 | Unclassified | 1591 |
| 330 | Ga0157375_10236291 | 3300013308 | Bacteria | 1987 |
| 331 | Ga0157375_10655377 | 3300013308 | Unclassified | 1206 |
| 332 | Ga0157375_11624837 | 3300013308 | Bacteria | 764 |
| 333 | Ga0157375_11708351 | 3300013308 | Bacteria | 745 |
| 334 | Ga0157375_12154389 | 3300013308 | Bacteria | 664 |
| 335 | Ga0163163_10008708 | 3300014325 | Bacteria | 9025 |
| 336 | Ga0163163_10226472 | 3300014325 | Bacteria | 1919 |
| 337 | Ga0163163_10519543 | 3300014325 | Bacteria | 1253 |
| 338 | Ga0163163_11144980 | 3300014325 | Unclassified | 841 |
| 339 | Ga0163163_11410326 | 3300014325 | Bacteria | 758 |
| 340 | Ga0163163_12373316 | 3300014325 | Bacteria | 589 |
| 341 | Ga0157380_10237373 | 3300014326 | Bacteria | 1641 |
| 342 | Ga0157380_10296274 | 3300014326 | Bacteria | 1488 |
| 343 | Ga0157380_10410777 | 3300014326 | Bacteria | 1287 |
| 344 | Ga0157380_10816630 | 3300014326 | Bacteria | 951 |
| 345 | Ga0157377_10260035 | 3300014745 | Bacteria | 1129 |
| 346 | Ga0157377_10789689 | 3300014745 | Bacteria | 699 |
| 347 | Ga0157379_10040715 | 3300014968 | Bacteria | 4148 |
| 348 | Ga0157379_10041656 | 3300014968 | Bacteria | 4099 |
| 349 | Ga0157379_10071635 | 3300014968 | Bacteria | 3100 |
| 350 | Ga0157379_11753238 | 3300014968 | Bacteria | 609 |
| 351 | Ga0157376_10018282 | 3300014969 | Bacteria | 5369 |
| 352 | Ga0157376_10028229 | 3300014969 | Bacteria | 4458 |
| 353 | Ga0157376_10036669 | 3300014969 | Bacteria | 3974 |
| 354 | Ga0157376_10093640 | 3300014969 | Bacteria | 2609 |
| 355 | Ga0157376_10172439 | 3300014969 | Unclassified | 1971 |
| 356 | Ga0157376_10433947 | 3300014969 | Bacteria | 1277 |
| 357 | Ga0207666_1009081 | 3300025271 | Bacteria | 1338 |
| 358 | Ga0207697_10030192 | 3300025315 | Bacteria | 2218 |
| 359 | Ga0207656_10054451 | 3300025321 | Bacteria | 1739 |
| 360 | Ga0207653_10054460 | 3300025885 | Bacteria | 1338 |
| 361 | Ga0207682_10073963 | 3300025893 | Bacteria | 1448 |
| 362 | Ga0207642_10039001 | 3300025899 | Bacteria | 2060 |
| 363 | Ga0207710_10013426 | 3300025900 | Bacteria | 3446 |
| 364 | Ga0207688_10377824 | 3300025901 | Bacteria | 876 |
| 365 | Ga0207680_10051906 | 3300025903 | Bacteria | 2454 |
| 366 | Ga0207680_10156834 | 3300025903 | Bacteria | 1523 |
| 367 | Ga0207647_10388961 | 3300025904 | Bacteria | 787 |
| 368 | Ga0207647_10434019 | 3300025904 | Unclassified | 737 |
| 369 | Ga0207685_10466500 | 3300025905 | Unclassified | 659 |
| 370 | Ga0207699_10044655 | 3300025906 | Unclassified | 2581 |
| 371 | Ga0207645_10086341 | 3300025907 | Bacteria | 2016 |
| 372 | Ga0207645_10404308 | 3300025907 | Bacteria | 919 |
| 373 | Ga0207643_10005644 | 3300025908 | Bacteria | 6690 |
| 374 | Ga0207643_10027486 | 3300025908 | Unclassified | 3154 |
| 375 | Ga0207643_10199487 | 3300025908 | Bacteria | 1218 |
| 376 | Ga0207684_10100443 | 3300025910 | Bacteria | 2472 |
| 377 | Ga0207654_10333357 | 3300025911 | Bacteria | 1040 |
| 378 | Ga0207654_10541324 | 3300025911 | Bacteria | 826 |
| 379 | Ga0207707_10002331 | 3300025912 | Bacteria | 17099 |
| 380 | Ga0207695_10098513 | 3300025913 | Bacteria | 2922 |
| 381 | Ga0207660_10078893 | 3300025917 | Bacteria | 2414 |
| 382 | Ga0207660_10129911 | 3300025917 | Bacteria | 1916 |
| 383 | Ga0207662_10006037 | 3300025918 | Bacteria | 6511 |
| 384 | Ga0207662_10131960 | 3300025918 | Bacteria | 1576 |
| 385 | Ga0207662_10784737 | 3300025918 | Bacteria | 671 |
| 386 | Ga0207649_10229968 | 3300025920 | Bacteria | 1325 |
| 387 | Ga0207649_10677644 | 3300025920 | Bacteria | 798 |
| 388 | Ga0207652_10177492 | 3300025921 | Unclassified | 1913 |
| 389 | Ga0207646_10000005 | 3300025922 | Bacteria | 523896 |
| 390 | Ga0207646_10213937 | 3300025922 | Bacteria | 1741 |
| 391 | Ga0207646_10649260 | 3300025922 | Bacteria | 945 |
| 392 | Ga0207681_10002833 | 3300025923 | Bacteria | 10975 |
| 393 | Ga0207681_10181784 | 3300025923 | Bacteria | 1602 |
| 394 | Ga0207681_10414341 | 3300025923 | Bacteria | 1090 |
| 395 | Ga0207694_11136540 | 3300025924 | Bacteria | 661 |
| 396 | Ga0207650_10037170 | 3300025925 | Bacteria | 3547 |
| 397 | Ga0207650_10071265 | 3300025925 | Bacteria | 2614 |
| 398 | Ga0207650_10116418 | 3300025925 | Bacteria | 2075 |
| 399 | Ga0207650_10392811 | 3300025925 | Bacteria | 1147 |
| 400 | Ga0207650_10476642 | 3300025925 | Bacteria | 1041 |
| 401 | Ga0207659_10004564 | 3300025926 | Bacteria | 8374 |
| 402 | Ga0207659_10009311 | 3300025926 | Bacteria | 6132 |
| 403 | Ga0207659_10075213 | 3300025926 | Bacteria | 2477 |
| 404 | Ga0207659_10140147 | 3300025926 | Bacteria | 1876 |
| 405 | Ga0207659_10211235 | 3300025926 | Unclassified | 1555 |
| 406 | Ga0207659_10214879 | 3300025926 | Bacteria | 1543 |
| 407 | Ga0207687_10028425 | 3300025927 | Bacteria | 3756 |
| 408 | Ga0207687_10431668 | 3300025927 | Unclassified | 1089 |
| 409 | Ga0207644_10044383 | 3300025931 | Bacteria | 3158 |
| 410 | Ga0207644_10147934 | 3300025931 | Bacteria | 1815 |
| 411 | Ga0207644_10774055 | 3300025931 | Bacteria | 802 |
| 412 | Ga0207644_10911801 | 3300025931 | Unclassified | 737 |
| 413 | Ga0207706_10080619 | 3300025933 | Unclassified | 2862 |
| 414 | Ga0207706_10670085 | 3300025933 | Bacteria | 888 |
| 415 | Ga0207686_10065762 | 3300025934 | Bacteria | 2313 |
| 416 | Ga0207686_10515169 | 3300025934 | Unclassified | 930 |
| 417 | Ga0207686_10605263 | 3300025934 | Bacteria | 863 |
| 418 | Ga0207709_10077526 | 3300025935 | Bacteria | 2131 |
| 419 | Ga0207709_10279372 | 3300025935 | Unclassified | 1233 |
| 420 | Ga0207670_10005144 | 3300025936 | Bacteria | 7149 |
| 421 | Ga0207670_10043284 | 3300025936 | Bacteria | 2972 |
| 422 | Ga0207670_10684135 | 3300025936 | Unclassified | 848 |
| 423 | Ga0207669_10108544 | 3300025937 | Bacteria | 1854 |
| 424 | Ga0207669_10126398 | 3300025937 | Bacteria | 1747 |
| 425 | Ga0207669_10559842 | 3300025937 | Unclassified | 924 |
| 426 | Ga0207669_11042614 | 3300025937 | Unclassified | 689 |
| 427 | Ga0207665_10052202 | 3300025939 | Unclassified | 2754 |
| 428 | Ga0207691_10063783 | 3300025940 | Bacteria | 3340 |
| 429 | Ga0207691_10090278 | 3300025940 | Unclassified | 2747 |
| 430 | Ga0207691_10146651 | 3300025940 | Bacteria | 2077 |
| 431 | Ga0207691_10227586 | 3300025940 | Unclassified | 1615 |
| 432 | Ga0207691_10785184 | 3300025940 | Bacteria | 801 |
| 433 | Ga0207691_11251229 | 3300025940 | Bacteria | 614 |
| 434 | Ga0207711_10016981 | 3300025941 | Bacteria | 6045 |
| 435 | Ga0207711_10019080 | 3300025941 | Bacteria | 5705 |
| 436 | Ga0207711_10697282 | 3300025941 | Bacteria | 947 |
| 437 | Ga0207711_11684745 | 3300025941 | Unclassified | 577 |
| 438 | Ga0207689_10029115 | 3300025942 | Bacteria | 4615 |
| 439 | Ga0207689_10089714 | 3300025942 | Bacteria | 2525 |
| 440 | Ga0207689_10256063 | 3300025942 | Bacteria | 1448 |
| 441 | Ga0207689_11368388 | 3300025942 | Bacteria | 594 |
| 442 | Ga0207661_10227638 | 3300025944 | Bacteria | 1650 |
| 443 | Ga0207679_10136904 | 3300025945 | Bacteria | 1973 |
| 444 | Ga0207679_10927422 | 3300025945 | Bacteria | 797 |
| 445 | Ga0207651_10030586 | 3300025960 | Archaea | 3431 |
| 446 | Ga0207651_10088252 | 3300025960 | Bacteria | 2260 |
| 447 | Ga0207651_10107092 | 3300025960 | Unclassified | 2089 |
| 448 | Ga0207651_10922076 | 3300025960 | Unclassified | 778 |
| 449 | Ga0207651_10931858 | 3300025960 | Bacteria | 774 |
| 450 | Ga0207712_10000063 | 3300025961 | Bacteria | 133704 |
| 451 | Ga0207712_10613650 | 3300025961 | Bacteria | 942 |
| 452 | Ga0207668_10001620 | 3300025972 | Bacteria | 13148 |
| 453 | Ga0207668_10197839 | 3300025972 | Bacteria | 1598 |
| 454 | Ga0207640_10219179 | 3300025981 | Bacteria | 1455 |
| 455 | Ga0207658_10134519 | 3300025986 | Bacteria | 1991 |
| 456 | Ga0207658_10767350 | 3300025986 | Unclassified | 874 |
| 457 | Ga0207677_10018548 | 3300026023 | Bacteria | 4178 |
| 458 | Ga0207677_10215836 | 3300026023 | Bacteria | 1535 |
| 459 | Ga0207677_10263549 | 3300026023 | Bacteria | 1406 |
| 460 | Ga0207677_10360007 | 3300026023 | Bacteria | 1222 |
| 461 | Ga0207703_10004498 | 3300026035 | Bacteria | 11442 |
| 462 | Ga0207703_10023908 | 3300026035 | Bacteria | 4805 |
| 463 | Ga0207703_10134964 | 3300026035 | Bacteria | 2135 |
| 464 | Ga0207703_10170408 | 3300026035 | Bacteria | 1914 |
| 465 | Ga0207703_10688354 | 3300026035 | Bacteria | 972 |
| 466 | Ga0207639_10298134 | 3300026041 | Bacteria | 1424 |
| 467 | Ga0207708_10020209 | 3300026075 | Bacteria | 5022 |
| 468 | Ga0207708_10036795 | 3300026075 | Bacteria | 3728 |
| 469 | Ga0207708_10049016 | 3300026075 | Bacteria | 3216 |
| 470 | Ga0207708_10381391 | 3300026075 | Bacteria | 1162 |
| 471 | Ga0207702_12225006 | 3300026078 | Bacteria | 537 |
| 472 | Ga0207641_10045110 | 3300026088 | Unclassified | 3710 |
| 473 | Ga0207641_10048860 | 3300026088 | Bacteria | 3573 |
| 474 | Ga0207641_10091025 | 3300026088 | Bacteria | 2669 |
| 475 | Ga0207641_10092906 | 3300026088 | Unclassified | 2643 |
| 476 | Ga0207641_10282042 | 3300026088 | Unclassified | 1563 |
| 477 | Ga0207641_11063194 | 3300026088 | Unclassified | 807 |
| 478 | Ga0207641_11763458 | 3300026088 | Bacteria | 621 |
| 479 | Ga0207648_10000844 | 3300026089 | Bacteria | 34567 |
| 480 | Ga0207648_10081967 | 3300026089 | Bacteria | 2813 |
| 481 | Ga0207648_10284180 | 3300026089 | Bacteria | 1480 |
| 482 | Ga0207648_10383397 | 3300026089 | Bacteria | 1271 |
| 483 | Ga0207676_10058395 | 3300026095 | Bacteria | 3043 |
| 484 | Ga0207676_10072530 | 3300026095 | Bacteria | 2768 |
| 485 | Ga0207676_10132112 | 3300026095 | Bacteria | 2124 |
| 486 | Ga0207676_10198270 | 3300026095 | Unclassified | 1772 |
| 487 | Ga0207676_10280606 | 3300026095 | Unclassified | 1512 |
| 488 | Ga0207674_10009268 | 3300026116 | Bacteria | 11279 |
| 489 | Ga0207674_10119086 | 3300026116 | Bacteria | 2609 |
| 490 | Ga0207674_10981151 | 3300026116 | Bacteria | 814 |
| 491 | Ga0207674_11827751 | 3300026116 | Bacteria | 574 |
| 492 | Ga0207675_100001335 | 3300026118 | Bacteria | 24751 |
| 493 | Ga0207675_100113852 | 3300026118 | Bacteria | 2554 |
| 494 | Ga0207675_100218887 | 3300026118 | Bacteria | 1834 |
| 495 | Ga0207675_100861803 | 3300026118 | Unclassified | 921 |
| 496 | Ga0207683_10047044 | 3300026121 | Bacteria | 3778 |
| 497 | Ga0207683_10083670 | 3300026121 | Bacteria | 2836 |
| 498 | Ga0207698_10272137 | 3300026142 | Bacteria | 1562 |
| 499 | Ga0209588_1010128 | 3300027671 | Unclassified | 2829 |
| 500 | Ga0209813_10136239 | 3300027866 | Bacteria | 868 |
| 501 | Ga0207428_10056271 | 3300027907 | Bacteria | 3126 |
| 502 | Ga0207428_10271485 | 3300027907 | Bacteria | 1260 |
| 503 | Ga0207428_11008650 | 3300027907 | Unclassified | 585 |
| 504 | Ga0268266_10009932 | 3300028379 | Bacteria | 8358 |
| 505 | Ga0268266_10261848 | 3300028379 | Bacteria | 1603 |
| 506 | Ga0268266_11289845 | 3300028379 | Unclassified | 706 |
| 507 | Ga0268265_10006637 | 3300028380 | Bacteria | 7830 |
| 508 | Ga0268265_10346621 | 3300028380 | Unclassified | 1354 |
| 509 | Ga0268265_11665896 | 3300028380 | Bacteria | 643 |
| 510 | Ga0268264_10112212 | 3300028381 | Unclassified | 2390 |
| 511 | Ga0268264_10533758 | 3300028381 | Bacteria | 1149 |
| 512 | Ga0268264_10871876 | 3300028381 | Unclassified | 902 |
| 513 | Ga0268264_10912349 | 3300028381 | Bacteria | 882 |
| 514 | Ga0268264_10917398 | 3300028381 | Bacteria | 880 |
| 515 | Ga0265338_10837648 | 3300028800 | Unclassified | 629 |
| 516 | Ga0316181_1222148 | 3300030744 | Bacteria | 2209 |
| 517 | Ga0265760_10025103 | 3300031090 | Bacteria | 1739 |
| 518 | Ga0307414_10266110 | 3300032004 | Unclassified | 1433 |
| 519 | Ga0373949_0056869 | 3300035090 | Bacteria | 998 |
| 520 | Ga0373951_0077844 | 3300035091 | Bacteria | 854 |
| 521 | Ga0373952_0250388 | 3300035092 | Unclassified | 536 |
| 522 | Ga0373932_0035450 | 3300035112 | Bacteria | 1411 |
| 523 | Ga0373936_0229540 | 3300035113 | Unclassified | 825 |
| 524 | Ga0373939_0242188 | 3300035114 | Bacteria | 699 |
| 525 | Ga0373941_0012238 | 3300035115 | Bacteria | 2239 |
| 526 | Ga0373954_0267417 | 3300035118 | Bacteria | 842 |
| 527 | Ga0373954_0284684 | 3300035118 | Unclassified | 815 |
| 528 | Ga0373956_0014364 | 3300035119 | Bacteria | 3308 |
| 529 | Ga0373956_0026411 | 3300035119 | Bacteria | 2515 |
| 530 | Ga0373957_0434288 | 3300035120 | Unclassified | 567 |
| 531 | Ga0373943_0579272 | 3300035170 | Bacteria | 660 |
| 532 | Ga0373955_0069612 | 3300035172 | Unclassified | 1964 |
| 533 | Ga0373955_0099850 | 3300035172 | Bacteria | 1664 |
| 534 | Ga0373955_0870082 | 3300035172 | Unclassified | 554 |
| 535 | Ga0373961_0089640 | 3300035241 | Bacteria | 980 |
| 536 | Ga0373931_0233620 | 3300035691 | Bacteria | 1112 |
| 537 | Ga0373931_0671456 | 3300035691 | Bacteria | 682 |
| 538 | Ga0373935_0068728 | 3300035692 | Unclassified | 2280 |
| 539 | Ga0373935_0217476 | 3300035692 | Bacteria | 1326 |
| 540 | Ga0373935_1449759 | 3300035692 | Unclassified | 513 |
| 541 | Ga0373927_0455479 | 3300035695 | Unclassified | 845 |
| 542 | Ga0373927_0621610 | 3300035695 | Bacteria | 714 |
| 543 | Ga0373933_0108697 | 3300035724 | Bacteria | 1728 |
| 544 | Ga0373937_0119345 | 3300036401 | Bacteria | 2457 |
| 545 | Ga0373937_0172060 | 3300036401 | Bacteria | 2032 |
| 546 | Ga0373925_0133519 | 3300037068 | Bacteria | 1937 |
| 547 | Ga0373925_0458778 | 3300037068 | Bacteria | 1044 |
| 548 | Ga0451807_1483177 | 3300041486 | Bacteria | 738 |
| 549 | Ga0451851_0572458 | 3300041507 | Bacteria | 592 |
| 550 | Ga0451853_3616473 | 3300041512 | Bacteria | 1024 |
| 551 | Ga0439435_0029068 | 3300042436 | Bacteria | 1490 |
| 552 | Ga0451577_0001736 | 3300042876 | Bacteria | 28096 |
| 553 | Ga0451577_0030092 | 3300042876 | Bacteria | 4906 |
| 554 | Ga0451577_0961838 | 3300042876 | Unclassified | 768 |
| 555 | Ga0451577_0992767 | 3300042876 | Unclassified | 754 |
| 556 | Ga0451577_1651333 | 3300042876 | Unclassified | 564 |
| 557 | Ga0453683_0004523 | 3300044673 | Bacteria | 9847 |
| 558 | Ga0453683_0040415 | 3300044673 | Bacteria | 2928 |
| 559 | Ga0453684_0001021 | 3300044712 | Bacteria | 89961 |
| 560 | Ga0453684_0088609 | 3300044712 | Bacteria | 3831 |
| 561 | Ga0453684_0206297 | 3300044712 | Bacteria | 2287 |
| 562 | Ga0453684_1041784 | 3300044712 | Unclassified | 868 |
| 563 | Ga0453684_2278021 | 3300044712 | Unclassified | 539 |
| 564 | Ga0451576_0087303 | 3300045051 | Bacteria | 3244 |
| 565 | Ga0451576_0101461 | 3300045051 | Bacteria | 2993 |
| 566 | Ga0451576_0325012 | 3300045051 | Bacteria | 1610 |
| 567 | Ga0466967_1035044 | 3300045976 | Bacteria | 818 |
| 568 | Ga0495603_0006905 | 3300046455 | Bacteria | 6813 |
| 569 | Ga0495580_0059640 | 3300046472 | Bacteria | 2682 |
| 570 | Ga0495580_0755189 | 3300046472 | Archaea | 633 |
| 571 | Ga0495582_0338614 | 3300046473 | Unclassified | 866 |
| 572 | Ga0495639_0247178 | 3300046475 | Unclassified | 881 |
| 573 | Ga0495662_0043266 | 3300046476 | Bacteria | 2174 |
| 574 | Ga0495594_0023874 | 3300046499 | Unclassified | 3280 |
| 575 | Ga0495607_0473772 | 3300046501 | Unclassified | 559 |
| 576 | Ga0495608_0024536 | 3300046511 | Unclassified | 4121 |
| 577 | Ga0495630_1108629 | 3300046517 | Bacteria | 600 |
| 578 | Ga0495630_1233074 | 3300046517 | Unclassified | 565 |
| 579 | Ga0495663_0097205 | 3300046525 | Bacteria | 966 |
| 580 | Ga0495663_0153885 | 3300046525 | Bacteria | 786 |
| 581 | Ga0495642_0057380 | 3300046528 | Unclassified | 1610 |
| 582 | Ga0495642_0100233 | 3300046528 | Bacteria | 1232 |
| 583 | Ga0495640_0326446 | 3300046533 | Unclassified | 950 |
| 584 | Ga0495621_0212581 | 3300046539 | Bacteria | 781 |
| 585 | Ga0495645_0031447 | 3300046543 | Bacteria | 3868 |
| 586 | Ga0495645_0736936 | 3300046543 | Unclassified | 596 |
| 587 | Ga0495633_0421100 | 3300046558 | Bacteria | 604 |
| 588 | Ga0495667_0605302 | 3300046559 | Bacteria | 682 |
| 589 | Ga0495611_0253885 | 3300046648 | Bacteria | 815 |
| 590 | Ga0495659_0002267 | 3300046664 | Bacteria | 6239 |
| 591 | Ga0495659_0034483 | 3300046664 | Bacteria | 1780 |
| 592 | Ga0495659_0074444 | 3300046664 | Bacteria | 1277 |
| 593 | Ga0495659_0335553 | 3300046664 | Unclassified | 644 |
| 594 | Ga0495588_0005306 | 3300046674 | Bacteria | 5730 |
| 595 | Ga0495657_0053302 | 3300046675 | Unclassified | 2707 |
| 596 | Ga0495599_0259922 | 3300046678 | Bacteria | 1055 |
| 597 | Ga0495647_0002231 | 3300046681 | Bacteria | 6070 |
| 598 | Ga0495658_0103481 | 3300046683 | Unclassified | 1703 |
| 599 | Ga0495658_0319597 | 3300046683 | Bacteria | 984 |
| 600 | Ga0495658_0678133 | 3300046683 | Bacteria | 660 |
| 601 | Ga0495669_0007901 | 3300046684 | Bacteria | 4466 |
| 602 | Ga0495613_0115078 | 3300046689 | Bacteria | 1936 |
| 603 | Ga0495624_0831148 | 3300046690 | Unclassified | 545 |
| 604 | Ga0495670_0044274 | 3300046691 | Bacteria | 2222 |
| 605 | Ga0495600_0132661 | 3300046809 | Bacteria | 1619 |
| 606 | Ga0495636_0043461 | 3300047318 | Unclassified | 1869 |
| 607 | Ga0495636_0057754 | 3300047318 | Bacteria | 1635 |
| 608 | Ga0495674_0858532 | 3300047319 | Bacteria | 703 |
| 609 | Ga0495685_134363 | 3300047447 | Unclassified | 808 |
| 610 | Ga0495684_0009675 | 3300047471 | Bacteria | 7433 |
| 611 | Ga0496100_0253325 | 3300048903 | Bacteria | 1303 |
| 612 | Ga0496102_0624138 | 3300048905 | Bacteria | 1001 |
| 613 | Ga0496104_0179552 | 3300048907 | Bacteria | 2027 |
| 614 | Ga0496104_0276825 | 3300048907 | Bacteria | 1591 |
| 615 | Ga0496104_0636252 | 3300048907 | Unclassified | 976 |
| 616 | Ga0496104_1176686 | 3300048907 | Bacteria | 670 |
| 617 | Ga0496105_1147989 | 3300048908 | Bacteria | 574 |
| 618 | Ga0496106_0395936 | 3300048909 | Bacteria | 1110 |
| 619 | Ga0496106_1079208 | 3300048909 | Unclassified | 630 |
| 620 | Ga0496108_0296490 | 3300048911 | Unclassified | 1408 |
| 621 | Ga0496109_1533391 | 3300048912 | Unclassified | 601 |
| 622 | Ga0496109_1846267 | 3300048912 | Unclassified | 537 |
| 623 | Ga0496110_0657457 | 3300048913 | Bacteria | 948 |
| 624 | Ga0496111_0809733 | 3300048914 | Bacteria | 678 |
| 625 | Ga0496112_0012702 | 3300048915 | Bacteria | 7745 |
| 626 | Ga0496112_1054240 | 3300048915 | Unclassified | 732 |
| 627 | Ga0496112_1242032 | 3300048915 | Bacteria | 661 |
| 628 | Ga0496113_0012726 | 3300048916 | Bacteria | 5666 |
| 629 | Ga0496113_0498141 | 3300048916 | Unclassified | 978 |
| 630 | Ga0496114_0057539 | 3300048917 | Bacteria | 3246 |
| 631 | Ga0501039_1543135 | 3300049575 | Bacteria | 510 |
| 632 | Ga0501072_0303396 | 3300049588 | Archaea | 1269 |
| 633 | Ga0501076_0962294 | 3300049592 | Bacteria | 703 |
| 634 | Ga0501081_1408374 | 3300049743 | Unclassified | 529 |
| 635 | Ga0501241_002671 | 3300049758 | Bacteria | 3432 |
| 636 | nmdc:mga00v17_576177_c1 | 3300050491 | Bacteria | 727 |
| 637 | nmdc:mga06z11_930370_c1 | 3300050494 | Bacteria | 530 |
| 638 | nmdc:mga06z11_97271_c1 | 3300050494 | Bacteria | 1609 |
| 639 | nmdc:mga04h51_132875_c1 | 3300050495 | Bacteria | 938 |
| 640 | nmdc:mga07m45_531293_c1 | 3300050496 | Bacteria | 681 |
| 641 | nmdc:mga05p37_151491_c2 | 3300050507 | Bacteria | 1484 |
| 642 | nmdc:mga05p37_2000542_c1 | 3300050507 | Bacteria | 548 |
| 643 | nmdc:mga05p37_2703_c1 | 3300050507 | Bacteria | 20615 |
| 644 | nmdc:mga08y16_174979_c1 | 3300050511 | Bacteria | 2229 |
| 645 | nmdc:mga08y16_889174_c1 | 3300050511 | Bacteria | 878 |
| 646 | nmdc:mga0n895_1547270_c1 | 3300050512 | Unclassified | 629 |
| 647 | nmdc:mga0n895_1704806_c1 | 3300050512 | Bacteria | 593 |
| 648 | nmdc:mga0n895_20877_c1 | 3300050512 | Bacteria | 6118 |
| 649 | nmdc:mga0n895_625324_c1 | 3300050512 | Bacteria | 1077 |
| 650 | nmdc:mga0rr50_283386_c1 | 3300050513 | Bacteria | 1383 |
| 651 | nmdc:mga0rr50_8733_c1 | 3300050513 | Bacteria | 6322 |
| 652 | nmdc:mga08x19_1094867_c1 | 3300050514 | Unclassified | 565 |
| 653 | nmdc:mga08x19_21010_c1 | 3300050514 | Bacteria | 4027 |
| 654 | nmdc:mga0a205_22081_c1 | 3300050515 | Bacteria | 6023 |
| 655 | nmdc:mga0a205_37742_c1 | 3300050515 | Bacteria | 4646 |
| 656 | nmdc:mga0a205_435073_c1 | 3300050515 | Bacteria | 1173 |
| 657 | nmdc:mga0a205_6451_c1 | 3300050515 | Bacteria | 10607 |
| 658 | nmdc:mga0sz30_432419_c1 | 3300050516 | Bacteria | 590 |
| 659 | Ga0495595_0025258 | 3300053084 | Bacteria | 2632 |
| 660 | Ga0495595_0361961 | 3300053084 | Bacteria | 733 |
| 661 | Ga0495619_0473554 | 3300053085 | Bacteria | 862 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005548 | Ga0070665_100157101 | Ga0070665_1001571013 | 108 |
| 2 | 3300005347 | Ga0070668_100006903 | Ga0070668_1000069037 | 110 |
| 3 | 3300009553 | Ga0105249_10000182 | Ga0105249_1000018219 | 110 |
| 4 | 3300025961 | Ga0207712_10000063 | Ga0207712_1000006316 | 110 |
| 5 | 3300025972 | Ga0207668_10001620 | Ga0207668_100016205 | 110 |
| 6 | 3300005456 | Ga0070678_101864115 | Ga0070678_1018641151 | 114 |
| 7 | 3300041486 | Ga0451807_1483177 | Ga0451807_1483177_136_579 | 114 |
| 8 | 3300042876 | Ga0451577_1651333 | Ga0451577_1651333_30_461 | 115 |
| 9 | 3300007788 | Ga0099795_10212859 | Ga0099795_102128592 | 116 |
| 10 | 3300025901 | Ga0207688_10377824 | Ga0207688_103778242 | 116 |
| 11 | 3300041507 | Ga0451851_0572458 | Ga0451851_0572458_10_474 | 121 |
| 12 | 3300046525 | Ga0495663_0153885 | Ga0495663_0153885_30_404 | 121 |
| 13 | 3300035120 | Ga0373957_0434288 | Ga0373957_0434288_89_532 | 122 |
| 14 | 3300046511 | Ga0495608_0024536 | Ga0495608_0024536_1111_1554 | 122 |
| 15 | 3300046675 | Ga0495657_0053302 | Ga0495657_0053302_234_677 | 122 |
| 16 | 3300047471 | Ga0495684_0009675 | Ga0495684_0009675_4981_5424 | 122 |
| 17 | 3300028800 | Ga0265338_10837648 | Ga0265338_108376482 | 123 |
| 18 | 3300046683 | Ga0495658_0319597 | Ga0495658_0319597_20_457 | 123 |
| 19 | 3300009093 | Ga0105240_10039765 | Ga0105240_100397652 | 124 |
| 20 | 3300025913 | Ga0207695_10098513 | Ga0207695_100985133 | 124 |
| 21 | 3300035113 | Ga0373936_0229540 | Ga0373936_0229540_356_745 | 126 |
| 22 | 3300005331 | Ga0070670_100562322 | Ga0070670_1005623221 | 129 |
| 23 | 3300025925 | Ga0207650_10476642 | Ga0207650_104766422 | 129 |
| 24 | 3300035090 | Ga0373949_0056869 | Ga0373949_0056869_574_972 | 129 |
| 25 | 3300014969 | Ga0157376_10018282 | Ga0157376_100182821 | 130 |
| 26 | 3300041512 | Ga0451853_3616473 | Ga0451853_3616473_266_700 | 130 |
| 27 | 3300005468 | Ga0070707_100001201 | Ga0070707_10000120113 | 132 |
| 28 | 3300025922 | Ga0207646_10000005 | Ga0207646_10000005227 | 132 |
| 29 | 3300042876 | Ga0451577_0030092 | Ga0451577_0030092_3227_3688 | 133 |
| 30 | 3300044673 | Ga0453683_0004523 | Ga0453683_0004523_6462_6923 | 133 |
| 31 | 3300044712 | Ga0453684_0088609 | Ga0453684_0088609_2658_3119 | 133 |
| 32 | 3300045976 | Ga0466967_1035044 | Ga0466967_1035044_29_463 | 133 |
| 33 | 3300005445 | Ga0070708_101149493 | Ga0070708_1011494932 | 134 |
| 34 | 3300005467 | Ga0070706_100003738 | Ga0070706_1000037389 | 134 |
| 35 | 3300005471 | Ga0070698_100718544 | Ga0070698_1007185442 | 134 |
| 36 | 3300025910 | Ga0207684_10100443 | Ga0207684_101004433 | 134 |
| 37 | 3300042876 | Ga0451577_0001736 | Ga0451577_0001736_27147_27578 | 134 |
| 38 | 3300042876 | Ga0451577_0992767 | Ga0451577_0992767_216_677 | 134 |
| 39 | 3300044712 | Ga0453684_0001021 | Ga0453684_0001021_36266_36697 | 134 |
| 40 | 3300005335 | Ga0070666_10581630 | Ga0070666_105816301 | 137 |
| 41 | 3300005354 | Ga0070675_100186100 | Ga0070675_1001861003 | 137 |
| 42 | 3300005355 | Ga0070671_100326498 | Ga0070671_1003264983 | 137 |
| 43 | 3300005434 | Ga0070709_10020457 | Ga0070709_100204571 | 137 |
| 44 | 3300007788 | Ga0099795_10266669 | Ga0099795_102666692 | 137 |
| 45 | 3300009176 | Ga0105242_10873901 | Ga0105242_108739012 | 137 |
| 46 | 3300010159 | Ga0099796_10567216 | Ga0099796_105672161 | 137 |
| 47 | 3300014325 | Ga0163163_11410326 | Ga0163163_114103261 | 137 |
| 48 | 3300014326 | Ga0157380_10410777 | Ga0157380_104107772 | 137 |
| 49 | 3300025926 | Ga0207659_10211235 | Ga0207659_102112353 | 137 |
| 50 | 3300025931 | Ga0207644_10774055 | Ga0207644_107740551 | 137 |
| 51 | 3300025934 | Ga0207686_10605263 | Ga0207686_106052631 | 137 |
| 52 | 3300025937 | Ga0207669_11042614 | Ga0207669_110426142 | 137 |
| 53 | 3300027671 | Ga0209588_1010128 | Ga0209588_10101283 | 137 |
| 54 | 3300049743 | Ga0501081_1408374 | Ga0501081_1408374_65_502 | 137 |
| 55 | 3300005289 | Ga0065704_10109235 | Ga0065704_101092352 | 138 |
| 56 | 3300005290 | Ga0065712_10791296 | Ga0065712_107912961 | 138 |
| 57 | 3300005293 | Ga0065715_10266221 | Ga0065715_102662212 | 138 |
| 58 | 3300005293 | Ga0065715_10382998 | Ga0065715_103829981 | 138 |
| 59 | 3300005293 | Ga0065715_10513686 | Ga0065715_105136861 | 138 |
| 60 | 3300005293 | Ga0065715_10622608 | Ga0065715_106226082 | 138 |
| 61 | 3300005327 | Ga0070658_10948661 | Ga0070658_109486612 | 138 |
| 62 | 3300005328 | Ga0070676_10264070 | Ga0070676_102640702 | 138 |
| 63 | 3300005328 | Ga0070676_10449532 | Ga0070676_104495322 | 138 |
| 64 | 3300005329 | Ga0070683_100316938 | Ga0070683_1003169382 | 138 |
| 65 | 3300005330 | Ga0070690_100314059 | Ga0070690_1003140591 | 138 |
| 66 | 3300005330 | Ga0070690_100382182 | Ga0070690_1003821821 | 138 |
| 67 | 3300005330 | Ga0070690_100643807 | Ga0070690_1006438072 | 138 |
| 68 | 3300005331 | Ga0070670_100009375 | Ga0070670_1000093758 | 138 |
| 69 | 3300005331 | Ga0070670_100014551 | Ga0070670_1000145515 | 138 |
| 70 | 3300005331 | Ga0070670_100047394 | Ga0070670_1000473945 | 138 |
| 71 | 3300005331 | Ga0070670_100163400 | Ga0070670_1001634003 | 138 |
| 72 | 3300005331 | Ga0070670_100467902 | Ga0070670_1004679021 | 138 |
| 73 | 3300005331 | Ga0070670_100531684 | Ga0070670_1005316843 | 138 |
| 74 | 3300005333 | Ga0070677_10066906 | Ga0070677_100669063 | 138 |
| 75 | 3300005333 | Ga0070677_10088607 | Ga0070677_100886073 | 138 |
| 76 | 3300005334 | Ga0068869_100054687 | Ga0068869_1000546874 | 138 |
| 77 | 3300005334 | Ga0068869_100077034 | Ga0068869_1000770342 | 138 |
| 78 | 3300005334 | Ga0068869_100574364 | Ga0068869_1005743642 | 138 |
| 79 | 3300005334 | Ga0068869_100884767 | Ga0068869_1008847671 | 138 |
| 80 | 3300005335 | Ga0070666_10315140 | Ga0070666_103151401 | 138 |
| 81 | 3300005335 | Ga0070666_10408260 | Ga0070666_104082601 | 138 |
| 82 | 3300005336 | Ga0070680_100100391 | Ga0070680_1001003911 | 138 |
| 83 | 3300005336 | Ga0070680_100192659 | Ga0070680_1001926593 | 138 |
| 84 | 3300005336 | Ga0070680_100887199 | Ga0070680_1008871991 | 138 |
| 85 | 3300005338 | Ga0068868_100014509 | Ga0068868_1000145094 | 138 |
| 86 | 3300005338 | Ga0068868_100219258 | Ga0068868_1002192582 | 138 |
| 87 | 3300005338 | Ga0068868_100231602 | Ga0068868_1002316022 | 138 |
| 88 | 3300005338 | Ga0068868_100431206 | Ga0068868_1004312062 | 138 |
| 89 | 3300005338 | Ga0068868_101621920 | Ga0068868_1016219201 | 138 |
| 90 | 3300005340 | Ga0070689_100003333 | Ga0070689_1000033338 | 138 |
| 91 | 3300005340 | Ga0070689_100562615 | Ga0070689_1005626151 | 138 |
| 92 | 3300005340 | Ga0070689_100594899 | Ga0070689_1005948991 | 138 |
| 93 | 3300005340 | Ga0070689_100600633 | Ga0070689_1006006331 | 138 |
| 94 | 3300005341 | Ga0070691_10025029 | Ga0070691_100250293 | 138 |
| 95 | 3300005341 | Ga0070691_10189877 | Ga0070691_101898772 | 138 |
| 96 | 3300005341 | Ga0070691_10541967 | Ga0070691_105419671 | 138 |
| 97 | 3300005343 | Ga0070687_100034188 | Ga0070687_1000341884 | 138 |
| 98 | 3300005344 | Ga0070661_100204768 | Ga0070661_1002047682 | 138 |
| 99 | 3300005345 | Ga0070692_10053084 | Ga0070692_100530842 | 138 |
| 100 | 3300005347 | Ga0070668_100115454 | Ga0070668_1001154542 | 138 |
| 101 | 3300005347 | Ga0070668_100862997 | Ga0070668_1008629971 | 138 |
| 102 | 3300005353 | Ga0070669_100005999 | Ga0070669_1000059999 | 138 |
| 103 | 3300005353 | Ga0070669_100009468 | Ga0070669_1000094682 | 138 |
| 104 | 3300005353 | Ga0070669_100085548 | Ga0070669_1000855483 | 138 |
| 105 | 3300005353 | Ga0070669_100346644 | Ga0070669_1003466442 | 138 |
| 106 | 3300005354 | Ga0070675_100004565 | Ga0070675_1000045656 | 138 |
| 107 | 3300005354 | Ga0070675_100197198 | Ga0070675_1001971981 | 138 |
| 108 | 3300005354 | Ga0070675_100444907 | Ga0070675_1004449072 | 138 |
| 109 | 3300005355 | Ga0070671_100063375 | Ga0070671_1000633754 | 138 |
| 110 | 3300005355 | Ga0070671_100124237 | Ga0070671_1001242373 | 138 |
| 111 | 3300005355 | Ga0070671_100303478 | Ga0070671_1003034781 | 138 |
| 112 | 3300005355 | Ga0070671_100731449 | Ga0070671_1007314492 | 138 |
| 113 | 3300005356 | Ga0070674_100079871 | Ga0070674_1000798713 | 138 |
| 114 | 3300005356 | Ga0070674_100624990 | Ga0070674_1006249901 | 138 |
| 115 | 3300005356 | Ga0070674_100782503 | Ga0070674_1007825031 | 138 |
| 116 | 3300005364 | Ga0070673_100027570 | Ga0070673_1000275702 | 138 |
| 117 | 3300005364 | Ga0070673_100052628 | Ga0070673_1000526283 | 138 |
| 118 | 3300005364 | Ga0070673_100102851 | Ga0070673_1001028513 | 138 |
| 119 | 3300005364 | Ga0070673_100632236 | Ga0070673_1006322361 | 138 |
| 120 | 3300005364 | Ga0070673_100863396 | Ga0070673_1008633962 | 138 |
| 121 | 3300005364 | Ga0070673_101049826 | Ga0070673_1010498262 | 138 |
| 122 | 3300005365 | Ga0070688_100036177 | Ga0070688_1000361774 | 138 |
| 123 | 3300005365 | Ga0070688_100331297 | Ga0070688_1003312972 | 138 |
| 124 | 3300005365 | Ga0070688_101605933 | Ga0070688_1016059331 | 138 |
| 125 | 3300005366 | Ga0070659_100765813 | Ga0070659_1007658132 | 138 |
| 126 | 3300005367 | Ga0070667_100014018 | Ga0070667_1000140186 | 138 |
| 127 | 3300005367 | Ga0070667_100059796 | Ga0070667_1000597963 | 138 |
| 128 | 3300005367 | Ga0070667_100924853 | Ga0070667_1009248532 | 138 |
| 129 | 3300005367 | Ga0070667_100954696 | Ga0070667_1009546962 | 138 |
| 130 | 3300005367 | Ga0070667_101036043 | Ga0070667_1010360432 | 138 |
| 131 | 3300005434 | Ga0070709_10138767 | Ga0070709_101387672 | 138 |
| 132 | 3300005436 | Ga0070713_100028665 | Ga0070713_1000286655 | 138 |
| 133 | 3300005438 | Ga0070701_10002357 | Ga0070701_100023578 | 138 |
| 134 | 3300005438 | Ga0070701_10158003 | Ga0070701_101580032 | 138 |
| 135 | 3300005438 | Ga0070701_10290527 | Ga0070701_102905272 | 138 |
| 136 | 3300005438 | Ga0070701_10514434 | Ga0070701_105144342 | 138 |
| 137 | 3300005439 | Ga0070711_101069735 | Ga0070711_1010697351 | 138 |
| 138 | 3300005440 | Ga0070705_100000037 | Ga0070705_10000003735 | 138 |
| 139 | 3300005440 | Ga0070705_101339951 | Ga0070705_1013399511 | 138 |
| 140 | 3300005441 | Ga0070700_100051603 | Ga0070700_1000516033 | 138 |
| 141 | 3300005441 | Ga0070700_100069990 | Ga0070700_1000699901 | 138 |
| 142 | 3300005441 | Ga0070700_100245856 | Ga0070700_1002458562 | 138 |
| 143 | 3300005441 | Ga0070700_100570034 | Ga0070700_1005700341 | 138 |
| 144 | 3300005441 | Ga0070700_101129841 | Ga0070700_1011298412 | 138 |
| 145 | 3300005444 | Ga0070694_100005480 | Ga0070694_1000054808 | 138 |
| 146 | 3300005444 | Ga0070694_100135736 | Ga0070694_1001357362 | 138 |
| 147 | 3300005444 | Ga0070694_100150397 | Ga0070694_1001503972 | 138 |
| 148 | 3300005444 | Ga0070694_100228084 | Ga0070694_1002280844 | 138 |
| 149 | 3300005444 | Ga0070694_100376059 | Ga0070694_1003760592 | 138 |
| 150 | 3300005444 | Ga0070694_100462243 | Ga0070694_1004622432 | 138 |
| 151 | 3300005444 | Ga0070694_100532433 | Ga0070694_1005324332 | 138 |
| 152 | 3300005444 | Ga0070694_100602804 | Ga0070694_1006028041 | 138 |
| 153 | 3300005445 | Ga0070708_100042068 | Ga0070708_1000420683 | 138 |
| 154 | 3300005455 | Ga0070663_100889066 | Ga0070663_1008890662 | 138 |
| 155 | 3300005456 | Ga0070678_100028655 | Ga0070678_1000286553 | 138 |
| 156 | 3300005456 | Ga0070678_100090163 | Ga0070678_1000901632 | 138 |
| 157 | 3300005457 | Ga0070662_100041354 | Ga0070662_1000413542 | 138 |
| 158 | 3300005457 | Ga0070662_100206567 | Ga0070662_1002065671 | 138 |
| 159 | 3300005457 | Ga0070662_100623348 | Ga0070662_1006233482 | 138 |
| 160 | 3300005458 | Ga0070681_10027374 | Ga0070681_100273742 | 138 |
| 161 | 3300005459 | Ga0068867_100000265 | Ga0068867_1000002657 | 138 |
| 162 | 3300005459 | Ga0068867_100130170 | Ga0068867_1001301702 | 138 |
| 163 | 3300005466 | Ga0070685_10249553 | Ga0070685_102495531 | 138 |
| 164 | 3300005466 | Ga0070685_10844433 | Ga0070685_108444331 | 138 |
| 165 | 3300005466 | Ga0070685_11048592 | Ga0070685_110485921 | 138 |
| 166 | 3300005467 | Ga0070706_100269592 | Ga0070706_1002695923 | 138 |
| 167 | 3300005467 | Ga0070706_100605121 | Ga0070706_1006051211 | 138 |
| 168 | 3300005468 | Ga0070707_100688457 | Ga0070707_1006884571 | 138 |
| 169 | 3300005468 | Ga0070707_101029950 | Ga0070707_1010299501 | 138 |
| 170 | 3300005468 | Ga0070707_101263492 | Ga0070707_1012634921 | 138 |
| 171 | 3300005471 | Ga0070698_100020353 | Ga0070698_1000203534 | 138 |
| 172 | 3300005518 | Ga0070699_100181207 | Ga0070699_1001812073 | 138 |
| 173 | 3300005518 | Ga0070699_100437039 | Ga0070699_1004370392 | 138 |
| 174 | 3300005518 | Ga0070699_102041868 | Ga0070699_1020418681 | 138 |
| 175 | 3300005530 | Ga0070679_100020171 | Ga0070679_1000201712 | 138 |
| 176 | 3300005530 | Ga0070679_101653619 | Ga0070679_1016536191 | 138 |
| 177 | 3300005535 | Ga0070684_100055686 | Ga0070684_1000556862 | 138 |
| 178 | 3300005535 | Ga0070684_101600719 | Ga0070684_1016007191 | 138 |
| 179 | 3300005536 | Ga0070697_100025013 | Ga0070697_1000250134 | 138 |
| 180 | 3300005536 | Ga0070697_100035381 | Ga0070697_1000353814 | 138 |
| 181 | 3300005536 | Ga0070697_100233130 | Ga0070697_1002331301 | 138 |
| 182 | 3300005536 | Ga0070697_100491683 | Ga0070697_1004916832 | 138 |
| 183 | 3300005539 | Ga0068853_100475661 | Ga0068853_1004756611 | 138 |
| 184 | 3300005543 | Ga0070672_100056393 | Ga0070672_1000563933 | 138 |
| 185 | 3300005543 | Ga0070672_100078985 | Ga0070672_1000789854 | 138 |
| 186 | 3300005543 | Ga0070672_100098450 | Ga0070672_1000984502 | 138 |
| 187 | 3300005543 | Ga0070672_100118866 | Ga0070672_1001188662 | 138 |
| 188 | 3300005543 | Ga0070672_100156607 | Ga0070672_1001566072 | 138 |
| 189 | 3300005543 | Ga0070672_100277346 | Ga0070672_1002773462 | 138 |
| 190 | 3300005544 | Ga0070686_100798685 | Ga0070686_1007986852 | 138 |
| 191 | 3300005545 | Ga0070695_100001493 | Ga0070695_1000014937 | 138 |
| 192 | 3300005545 | Ga0070695_100142118 | Ga0070695_1001421183 | 138 |
| 193 | 3300005545 | Ga0070695_100186564 | Ga0070695_1001865642 | 138 |
| 194 | 3300005545 | Ga0070695_100957812 | Ga0070695_1009578122 | 138 |
| 195 | 3300005545 | Ga0070695_101592368 | Ga0070695_1015923681 | 138 |
| 196 | 3300005546 | Ga0070696_100000139 | Ga0070696_10000013910 | 138 |
| 197 | 3300005547 | Ga0070693_100719677 | Ga0070693_1007196771 | 138 |
| 198 | 3300005548 | Ga0070665_100002281 | Ga0070665_10000228113 | 138 |
| 199 | 3300005548 | Ga0070665_101790414 | Ga0070665_1017904141 | 138 |
| 200 | 3300005549 | Ga0070704_100058662 | Ga0070704_1000586625 | 138 |
| 201 | 3300005549 | Ga0070704_100236602 | Ga0070704_1002366022 | 138 |
| 202 | 3300005549 | Ga0070704_100725711 | Ga0070704_1007257111 | 138 |
| 203 | 3300005549 | Ga0070704_101252564 | Ga0070704_1012525641 | 138 |
| 204 | 3300005563 | Ga0068855_101144913 | Ga0068855_1011449131 | 138 |
| 205 | 3300005564 | Ga0070664_100011848 | Ga0070664_1000118482 | 138 |
| 206 | 3300005564 | Ga0070664_100338092 | Ga0070664_1003380922 | 138 |
| 207 | 3300005564 | Ga0070664_100898856 | Ga0070664_1008988562 | 138 |
| 208 | 3300005577 | Ga0068857_100030919 | Ga0068857_1000309196 | 138 |
| 209 | 3300005577 | Ga0068857_100442222 | Ga0068857_1004422222 | 138 |
| 210 | 3300005578 | Ga0068854_100048700 | Ga0068854_1000487003 | 138 |
| 211 | 3300005615 | Ga0070702_100001352 | Ga0070702_1000013525 | 138 |
| 212 | 3300005615 | Ga0070702_100014861 | Ga0070702_1000148612 | 138 |
| 213 | 3300005615 | Ga0070702_100080529 | Ga0070702_1000805293 | 138 |
| 214 | 3300005616 | Ga0068852_100212705 | Ga0068852_1002127052 | 138 |
| 215 | 3300005616 | Ga0068852_100395631 | Ga0068852_1003956311 | 138 |
| 216 | 3300005616 | Ga0068852_100626788 | Ga0068852_1006267881 | 138 |
| 217 | 3300005616 | Ga0068852_100752774 | Ga0068852_1007527742 | 138 |
| 218 | 3300005617 | Ga0068859_100008136 | Ga0068859_1000081368 | 138 |
| 219 | 3300005617 | Ga0068859_100061047 | Ga0068859_1000610473 | 138 |
| 220 | 3300005617 | Ga0068859_100139918 | Ga0068859_1001399183 | 138 |
| 221 | 3300005617 | Ga0068859_100149513 | Ga0068859_1001495134 | 138 |
| 222 | 3300005617 | Ga0068859_100266103 | Ga0068859_1002661032 | 138 |
| 223 | 3300005617 | Ga0068859_100282822 | Ga0068859_1002828223 | 138 |
| 224 | 3300005617 | Ga0068859_100586155 | Ga0068859_1005861552 | 138 |
| 225 | 3300005617 | Ga0068859_100853168 | Ga0068859_1008531682 | 138 |
| 226 | 3300005617 | Ga0068859_101110656 | Ga0068859_1011106562 | 138 |
| 227 | 3300005617 | Ga0068859_101203199 | Ga0068859_1012031991 | 138 |
| 228 | 3300005618 | Ga0068864_100024466 | Ga0068864_1000244666 | 138 |
| 229 | 3300005618 | Ga0068864_100139734 | Ga0068864_1001397343 | 138 |
| 230 | 3300005618 | Ga0068864_100220586 | Ga0068864_1002205863 | 138 |
| 231 | 3300005618 | Ga0068864_100224395 | Ga0068864_1002243952 | 138 |
| 232 | 3300005618 | Ga0068864_100411615 | Ga0068864_1004116151 | 138 |
| 233 | 3300005718 | Ga0068866_10014712 | Ga0068866_100147124 | 138 |
| 234 | 3300005718 | Ga0068866_10816868 | Ga0068866_108168681 | 138 |
| 235 | 3300005719 | Ga0068861_100003999 | Ga0068861_1000039992 | 138 |
| 236 | 3300005719 | Ga0068861_100575608 | Ga0068861_1005756083 | 138 |
| 237 | 3300005719 | Ga0068861_100595739 | Ga0068861_1005957391 | 138 |
| 238 | 3300005834 | Ga0068851_10073785 | Ga0068851_100737852 | 138 |
| 239 | 3300005834 | Ga0068851_10632961 | Ga0068851_106329611 | 138 |
| 240 | 3300005840 | Ga0068870_10002276 | Ga0068870_100022764 | 138 |
| 241 | 3300005840 | Ga0068870_10021401 | Ga0068870_100214012 | 138 |
| 242 | 3300005840 | Ga0068870_10116139 | Ga0068870_101161393 | 138 |
| 243 | 3300005841 | Ga0068863_100008012 | Ga0068863_1000080128 | 138 |
| 244 | 3300005841 | Ga0068863_100065528 | Ga0068863_1000655285 | 138 |
| 245 | 3300005841 | Ga0068863_100137664 | Ga0068863_1001376642 | 138 |
| 246 | 3300005841 | Ga0068863_100330393 | Ga0068863_1003303932 | 138 |
| 247 | 3300005841 | Ga0068863_100378544 | Ga0068863_1003785443 | 138 |
| 248 | 3300005841 | Ga0068863_101073862 | Ga0068863_1010738621 | 138 |
| 249 | 3300005842 | Ga0068858_100017955 | Ga0068858_1000179554 | 138 |
| 250 | 3300005842 | Ga0068858_100044696 | Ga0068858_1000446962 | 138 |
| 251 | 3300005842 | Ga0068858_100109092 | Ga0068858_1001090923 | 138 |
| 252 | 3300005842 | Ga0068858_100562876 | Ga0068858_1005628762 | 138 |
| 253 | 3300005843 | Ga0068860_100027062 | Ga0068860_1000270623 | 138 |
| 254 | 3300005843 | Ga0068860_100156293 | Ga0068860_1001562933 | 138 |
| 255 | 3300005843 | Ga0068860_100177629 | Ga0068860_1001776292 | 138 |
| 256 | 3300005843 | Ga0068860_100582643 | Ga0068860_1005826432 | 138 |
| 257 | 3300005843 | Ga0068860_102144439 | Ga0068860_1021444392 | 138 |
| 258 | 3300005844 | Ga0068862_100047227 | Ga0068862_1000472274 | 138 |
| 259 | 3300005844 | Ga0068862_100279952 | Ga0068862_1002799522 | 138 |
| 260 | 3300005844 | Ga0068862_100368737 | Ga0068862_1003687373 | 138 |
| 261 | 3300005844 | Ga0068862_101915203 | Ga0068862_1019152031 | 138 |
| 262 | 3300005937 | Ga0081455_10049151 | Ga0081455_100491513 | 138 |
| 263 | 3300005937 | Ga0081455_11025349 | Ga0081455_110253491 | 138 |
| 264 | 3300006038 | Ga0075365_10579676 | Ga0075365_105796761 | 138 |
| 265 | 3300006042 | Ga0075368_10136287 | Ga0075368_101362872 | 138 |
| 266 | 3300006048 | Ga0075363_100460400 | Ga0075363_1004604002 | 138 |
| 267 | 3300006051 | Ga0075364_10021461 | Ga0075364_100214612 | 138 |
| 268 | 3300006058 | Ga0075432_10236886 | Ga0075432_102368862 | 138 |
| 269 | 3300006163 | Ga0070715_10865485 | Ga0070715_108654851 | 138 |
| 270 | 3300006173 | Ga0070716_100143342 | Ga0070716_1001433422 | 138 |
| 271 | 3300006178 | Ga0075367_10049319 | Ga0075367_100493193 | 138 |
| 272 | 3300006186 | Ga0075369_10210019 | Ga0075369_102100192 | 138 |
| 273 | 3300006237 | Ga0097621_100064160 | Ga0097621_1000641605 | 138 |
| 274 | 3300006237 | Ga0097621_100148642 | Ga0097621_1001486422 | 138 |
| 275 | 3300006237 | Ga0097621_100208888 | Ga0097621_1002088883 | 138 |
| 276 | 3300006237 | Ga0097621_101183110 | Ga0097621_1011831101 | 138 |
| 277 | 3300006353 | Ga0075370_10305278 | Ga0075370_103052782 | 138 |
| 278 | 3300006358 | Ga0068871_100436581 | Ga0068871_1004365812 | 138 |
| 279 | 3300006358 | Ga0068871_100455679 | Ga0068871_1004556791 | 138 |
| 280 | 3300006358 | Ga0068871_100559085 | Ga0068871_1005590852 | 138 |
| 281 | 3300006358 | Ga0068871_100562861 | Ga0068871_1005628613 | 138 |
| 282 | 3300006358 | Ga0068871_100831364 | Ga0068871_1008313641 | 138 |
| 283 | 3300006844 | Ga0075428_100015340 | Ga0075428_1000153408 | 138 |
| 284 | 3300006844 | Ga0075428_101279264 | Ga0075428_1012792642 | 138 |
| 285 | 3300006852 | Ga0075433_10010141 | Ga0075433_100101413 | 138 |
| 286 | 3300006852 | Ga0075433_10072163 | Ga0075433_100721634 | 138 |
| 287 | 3300006852 | Ga0075433_10137458 | Ga0075433_101374582 | 138 |
| 288 | 3300006852 | Ga0075433_10562128 | Ga0075433_105621281 | 138 |
| 289 | 3300006871 | Ga0075434_100010589 | Ga0075434_1000105898 | 138 |
| 290 | 3300006871 | Ga0075434_100116584 | Ga0075434_1001165844 | 138 |
| 291 | 3300006871 | Ga0075434_100120821 | Ga0075434_1001208214 | 138 |
| 292 | 3300006871 | Ga0075434_100209203 | Ga0075434_1002092033 | 138 |
| 293 | 3300006871 | Ga0075434_100876875 | Ga0075434_1008768751 | 138 |
| 294 | 3300006880 | Ga0075429_100096236 | Ga0075429_1000962362 | 138 |
| 295 | 3300006881 | Ga0068865_100129755 | Ga0068865_1001297552 | 138 |
| 296 | 3300006881 | Ga0068865_100273617 | Ga0068865_1002736172 | 138 |
| 297 | 3300006881 | Ga0068865_100529034 | Ga0068865_1005290342 | 138 |
| 298 | 3300006914 | Ga0075436_100092788 | Ga0075436_1000927882 | 138 |
| 299 | 3300006914 | Ga0075436_101343189 | Ga0075436_1013431891 | 138 |
| 300 | 3300006931 | Ga0097620_100008136 | Ga0097620_1000081368 | 138 |
| 301 | 3300006931 | Ga0097620_100061048 | Ga0097620_1000610485 | 138 |
| 302 | 3300006931 | Ga0097620_100139921 | Ga0097620_1001399212 | 138 |
| 303 | 3300006931 | Ga0097620_100149501 | Ga0097620_1001495014 | 138 |
| 304 | 3300006931 | Ga0097620_100266113 | Ga0097620_1002661132 | 138 |
| 305 | 3300006931 | Ga0097620_100282827 | Ga0097620_1002828272 | 138 |
| 306 | 3300006931 | Ga0097620_100586157 | Ga0097620_1005861572 | 138 |
| 307 | 3300006931 | Ga0097620_100853201 | Ga0097620_1008532012 | 138 |
| 308 | 3300006931 | Ga0097620_101055297 | Ga0097620_1010552972 | 138 |
| 309 | 3300006931 | Ga0097620_101110545 | Ga0097620_1011105452 | 138 |
| 310 | 3300006931 | Ga0097620_101203189 | Ga0097620_1012031892 | 138 |
| 311 | 3300007076 | Ga0075435_100003148 | Ga0075435_1000031488 | 138 |
| 312 | 3300007076 | Ga0075435_100246914 | Ga0075435_1002469142 | 138 |
| 313 | 3300009093 | Ga0105240_10886558 | Ga0105240_108865582 | 138 |
| 314 | 3300009094 | Ga0111539_10038271 | Ga0111539_100382717 | 138 |
| 315 | 3300009094 | Ga0111539_10076896 | Ga0111539_100768965 | 138 |
| 316 | 3300009094 | Ga0111539_10098220 | Ga0111539_100982203 | 138 |
| 317 | 3300009094 | Ga0111539_10290994 | Ga0111539_102909942 | 138 |
| 318 | 3300009094 | Ga0111539_10795095 | Ga0111539_107950952 | 138 |
| 319 | 3300009094 | Ga0111539_11292240 | Ga0111539_112922401 | 138 |
| 320 | 3300009098 | Ga0105245_10021070 | Ga0105245_100210707 | 138 |
| 321 | 3300009098 | Ga0105245_10087577 | Ga0105245_100875772 | 138 |
| 322 | 3300009098 | Ga0105245_10105160 | Ga0105245_101051602 | 138 |
| 323 | 3300009101 | Ga0105247_10011072 | Ga0105247_100110725 | 138 |
| 324 | 3300009147 | Ga0114129_10152136 | Ga0114129_101521361 | 138 |
| 325 | 3300009147 | Ga0114129_10560789 | Ga0114129_105607893 | 138 |
| 326 | 3300009147 | Ga0114129_11499005 | Ga0114129_114990051 | 138 |
| 327 | 3300009147 | Ga0114129_11670967 | Ga0114129_116709672 | 138 |
| 328 | 3300009147 | Ga0114129_12337654 | Ga0114129_123376541 | 138 |
| 329 | 3300009148 | Ga0105243_10392677 | Ga0105243_103926773 | 138 |
| 330 | 3300009148 | Ga0105243_10480418 | Ga0105243_104804182 | 138 |
| 331 | 3300009148 | Ga0105243_11808069 | Ga0105243_118080691 | 138 |
| 332 | 3300009174 | Ga0105241_10443791 | Ga0105241_104437912 | 138 |
| 333 | 3300009174 | Ga0105241_11351626 | Ga0105241_113516262 | 138 |
| 334 | 3300009176 | Ga0105242_10040109 | Ga0105242_100401094 | 138 |
| 335 | 3300009176 | Ga0105242_10081955 | Ga0105242_100819552 | 138 |
| 336 | 3300009177 | Ga0105248_10012713 | Ga0105248_100127134 | 138 |
| 337 | 3300009177 | Ga0105248_10016697 | Ga0105248_100166976 | 138 |
| 338 | 3300009177 | Ga0105248_10147607 | Ga0105248_101476073 | 138 |
| 339 | 3300009177 | Ga0105248_10343732 | Ga0105248_103437322 | 138 |
| 340 | 3300009177 | Ga0105248_10376695 | Ga0105248_103766952 | 138 |
| 341 | 3300009177 | Ga0105248_10749130 | Ga0105248_107491302 | 138 |
| 342 | 3300009177 | Ga0105248_12788511 | Ga0105248_127885112 | 138 |
| 343 | 3300009551 | Ga0105238_10630599 | Ga0105238_106305992 | 138 |
| 344 | 3300009551 | Ga0105238_11405115 | Ga0105238_114051152 | 138 |
| 345 | 3300009553 | Ga0105249_10013317 | Ga0105249_100133172 | 138 |
| 346 | 3300009553 | Ga0105249_11282879 | Ga0105249_112828792 | 138 |
| 347 | 3300010375 | Ga0105239_12204528 | Ga0105239_122045281 | 138 |
| 348 | 3300011119 | Ga0105246_10133502 | Ga0105246_101335023 | 138 |
| 349 | 3300011119 | Ga0105246_10140078 | Ga0105246_101400781 | 138 |
| 350 | 3300011119 | Ga0105246_10154402 | Ga0105246_101544022 | 138 |
| 351 | 3300011119 | Ga0105246_10528273 | Ga0105246_105282732 | 138 |
| 352 | 3300013105 | Ga0157369_10073719 | Ga0157369_100737192 | 138 |
| 353 | 3300013296 | Ga0157374_10005772 | Ga0157374_100057724 | 138 |
| 354 | 3300013296 | Ga0157374_10524731 | Ga0157374_105247313 | 138 |
| 355 | 3300013296 | Ga0157374_11114785 | Ga0157374_111147852 | 138 |
| 356 | 3300013297 | Ga0157378_10481020 | Ga0157378_104810203 | 138 |
| 357 | 3300013297 | Ga0157378_10578753 | Ga0157378_105787532 | 138 |
| 358 | 3300013297 | Ga0157378_10940107 | Ga0157378_109401072 | 138 |
| 359 | 3300013297 | Ga0157378_11714476 | Ga0157378_117144762 | 138 |
| 360 | 3300013297 | Ga0157378_12152645 | Ga0157378_121526451 | 138 |
| 361 | 3300013306 | Ga0163162_10091980 | Ga0163162_100919802 | 138 |
| 362 | 3300013306 | Ga0163162_10300998 | Ga0163162_103009982 | 138 |
| 363 | 3300013306 | Ga0163162_10358670 | Ga0163162_103586702 | 138 |
| 364 | 3300013308 | Ga0157375_10236291 | Ga0157375_102362913 | 138 |
| 365 | 3300013308 | Ga0157375_10655377 | Ga0157375_106553773 | 138 |
| 366 | 3300013308 | Ga0157375_11624837 | Ga0157375_116248371 | 138 |
| 367 | 3300013308 | Ga0157375_11708351 | Ga0157375_117083512 | 138 |
| 368 | 3300013308 | Ga0157375_12154389 | Ga0157375_121543891 | 138 |
| 369 | 3300014325 | Ga0163163_10008708 | Ga0163163_100087085 | 138 |
| 370 | 3300014325 | Ga0163163_10226472 | Ga0163163_102264722 | 138 |
| 371 | 3300014325 | Ga0163163_10519543 | Ga0163163_105195432 | 138 |
| 372 | 3300014325 | Ga0163163_11144980 | Ga0163163_111449802 | 138 |
| 373 | 3300014325 | Ga0163163_12373316 | Ga0163163_123733161 | 138 |
| 374 | 3300014326 | Ga0157380_10237373 | Ga0157380_102373732 | 138 |
| 375 | 3300014326 | Ga0157380_10296274 | Ga0157380_102962743 | 138 |
| 376 | 3300014326 | Ga0157380_10816630 | Ga0157380_108166302 | 138 |
| 377 | 3300014745 | Ga0157377_10260035 | Ga0157377_102600352 | 138 |
| 378 | 3300014745 | Ga0157377_10789689 | Ga0157377_107896891 | 138 |
| 379 | 3300014968 | Ga0157379_10040715 | Ga0157379_100407152 | 138 |
| 380 | 3300014968 | Ga0157379_10041656 | Ga0157379_100416562 | 138 |
| 381 | 3300014968 | Ga0157379_10071635 | Ga0157379_100716352 | 138 |
| 382 | 3300014968 | Ga0157379_11753238 | Ga0157379_117532381 | 138 |
| 383 | 3300014969 | Ga0157376_10028229 | Ga0157376_100282292 | 138 |
| 384 | 3300014969 | Ga0157376_10036669 | Ga0157376_100366691 | 138 |
| 385 | 3300014969 | Ga0157376_10093640 | Ga0157376_100936403 | 138 |
| 386 | 3300014969 | Ga0157376_10172439 | Ga0157376_101724393 | 138 |
| 387 | 3300014969 | Ga0157376_10433947 | Ga0157376_104339471 | 138 |
| 388 | 3300025271 | Ga0207666_1009081 | Ga0207666_10090811 | 138 |
| 389 | 3300025315 | Ga0207697_10030192 | Ga0207697_100301923 | 138 |
| 390 | 3300025321 | Ga0207656_10054451 | Ga0207656_100544512 | 138 |
| 391 | 3300025885 | Ga0207653_10054460 | Ga0207653_100544602 | 138 |
| 392 | 3300025893 | Ga0207682_10073963 | Ga0207682_100739633 | 138 |
| 393 | 3300025899 | Ga0207642_10039001 | Ga0207642_100390012 | 138 |
| 394 | 3300025900 | Ga0207710_10013426 | Ga0207710_100134264 | 138 |
| 395 | 3300025903 | Ga0207680_10051906 | Ga0207680_100519063 | 138 |
| 396 | 3300025903 | Ga0207680_10156834 | Ga0207680_101568342 | 138 |
| 397 | 3300025904 | Ga0207647_10388961 | Ga0207647_103889611 | 138 |
| 398 | 3300025904 | Ga0207647_10434019 | Ga0207647_104340191 | 138 |
| 399 | 3300025905 | Ga0207685_10466500 | Ga0207685_104665001 | 138 |
| 400 | 3300025906 | Ga0207699_10044655 | Ga0207699_100446552 | 138 |
| 401 | 3300025907 | Ga0207645_10086341 | Ga0207645_100863413 | 138 |
| 402 | 3300025907 | Ga0207645_10404308 | Ga0207645_104043081 | 138 |
| 403 | 3300025908 | Ga0207643_10005644 | Ga0207643_100056444 | 138 |
| 404 | 3300025908 | Ga0207643_10027486 | Ga0207643_100274866 | 138 |
| 405 | 3300025908 | Ga0207643_10199487 | Ga0207643_101994873 | 138 |
| 406 | 3300025911 | Ga0207654_10333357 | Ga0207654_103333571 | 138 |
| 407 | 3300025911 | Ga0207654_10541324 | Ga0207654_105413241 | 138 |
| 408 | 3300025912 | Ga0207707_10002331 | Ga0207707_1000233120 | 138 |
| 409 | 3300025917 | Ga0207660_10078893 | Ga0207660_100788932 | 138 |
| 410 | 3300025917 | Ga0207660_10129911 | Ga0207660_101299113 | 138 |
| 411 | 3300025918 | Ga0207662_10006037 | Ga0207662_100060371 | 138 |
| 412 | 3300025918 | Ga0207662_10131960 | Ga0207662_101319601 | 138 |
| 413 | 3300025918 | Ga0207662_10784737 | Ga0207662_107847371 | 138 |
| 414 | 3300025920 | Ga0207649_10229968 | Ga0207649_102299683 | 138 |
| 415 | 3300025920 | Ga0207649_10677644 | Ga0207649_106776441 | 138 |
| 416 | 3300025921 | Ga0207652_10177492 | Ga0207652_101774922 | 138 |
| 417 | 3300025922 | Ga0207646_10213937 | Ga0207646_102139372 | 138 |
| 418 | 3300025922 | Ga0207646_10649260 | Ga0207646_106492601 | 138 |
| 419 | 3300025923 | Ga0207681_10002833 | Ga0207681_100028332 | 138 |
| 420 | 3300025923 | Ga0207681_10181784 | Ga0207681_101817842 | 138 |
| 421 | 3300025923 | Ga0207681_10414341 | Ga0207681_104143412 | 138 |
| 422 | 3300025924 | Ga0207694_11136540 | Ga0207694_111365401 | 138 |
| 423 | 3300025925 | Ga0207650_10037170 | Ga0207650_100371703 | 138 |
| 424 | 3300025925 | Ga0207650_10071265 | Ga0207650_100712651 | 138 |
| 425 | 3300025925 | Ga0207650_10116418 | Ga0207650_101164181 | 138 |
| 426 | 3300025925 | Ga0207650_10392811 | Ga0207650_103928111 | 138 |
| 427 | 3300025926 | Ga0207659_10004564 | Ga0207659_100045643 | 138 |
| 428 | 3300025926 | Ga0207659_10009311 | Ga0207659_100093115 | 138 |
| 429 | 3300025926 | Ga0207659_10075213 | Ga0207659_100752131 | 138 |
| 430 | 3300025926 | Ga0207659_10140147 | Ga0207659_101401473 | 138 |
| 431 | 3300025926 | Ga0207659_10214879 | Ga0207659_102148792 | 138 |
| 432 | 3300025927 | Ga0207687_10028425 | Ga0207687_100284253 | 138 |
| 433 | 3300025927 | Ga0207687_10431668 | Ga0207687_104316682 | 138 |
| 434 | 3300025931 | Ga0207644_10044383 | Ga0207644_100443831 | 138 |
| 435 | 3300025931 | Ga0207644_10147934 | Ga0207644_101479342 | 138 |
| 436 | 3300025931 | Ga0207644_10911801 | Ga0207644_109118011 | 138 |
| 437 | 3300025933 | Ga0207706_10080619 | Ga0207706_100806194 | 138 |
| 438 | 3300025933 | Ga0207706_10670085 | Ga0207706_106700852 | 138 |
| 439 | 3300025934 | Ga0207686_10065762 | Ga0207686_100657623 | 138 |
| 440 | 3300025934 | Ga0207686_10515169 | Ga0207686_105151692 | 138 |
| 441 | 3300025935 | Ga0207709_10077526 | Ga0207709_100775263 | 138 |
| 442 | 3300025935 | Ga0207709_10279372 | Ga0207709_102793722 | 138 |
| 443 | 3300025936 | Ga0207670_10005144 | Ga0207670_100051448 | 138 |
| 444 | 3300025936 | Ga0207670_10043284 | Ga0207670_100432842 | 138 |
| 445 | 3300025936 | Ga0207670_10684135 | Ga0207670_106841352 | 138 |
| 446 | 3300025937 | Ga0207669_10108544 | Ga0207669_101085442 | 138 |
| 447 | 3300025937 | Ga0207669_10126398 | Ga0207669_101263981 | 138 |
| 448 | 3300025937 | Ga0207669_10559842 | Ga0207669_105598422 | 138 |
| 449 | 3300025939 | Ga0207665_10052202 | Ga0207665_100522022 | 138 |
| 450 | 3300025940 | Ga0207691_10063783 | Ga0207691_100637833 | 138 |
| 451 | 3300025940 | Ga0207691_10090278 | Ga0207691_100902783 | 138 |
| 452 | 3300025940 | Ga0207691_10146651 | Ga0207691_101466512 | 138 |
| 453 | 3300025940 | Ga0207691_10227586 | Ga0207691_102275862 | 138 |
| 454 | 3300025940 | Ga0207691_10785184 | Ga0207691_107851841 | 138 |
| 455 | 3300025940 | Ga0207691_11251229 | Ga0207691_112512291 | 138 |
| 456 | 3300025941 | Ga0207711_10016981 | Ga0207711_100169816 | 138 |
| 457 | 3300025941 | Ga0207711_10019080 | Ga0207711_100190804 | 138 |
| 458 | 3300025941 | Ga0207711_10697282 | Ga0207711_106972822 | 138 |
| 459 | 3300025941 | Ga0207711_11684745 | Ga0207711_116847451 | 138 |
| 460 | 3300025942 | Ga0207689_10029115 | Ga0207689_100291154 | 138 |
| 461 | 3300025942 | Ga0207689_10089714 | Ga0207689_100897142 | 138 |
| 462 | 3300025942 | Ga0207689_10256063 | Ga0207689_102560632 | 138 |
| 463 | 3300025942 | Ga0207689_11368388 | Ga0207689_113683881 | 138 |
| 464 | 3300025944 | Ga0207661_10227638 | Ga0207661_102276383 | 138 |
| 465 | 3300025945 | Ga0207679_10136904 | Ga0207679_101369042 | 138 |
| 466 | 3300025945 | Ga0207679_10927422 | Ga0207679_109274222 | 138 |
| 467 | 3300025960 | Ga0207651_10030586 | Ga0207651_100305862 | 138 |
| 468 | 3300025960 | Ga0207651_10088252 | Ga0207651_100882523 | 138 |
| 469 | 3300025960 | Ga0207651_10107092 | Ga0207651_101070923 | 138 |
| 470 | 3300025960 | Ga0207651_10922076 | Ga0207651_109220761 | 138 |
| 471 | 3300025960 | Ga0207651_10931858 | Ga0207651_109318581 | 138 |
| 472 | 3300025961 | Ga0207712_10613650 | Ga0207712_106136501 | 138 |
| 473 | 3300025972 | Ga0207668_10197839 | Ga0207668_101978392 | 138 |
| 474 | 3300025981 | Ga0207640_10219179 | Ga0207640_102191792 | 138 |
| 475 | 3300025986 | Ga0207658_10134519 | Ga0207658_101345193 | 138 |
| 476 | 3300025986 | Ga0207658_10767350 | Ga0207658_107673501 | 138 |
| 477 | 3300026023 | Ga0207677_10018548 | Ga0207677_100185485 | 138 |
| 478 | 3300026023 | Ga0207677_10215836 | Ga0207677_102158362 | 138 |
| 479 | 3300026023 | Ga0207677_10263549 | Ga0207677_102635492 | 138 |
| 480 | 3300026023 | Ga0207677_10360007 | Ga0207677_103600072 | 138 |
| 481 | 3300026035 | Ga0207703_10004498 | Ga0207703_1000449814 | 138 |
| 482 | 3300026035 | Ga0207703_10023908 | Ga0207703_100239084 | 138 |
| 483 | 3300026035 | Ga0207703_10134964 | Ga0207703_101349642 | 138 |
| 484 | 3300026035 | Ga0207703_10170408 | Ga0207703_101704082 | 138 |
| 485 | 3300026035 | Ga0207703_10688354 | Ga0207703_106883542 | 138 |
| 486 | 3300026041 | Ga0207639_10298134 | Ga0207639_102981342 | 138 |
| 487 | 3300026075 | Ga0207708_10020209 | Ga0207708_100202096 | 138 |
| 488 | 3300026075 | Ga0207708_10036795 | Ga0207708_100367952 | 138 |
| 489 | 3300026075 | Ga0207708_10049016 | Ga0207708_100490163 | 138 |
| 490 | 3300026075 | Ga0207708_10381391 | Ga0207708_103813912 | 138 |
| 491 | 3300026078 | Ga0207702_12225006 | Ga0207702_122250061 | 138 |
| 492 | 3300026088 | Ga0207641_10045110 | Ga0207641_100451104 | 138 |
| 493 | 3300026088 | Ga0207641_10048860 | Ga0207641_100488602 | 138 |
| 494 | 3300026088 | Ga0207641_10091025 | Ga0207641_100910252 | 138 |
| 495 | 3300026088 | Ga0207641_10092906 | Ga0207641_100929062 | 138 |
| 496 | 3300026088 | Ga0207641_10282042 | Ga0207641_102820423 | 138 |
| 497 | 3300026088 | Ga0207641_11063194 | Ga0207641_110631942 | 138 |
| 498 | 3300026088 | Ga0207641_11763458 | Ga0207641_117634581 | 138 |
| 499 | 3300026089 | Ga0207648_10000844 | Ga0207648_100008447 | 138 |
| 500 | 3300026089 | Ga0207648_10081967 | Ga0207648_100819671 | 138 |
| 501 | 3300026089 | Ga0207648_10284180 | Ga0207648_102841802 | 138 |
| 502 | 3300026089 | Ga0207648_10383397 | Ga0207648_103833973 | 138 |
| 503 | 3300026095 | Ga0207676_10058395 | Ga0207676_100583954 | 138 |
| 504 | 3300026095 | Ga0207676_10072530 | Ga0207676_100725301 | 138 |
| 505 | 3300026095 | Ga0207676_10132112 | Ga0207676_101321123 | 138 |
| 506 | 3300026095 | Ga0207676_10198270 | Ga0207676_101982702 | 138 |
| 507 | 3300026095 | Ga0207676_10280606 | Ga0207676_102806062 | 138 |
| 508 | 3300026116 | Ga0207674_10009268 | Ga0207674_1000926814 | 138 |
| 509 | 3300026116 | Ga0207674_10119086 | Ga0207674_101190862 | 138 |
| 510 | 3300026116 | Ga0207674_10981151 | Ga0207674_109811512 | 138 |
| 511 | 3300026116 | Ga0207674_11827751 | Ga0207674_118277511 | 138 |
| 512 | 3300026118 | Ga0207675_100001335 | Ga0207675_10000133524 | 138 |
| 513 | 3300026118 | Ga0207675_100113852 | Ga0207675_1001138524 | 138 |
| 514 | 3300026118 | Ga0207675_100218887 | Ga0207675_1002188872 | 138 |
| 515 | 3300026118 | Ga0207675_100861803 | Ga0207675_1008618031 | 138 |
| 516 | 3300026121 | Ga0207683_10047044 | Ga0207683_100470444 | 138 |
| 517 | 3300026121 | Ga0207683_10083670 | Ga0207683_100836703 | 138 |
| 518 | 3300026142 | Ga0207698_10272137 | Ga0207698_102721372 | 138 |
| 519 | 3300027866 | Ga0209813_10136239 | Ga0209813_101362392 | 138 |
| 520 | 3300027907 | Ga0207428_10056271 | Ga0207428_100562713 | 138 |
| 521 | 3300027907 | Ga0207428_10271485 | Ga0207428_102714853 | 138 |
| 522 | 3300027907 | Ga0207428_11008650 | Ga0207428_110086501 | 138 |
| 523 | 3300028379 | Ga0268266_10009932 | Ga0268266_100099327 | 138 |
| 524 | 3300028379 | Ga0268266_10261848 | Ga0268266_102618482 | 138 |
| 525 | 3300028379 | Ga0268266_11289845 | Ga0268266_112898451 | 138 |
| 526 | 3300028380 | Ga0268265_10006637 | Ga0268265_100066372 | 138 |
| 527 | 3300028380 | Ga0268265_10346621 | Ga0268265_103466212 | 138 |
| 528 | 3300028380 | Ga0268265_11665896 | Ga0268265_116658961 | 138 |
| 529 | 3300028381 | Ga0268264_10112212 | Ga0268264_101122123 | 138 |
| 530 | 3300028381 | Ga0268264_10533758 | Ga0268264_105337582 | 138 |
| 531 | 3300028381 | Ga0268264_10871876 | Ga0268264_108718762 | 138 |
| 532 | 3300028381 | Ga0268264_10912349 | Ga0268264_109123491 | 138 |
| 533 | 3300028381 | Ga0268264_10917398 | Ga0268264_109173982 | 138 |
| 534 | 3300031090 | Ga0265760_10025103 | Ga0265760_100251032 | 138 |
| 535 | 3300035091 | Ga0373951_0077844 | Ga0373951_0077844_297_734 | 138 |
| 536 | 3300035092 | Ga0373952_0250388 | Ga0373952_0250388_15_452 | 138 |
| 537 | 3300035112 | Ga0373932_0035450 | Ga0373932_0035450_900_1337 | 138 |
| 538 | 3300035114 | Ga0373939_0242188 | Ga0373939_0242188_65_502 | 138 |
| 539 | 3300035115 | Ga0373941_0012238 | Ga0373941_0012238_1277_1714 | 138 |
| 540 | 3300035118 | Ga0373954_0267417 | Ga0373954_0267417_218_655 | 138 |
| 541 | 3300035118 | Ga0373954_0284684 | Ga0373954_0284684_359_799 | 138 |
| 542 | 3300035119 | Ga0373956_0014364 | Ga0373956_0014364_964_1398 | 138 |
| 543 | 3300035119 | Ga0373956_0026411 | Ga0373956_0026411_1909_2346 | 138 |
| 544 | 3300035170 | Ga0373943_0579272 | Ga0373943_0579272_101_538 | 138 |
| 545 | 3300035172 | Ga0373955_0069612 | Ga0373955_0069612_1300_1743 | 138 |
| 546 | 3300035172 | Ga0373955_0099850 | Ga0373955_0099850_688_1125 | 138 |
| 547 | 3300035172 | Ga0373955_0870082 | Ga0373955_0870082_23_463 | 138 |
| 548 | 3300035241 | Ga0373961_0089640 | Ga0373961_0089640_299_736 | 138 |
| 549 | 3300035691 | Ga0373931_0233620 | Ga0373931_0233620_138_575 | 138 |
| 550 | 3300035691 | Ga0373931_0671456 | Ga0373931_0671456_149_586 | 138 |
| 551 | 3300035692 | Ga0373935_0068728 | Ga0373935_0068728_989_1429 | 138 |
| 552 | 3300035692 | Ga0373935_0217476 | Ga0373935_0217476_217_654 | 138 |
| 553 | 3300035692 | Ga0373935_1449759 | Ga0373935_1449759_11_448 | 138 |
| 554 | 3300035695 | Ga0373927_0455479 | Ga0373927_0455479_392_832 | 138 |
| 555 | 3300035695 | Ga0373927_0621610 | Ga0373927_0621610_45_482 | 138 |
| 556 | 3300035724 | Ga0373933_0108697 | Ga0373933_0108697_49_486 | 138 |
| 557 | 3300036401 | Ga0373937_0119345 | Ga0373937_0119345_202_639 | 138 |
| 558 | 3300036401 | Ga0373937_0172060 | Ga0373937_0172060_846_1283 | 138 |
| 559 | 3300037068 | Ga0373925_0133519 | Ga0373925_0133519_218_658 | 138 |
| 560 | 3300037068 | Ga0373925_0458778 | Ga0373925_0458778_150_587 | 138 |
| 561 | 3300042436 | Ga0439435_0029068 | Ga0439435_0029068_968_1402 | 138 |
| 562 | 3300042876 | Ga0451577_0961838 | Ga0451577_0961838_266_703 | 138 |
| 563 | 3300044673 | Ga0453683_0040415 | Ga0453683_0040415_1659_2099 | 138 |
| 564 | 3300044712 | Ga0453684_0206297 | Ga0453684_0206297_1605_2045 | 138 |
| 565 | 3300044712 | Ga0453684_1041784 | Ga0453684_1041784_350_787 | 138 |
| 566 | 3300044712 | Ga0453684_2278021 | Ga0453684_2278021_82_519 | 138 |
| 567 | 3300045051 | Ga0451576_0087303 | Ga0451576_0087303_2756_3193 | 138 |
| 568 | 3300045051 | Ga0451576_0101461 | Ga0451576_0101461_2333_2770 | 138 |
| 569 | 3300045051 | Ga0451576_0325012 | Ga0451576_0325012_904_1341 | 138 |
| 570 | 3300046455 | Ga0495603_0006905 | Ga0495603_0006905_664_1101 | 138 |
| 571 | 3300046472 | Ga0495580_0059640 | Ga0495580_0059640_568_1008 | 138 |
| 572 | 3300046472 | Ga0495580_0755189 | Ga0495580_0755189_59_487 | 138 |
| 573 | 3300046473 | Ga0495582_0338614 | Ga0495582_0338614_369_809 | 138 |
| 574 | 3300046475 | Ga0495639_0247178 | Ga0495639_0247178_180_617 | 138 |
| 575 | 3300046476 | Ga0495662_0043266 | Ga0495662_0043266_168_608 | 138 |
| 576 | 3300046499 | Ga0495594_0023874 | Ga0495594_0023874_2375_2812 | 138 |
| 577 | 3300046501 | Ga0495607_0473772 | Ga0495607_0473772_62_499 | 138 |
| 578 | 3300046517 | Ga0495630_1108629 | Ga0495630_1108629_67_504 | 138 |
| 579 | 3300046517 | Ga0495630_1233074 | Ga0495630_1233074_46_474 | 138 |
| 580 | 3300046525 | Ga0495663_0097205 | Ga0495663_0097205_62_499 | 138 |
| 581 | 3300046528 | Ga0495642_0057380 | Ga0495642_0057380_134_571 | 138 |
| 582 | 3300046528 | Ga0495642_0100233 | Ga0495642_0100233_582_1019 | 138 |
| 583 | 3300046533 | Ga0495640_0326446 | Ga0495640_0326446_448_885 | 138 |
| 584 | 3300046539 | Ga0495621_0212581 | Ga0495621_0212581_41_478 | 138 |
| 585 | 3300046543 | Ga0495645_0031447 | Ga0495645_0031447_1709_2146 | 138 |
| 586 | 3300046543 | Ga0495645_0736936 | Ga0495645_0736936_37_474 | 138 |
| 587 | 3300046558 | Ga0495633_0421100 | Ga0495633_0421100_15_452 | 138 |
| 588 | 3300046559 | Ga0495667_0605302 | Ga0495667_0605302_175_612 | 138 |
| 589 | 3300046648 | Ga0495611_0253885 | Ga0495611_0253885_301_738 | 138 |
| 590 | 3300046664 | Ga0495659_0002267 | Ga0495659_0002267_5492_5929 | 138 |
| 591 | 3300046664 | Ga0495659_0034483 | Ga0495659_0034483_279_716 | 138 |
| 592 | 3300046664 | Ga0495659_0074444 | Ga0495659_0074444_96_533 | 138 |
| 593 | 3300046664 | Ga0495659_0335553 | Ga0495659_0335553_158_595 | 138 |
| 594 | 3300046674 | Ga0495588_0005306 | Ga0495588_0005306_188_625 | 138 |
| 595 | 3300046678 | Ga0495599_0259922 | Ga0495599_0259922_122_559 | 138 |
| 596 | 3300046681 | Ga0495647_0002231 | Ga0495647_0002231_5111_5551 | 138 |
| 597 | 3300046683 | Ga0495658_0103481 | Ga0495658_0103481_63_500 | 138 |
| 598 | 3300046683 | Ga0495658_0678133 | Ga0495658_0678133_82_519 | 138 |
| 599 | 3300046684 | Ga0495669_0007901 | Ga0495669_0007901_2675_3112 | 138 |
| 600 | 3300046689 | Ga0495613_0115078 | Ga0495613_0115078_566_1003 | 138 |
| 601 | 3300046690 | Ga0495624_0831148 | Ga0495624_0831148_42_482 | 138 |
| 602 | 3300046691 | Ga0495670_0044274 | Ga0495670_0044274_1635_2072 | 138 |
| 603 | 3300046809 | Ga0495600_0132661 | Ga0495600_0132661_491_928 | 138 |
| 604 | 3300047318 | Ga0495636_0043461 | Ga0495636_0043461_637_1074 | 138 |
| 605 | 3300047318 | Ga0495636_0057754 | Ga0495636_0057754_502_939 | 138 |
| 606 | 3300047319 | Ga0495674_0858532 | Ga0495674_0858532_52_486 | 138 |
| 607 | 3300047447 | Ga0495685_134363 | Ga0495685_134363_235_672 | 138 |
| 608 | 3300048903 | Ga0496100_0253325 | Ga0496100_0253325_358_798 | 138 |
| 609 | 3300048905 | Ga0496102_0624138 | Ga0496102_0624138_514_951 | 138 |
| 610 | 3300048907 | Ga0496104_0179552 | Ga0496104_0179552_712_1149 | 138 |
| 611 | 3300048907 | Ga0496104_0276825 | Ga0496104_0276825_987_1424 | 138 |
| 612 | 3300048907 | Ga0496104_0636252 | Ga0496104_0636252_252_695 | 138 |
| 613 | 3300048907 | Ga0496104_1176686 | Ga0496104_1176686_131_571 | 138 |
| 614 | 3300048908 | Ga0496105_1147989 | Ga0496105_1147989_65_508 | 138 |
| 615 | 3300048909 | Ga0496106_0395936 | Ga0496106_0395936_351_788 | 138 |
| 616 | 3300048909 | Ga0496106_1079208 | Ga0496106_1079208_76_513 | 138 |
| 617 | 3300048911 | Ga0496108_0296490 | Ga0496108_0296490_27_464 | 138 |
| 618 | 3300048912 | Ga0496109_1533391 | Ga0496109_1533391_58_498 | 138 |
| 619 | 3300048912 | Ga0496109_1846267 | Ga0496109_1846267_21_455 | 138 |
| 620 | 3300048913 | Ga0496110_0657457 | Ga0496110_0657457_303_740 | 138 |
| 621 | 3300048914 | Ga0496111_0809733 | Ga0496111_0809733_13_453 | 138 |
| 622 | 3300048915 | Ga0496112_0012702 | Ga0496112_0012702_1486_1923 | 138 |
| 623 | 3300048915 | Ga0496112_1054240 | Ga0496112_1054240_126_560 | 138 |
| 624 | 3300048915 | Ga0496112_1242032 | Ga0496112_1242032_102_542 | 138 |
| 625 | 3300048916 | Ga0496113_0012726 | Ga0496113_0012726_4901_5338 | 138 |
| 626 | 3300048916 | Ga0496113_0498141 | Ga0496113_0498141_396_830 | 138 |
| 627 | 3300048917 | Ga0496114_0057539 | Ga0496114_0057539_1220_1657 | 138 |
| 628 | 3300049575 | Ga0501039_1543135 | Ga0501039_1543135_27_461 | 138 |
| 629 | 3300049588 | Ga0501072_0303396 | Ga0501072_0303396_655_1119 | 138 |
| 630 | 3300049592 | Ga0501076_0962294 | Ga0501076_0962294_150_614 | 138 |
| 631 | 3300050491 | nmdc:mga00v17_576177_c1 | nmdc:mga00v17_576177_c1_160_597 | 138 |
| 632 | 3300050494 | nmdc:mga06z11_930370_c1 | nmdc:mga06z11_930370_c1_71_508 | 138 |
| 633 | 3300050494 | nmdc:mga06z11_97271_c1 | nmdc:mga06z11_97271_c1_1134_1571 | 138 |
| 634 | 3300050495 | nmdc:mga04h51_132875_c1 | nmdc:mga04h51_132875_c1_80_517 | 138 |
| 635 | 3300050496 | nmdc:mga07m45_531293_c1 | nmdc:mga07m45_531293_c1_219_656 | 138 |
| 636 | 3300050507 | nmdc:mga05p37_151491_c2 | nmdc:mga05p37_151491_c2_949_1386 | 138 |
| 637 | 3300050507 | nmdc:mga05p37_2000542_c1 | nmdc:mga05p37_2000542_c1_89_526 | 138 |
| 638 | 3300050507 | nmdc:mga05p37_2703_c1 | nmdc:mga05p37_2703_c1_7212_7649 | 138 |
| 639 | 3300050511 | nmdc:mga08y16_174979_c1 | nmdc:mga08y16_174979_c1_228_665 | 138 |
| 640 | 3300050511 | nmdc:mga08y16_889174_c1 | nmdc:mga08y16_889174_c1_231_668 | 138 |
| 641 | 3300050512 | nmdc:mga0n895_1547270_c1 | nmdc:mga0n895_1547270_c1_95_532 | 138 |
| 642 | 3300050512 | nmdc:mga0n895_1704806_c1 | nmdc:mga0n895_1704806_c1_142_579 | 138 |
| 643 | 3300050512 | nmdc:mga0n895_20877_c1 | nmdc:mga0n895_20877_c1_1940_2377 | 138 |
| 644 | 3300050512 | nmdc:mga0n895_625324_c1 | nmdc:mga0n895_625324_c1_508_945 | 138 |
| 645 | 3300050513 | nmdc:mga0rr50_283386_c1 | nmdc:mga0rr50_283386_c1_620_1057 | 138 |
| 646 | 3300050513 | nmdc:mga0rr50_8733_c1 | nmdc:mga0rr50_8733_c1_774_1211 | 138 |
| 647 | 3300050514 | nmdc:mga08x19_1094867_c1 | nmdc:mga08x19_1094867_c1_103_540 | 138 |
| 648 | 3300050514 | nmdc:mga08x19_21010_c1 | nmdc:mga08x19_21010_c1_2272_2709 | 138 |
| 649 | 3300050515 | nmdc:mga0a205_22081_c1 | nmdc:mga0a205_22081_c1_924_1361 | 138 |
| 650 | 3300050515 | nmdc:mga0a205_37742_c1 | nmdc:mga0a205_37742_c1_2221_2658 | 138 |
| 651 | 3300050515 | nmdc:mga0a205_435073_c1 | nmdc:mga0a205_435073_c1_225_662 | 138 |
| 652 | 3300050515 | nmdc:mga0a205_6451_c1 | nmdc:mga0a205_6451_c1_6204_6641 | 138 |
| 653 | 3300050516 | nmdc:mga0sz30_432419_c1 | nmdc:mga0sz30_432419_c1_128_565 | 138 |
| 654 | 3300053084 | Ga0495595_0025258 | Ga0495595_0025258_2052_2489 | 138 |
| 655 | 3300053084 | Ga0495595_0361961 | Ga0495595_0361961_227_670 | 138 |
| 656 | 3300053085 | Ga0495619_0473554 | Ga0495619_0473554_369_806 | 138 |
| 657 | 3300030744 | Ga0316181_1222148 | Ga0316181_12221481 | 141 |
| 658 | 3300032004 | Ga0307414_10266110 | Ga0307414_102661102 | 141 |
| 659 | 3300049758 | Ga0501241_002671 | Ga0501241_002671_1118_1549 | 141 |
| 660 | 3300003323 | rootH1_10076471 | rootH1_100764715 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tmh-assembly1.cif.gz_K | cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model | 0.8887 | 18 | 60 |
| 1xvl-assembly3.cif.gz_C | the three-dimensional structure of mntc from synechocystis 6803 | 0.8005 | 18 | 64 |
| 6sdk-assembly1.cif.gz_B | crystal structure of bacterial parb dimer bound to cdp | 0.7475 | 80 | 133 |
| 7nfu-assembly2.cif.gz_B | crystal structure of c-terminally truncated geobacillus thermoleovorans nucleoid occlusion protein noc | 0.7296 | 67 | 131 |
| 6kkm-assembly1.cif.gz_G-2 | crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 | 0.7222 | 69 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jg7B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8841 | 18 | 64 | 3.40.50.1980 |
| af_Q2G118_97_208_1.10.10.2830 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.805 | 95 | 131 | 1.10.10.2830 |
| 1vz0D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.7259 | 79 | 129 | 1.10.10.2830 |
| af_B4FTT4_81_159_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.58 | 17 | 69 | 1.10.287.70 |
| 4v1gB00 | Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C | 0.5201 | 9 | 64 | 1.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2A2Y4-F1-model_v4 | Uncharacterized protein | 0.9751 | 60 | 143 |
|
| AF-A0A519Z5M5-F1-model_v4 | Uncharacterized protein | 0.9572 | 59 | 143 |
|
| AF-A0A223V3F7-F1-model_v4 | Uncharacterized protein | 0.956 | 64 | 143 |
|
| AF-A0A4V2A2Y4-F1-model_v4 | Uncharacterized protein | 0.9529 | 60 | 143 |
|
| AF-A0A0E9MYA1-F1-model_v4 | Uncharacterized protein | 0.9496 | 43 | 143 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar