F473329

General Info

Members Datasets Scaffolds Average Seq Length
660 276 661 144

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10376695|Ga0105248_103766952
Length 154
Sequence MSERREVHMAETRSQSFENHGQYRPEYHIVVFFILLANFLWAGYQLFQGLTGGAVVAFLMSVALIVMFFSVRVQILTVQDRVIRLEMRQRFRSVLAADLANRASSLPLRQIIALRFASDEELPSLVSEVVSGQVTAPKEIKQKVRDWQADHLRA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 3.18
Rhizosphere 94.24
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10076471 3300003316 Bacteria 7886
2 rootH1_10076471 3300003323 Bacteria 4360
3 Ga0065704_10109235 3300005289 Bacteria 2008
4 Ga0065712_10791296 3300005290 Unclassified 515
5 Ga0065715_10266221 3300005293 Bacteria 1121
6 Ga0065715_10382998 3300005293 Bacteria 905
7 Ga0065715_10513686 3300005293 Bacteria 769
8 Ga0065715_10622608 3300005293 Bacteria 694
9 Ga0070658_10948661 3300005327 Bacteria 748
10 Ga0070676_10264070 3300005328 Bacteria 1154
11 Ga0070676_10449532 3300005328 Bacteria 906
12 Ga0070683_100316938 3300005329 Bacteria 1484
13 Ga0070690_100314059 3300005330 Bacteria 1127
14 Ga0070690_100382182 3300005330 Bacteria 1030
15 Ga0070690_100643807 3300005330 Bacteria 809
16 Ga0070670_100009375 3300005331 Bacteria 8356
17 Ga0070670_100014551 3300005331 Bacteria 6755
18 Ga0070670_100047394 3300005331 Bacteria 3698
19 Ga0070670_100163400 3300005331 Bacteria 1930
20 Ga0070670_100467902 3300005331 Bacteria 1118
21 Ga0070670_100531684 3300005331 Bacteria 1048
22 Ga0070670_100562322 3300005331 Bacteria 1018
23 Ga0070677_10066906 3300005333 Bacteria 1499
24 Ga0070677_10088607 3300005333 Bacteria 1341
25 Ga0068869_100054687 3300005334 Bacteria 2907
26 Ga0068869_100077034 3300005334 Bacteria 2480
27 Ga0068869_100574364 3300005334 Bacteria 950
28 Ga0068869_100884767 3300005334 Bacteria 772
29 Ga0070666_10315140 3300005335 Bacteria 1115
30 Ga0070666_10408260 3300005335 Unclassified 977
31 Ga0070666_10581630 3300005335 Bacteria 816
32 Ga0070680_100100391 3300005336 Bacteria 2402
33 Ga0070680_100192659 3300005336 Bacteria 1718
34 Ga0070680_100887199 3300005336 Bacteria 769
35 Ga0068868_100014509 3300005338 Bacteria 5808
36 Ga0068868_100219258 3300005338 Bacteria 1592
37 Ga0068868_100231602 3300005338 Bacteria 1550
38 Ga0068868_100431206 3300005338 Bacteria 1143
39 Ga0068868_101621920 3300005338 Unclassified 608
40 Ga0070689_100003333 3300005340 Bacteria 10671
41 Ga0070689_100562615 3300005340 Bacteria 984
42 Ga0070689_100594899 3300005340 Bacteria 958
43 Ga0070689_100600633 3300005340 Unclassified 953
44 Ga0070691_10025029 3300005341 Bacteria 2778
45 Ga0070691_10189877 3300005341 Unclassified 1074
46 Ga0070691_10541967 3300005341 Bacteria 679
47 Ga0070687_100034188 3300005343 Bacteria 2515
48 Ga0070661_100204768 3300005344 Bacteria 1509
49 Ga0070692_10053084 3300005345 Unclassified 2113
50 Ga0070668_100006903 3300005347 Bacteria 8416
51 Ga0070668_100115454 3300005347 Bacteria 2140
52 Ga0070668_100862997 3300005347 Bacteria 807
53 Ga0070669_100005999 3300005353 Bacteria 8764
54 Ga0070669_100009468 3300005353 Bacteria 6938
55 Ga0070669_100085548 3300005353 Bacteria 2354
56 Ga0070669_100346644 3300005353 Bacteria 1205
57 Ga0070675_100004565 3300005354 Bacteria 10568
58 Ga0070675_100186100 3300005354 Unclassified 1797
59 Ga0070675_100197198 3300005354 Bacteria 1746
60 Ga0070675_100444907 3300005354 Bacteria 1161
61 Ga0070671_100063375 3300005355 Bacteria 3078
62 Ga0070671_100124237 3300005355 Bacteria 2172
63 Ga0070671_100303478 3300005355 Bacteria 1360
64 Ga0070671_100326498 3300005355 Bacteria 1308
65 Ga0070671_100731449 3300005355 Bacteria 859
66 Ga0070674_100079871 3300005356 Bacteria 2334
67 Ga0070674_100624990 3300005356 Bacteria 913
68 Ga0070674_100782503 3300005356 Bacteria 822
69 Ga0070673_100027570 3300005364 Bacteria 4212
70 Ga0070673_100052628 3300005364 Bacteria 3195
71 Ga0070673_100102851 3300005364 Bacteria 2356
72 Ga0070673_100632236 3300005364 Bacteria 978
73 Ga0070673_100863396 3300005364 Archaea 838
74 Ga0070673_101049826 3300005364 Bacteria 760
75 Ga0070688_100036177 3300005365 Unclassified 3002
76 Ga0070688_100331297 3300005365 Unclassified 1109
77 Ga0070688_101605933 3300005365 Bacteria 531
78 Ga0070659_100765813 3300005366 Unclassified 838
79 Ga0070667_100014018 3300005367 Bacteria 6626
80 Ga0070667_100059796 3300005367 Bacteria 3224
81 Ga0070667_100924853 3300005367 Bacteria 812
82 Ga0070667_100954696 3300005367 Unclassified 799
83 Ga0070667_101036043 3300005367 Unclassified 766
84 Ga0070709_10020457 3300005434 Bacteria 3839
85 Ga0070709_10138767 3300005434 Bacteria 1668
86 Ga0070713_100028665 3300005436 Bacteria 4398
87 Ga0070701_10002357 3300005438 Bacteria 7254
88 Ga0070701_10158003 3300005438 Unclassified 1311
89 Ga0070701_10290527 3300005438 Unclassified 1001
90 Ga0070701_10514434 3300005438 Unclassified 779
91 Ga0070711_101069735 3300005439 Archaea 694
92 Ga0070705_100000037 3300005440 Bacteria 66783
93 Ga0070705_101339951 3300005440 Bacteria 595
94 Ga0070700_100051603 3300005441 Bacteria 2561
95 Ga0070700_100069990 3300005441 Bacteria 2236
96 Ga0070700_100245856 3300005441 Bacteria 1281
97 Ga0070700_100570034 3300005441 Bacteria 882
98 Ga0070700_101129841 3300005441 Unclassified 651
99 Ga0070694_100005480 3300005444 Bacteria 7688
100 Ga0070694_100135736 3300005444 Bacteria 1783
101 Ga0070694_100150397 3300005444 Bacteria 1700
102 Ga0070694_100228084 3300005444 Bacteria 1400
103 Ga0070694_100376059 3300005444 Unclassified 1107
104 Ga0070694_100462243 3300005444 Bacteria 1004
105 Ga0070694_100532433 3300005444 Unclassified 939
106 Ga0070694_100602804 3300005444 Bacteria 885
107 Ga0070708_100042068 3300005445 Bacteria 4008
108 Ga0070708_101149493 3300005445 Unclassified 727
109 Ga0070663_100889066 3300005455 Bacteria 769
110 Ga0070678_100028655 3300005456 Bacteria 3801
111 Ga0070678_100090163 3300005456 Bacteria 2349
112 Ga0070678_101864115 3300005456 Unclassified 567
113 Ga0070662_100041354 3300005457 Bacteria 3288
114 Ga0070662_100206567 3300005457 Bacteria 1561
115 Ga0070662_100623348 3300005457 Bacteria 908
116 Ga0070681_10027374 3300005458 Bacteria 5732
117 Ga0068867_100000265 3300005459 Bacteria 34503
118 Ga0068867_100130170 3300005459 Bacteria 1954
119 Ga0070685_10249553 3300005466 Bacteria 1175
120 Ga0070685_10844433 3300005466 Bacteria 678
121 Ga0070685_11048592 3300005466 Bacteria 614
122 Ga0070706_100003738 3300005467 Bacteria 14874
123 Ga0070706_100269592 3300005467 Bacteria 1589
124 Ga0070706_100605121 3300005467 Bacteria 1018
125 Ga0070707_100001201 3300005468 Bacteria 25483
126 Ga0070707_100688457 3300005468 Bacteria 985
127 Ga0070707_101029950 3300005468 Unclassified 789
128 Ga0070707_101263492 3300005468 Bacteria 705
129 Ga0070698_100020353 3300005471 Bacteria 6954
130 Ga0070698_100718544 3300005471 Bacteria 942
131 Ga0070699_100181207 3300005518 Bacteria 1869
132 Ga0070699_100437039 3300005518 Bacteria 1186
133 Ga0070699_102041868 3300005518 Bacteria 524
134 Ga0070679_100020171 3300005530 Bacteria 6496
135 Ga0070679_101653619 3300005530 Unclassified 588
136 Ga0070684_100055686 3300005535 Bacteria 3449
137 Ga0070684_101600719 3300005535 Unclassified 614
138 Ga0070697_100025013 3300005536 Bacteria 4758
139 Ga0070697_100035381 3300005536 Unclassified 4028
140 Ga0070697_100233130 3300005536 Unclassified 1570
141 Ga0070697_100491683 3300005536 Unclassified 1072
142 Ga0068853_100475661 3300005539 Bacteria 1177
143 Ga0070672_100056393 3300005543 Bacteria 3081
144 Ga0070672_100078985 3300005543 Bacteria 2633
145 Ga0070672_100098450 3300005543 Unclassified 2369
146 Ga0070672_100118866 3300005543 Bacteria 2161
147 Ga0070672_100156607 3300005543 Unclassified 1887
148 Ga0070672_100277346 3300005543 Bacteria 1416
149 Ga0070686_100798685 3300005544 Unclassified 760
150 Ga0070695_100001493 3300005545 Bacteria 12980
151 Ga0070695_100142118 3300005545 Unclassified 1666
152 Ga0070695_100186564 3300005545 Bacteria 1473
153 Ga0070695_100957812 3300005545 Unclassified 694
154 Ga0070695_101592368 3300005545 Bacteria 545
155 Ga0070696_100000139 3300005546 Bacteria 39687
156 Ga0070693_100719677 3300005547 Bacteria 733
157 Ga0070665_100002281 3300005548 Bacteria 21328
158 Ga0070665_100157101 3300005548 Bacteria 2276
159 Ga0070665_101790414 3300005548 Unclassified 621
160 Ga0070704_100058662 3300005549 Unclassified 2742
161 Ga0070704_100236602 3300005549 Bacteria 1493
162 Ga0070704_100725711 3300005549 Bacteria 883
163 Ga0070704_101252564 3300005549 Bacteria 678
164 Ga0068855_101144913 3300005563 Bacteria 811
165 Ga0070664_100011848 3300005564 Bacteria 7076
166 Ga0070664_100338092 3300005564 Bacteria 1367
167 Ga0070664_100898856 3300005564 Bacteria 830
168 Ga0068857_100030919 3300005577 Bacteria 4731
169 Ga0068857_100442222 3300005577 Unclassified 1215
170 Ga0068854_100048700 3300005578 Bacteria 3024
171 Ga0070702_100001352 3300005615 Bacteria 9992
172 Ga0070702_100014861 3300005615 Bacteria 3961
173 Ga0070702_100080529 3300005615 Bacteria 1949
174 Ga0068852_100212705 3300005616 Bacteria 1835
175 Ga0068852_100395631 3300005616 Unclassified 1358
176 Ga0068852_100626788 3300005616 Bacteria 1081
177 Ga0068852_100752774 3300005616 Bacteria 986
178 Ga0068859_100008136 3300005617 Bacteria 10632
179 Ga0068859_100061047 3300005617 Bacteria 3799
180 Ga0068859_100139918 3300005617 Bacteria 2494
181 Ga0068859_100149513 3300005617 Bacteria 2411
182 Ga0068859_100266103 3300005617 Bacteria 1806
183 Ga0068859_100282822 3300005617 Unclassified 1751
184 Ga0068859_100586155 3300005617 Bacteria 1208
185 Ga0068859_100853168 3300005617 Bacteria 997
186 Ga0068859_101110656 3300005617 Unclassified 870
187 Ga0068859_101203199 3300005617 Archaea 834
188 Ga0068864_100024466 3300005618 Bacteria 5081
189 Ga0068864_100139734 3300005618 Bacteria 2184
190 Ga0068864_100220586 3300005618 Bacteria 1749
191 Ga0068864_100224395 3300005618 Bacteria 1735
192 Ga0068864_100411615 3300005618 Unclassified 1287
193 Ga0068866_10014712 3300005718 Bacteria 3461
194 Ga0068866_10816868 3300005718 Archaea 649
195 Ga0068861_100003999 3300005719 Bacteria 9872
196 Ga0068861_100575608 3300005719 Bacteria 1030
197 Ga0068861_100595739 3300005719 Unclassified 1014
198 Ga0068851_10073785 3300005834 Bacteria 1770
199 Ga0068851_10632961 3300005834 Bacteria 653
200 Ga0068870_10002276 3300005840 Bacteria 7974
201 Ga0068870_10021401 3300005840 Bacteria 3163
202 Ga0068870_10116139 3300005840 Bacteria 1535
203 Ga0068863_100008012 3300005841 Bacteria 10322
204 Ga0068863_100065528 3300005841 Bacteria 3437
205 Ga0068863_100137664 3300005841 Bacteria 2333
206 Ga0068863_100330393 3300005841 Bacteria 1482
207 Ga0068863_100378544 3300005841 Bacteria 1382
208 Ga0068863_101073862 3300005841 Unclassified 809
209 Ga0068858_100017955 3300005842 Bacteria 6624
210 Ga0068858_100044696 3300005842 Bacteria 4105
211 Ga0068858_100109092 3300005842 Bacteria 2584
212 Ga0068858_100562876 3300005842 Bacteria 1104
213 Ga0068860_100027062 3300005843 Bacteria 5525
214 Ga0068860_100156293 3300005843 Bacteria 2198
215 Ga0068860_100177629 3300005843 Bacteria 2058
216 Ga0068860_100582643 3300005843 Bacteria 1123
217 Ga0068860_102144439 3300005843 Unclassified 580
218 Ga0068862_100047227 3300005844 Bacteria 3674
219 Ga0068862_100279952 3300005844 Unclassified 1528
220 Ga0068862_100368737 3300005844 Bacteria 1336
221 Ga0068862_101915203 3300005844 Bacteria 603
222 Ga0081455_10049151 3300005937 Bacteria 3638
223 Ga0081455_11025349 3300005937 Unclassified 510
224 Ga0075365_10579676 3300006038 Bacteria 793
225 Ga0075368_10136287 3300006042 Bacteria 1022
226 Ga0075363_100460400 3300006048 Bacteria 752
227 Ga0075364_10021461 3300006051 Bacteria 4070
228 Ga0075432_10236886 3300006058 Unclassified 736
229 Ga0070715_10865485 3300006163 Unclassified 554
230 Ga0070716_100143342 3300006173 Unclassified 1527
231 Ga0075367_10049319 3300006178 Bacteria 2481
232 Ga0075369_10210019 3300006186 Bacteria 900
233 Ga0097621_100064160 3300006237 Bacteria 3020
234 Ga0097621_100148642 3300006237 Bacteria 2008
235 Ga0097621_100208888 3300006237 Bacteria 1698
236 Ga0097621_101183110 3300006237 Archaea 720
237 Ga0075370_10305278 3300006353 Bacteria 947
238 Ga0068871_100436581 3300006358 Bacteria 1171
239 Ga0068871_100455679 3300006358 Bacteria 1147
240 Ga0068871_100559085 3300006358 Unclassified 1037
241 Ga0068871_100562861 3300006358 Unclassified 1033
242 Ga0068871_100831364 3300006358 Unclassified 853
243 Ga0075428_100015340 3300006844 Bacteria 8497
244 Ga0075428_101279264 3300006844 Unclassified 772
245 Ga0075433_10010141 3300006852 Bacteria 7553
246 Ga0075433_10072163 3300006852 Bacteria 3035
247 Ga0075433_10137458 3300006852 Unclassified 2172
248 Ga0075433_10562128 3300006852 Bacteria 1002
249 Ga0075434_100010589 3300006871 Bacteria 8653
250 Ga0075434_100116584 3300006871 Bacteria 2684
251 Ga0075434_100120821 3300006871 Bacteria 2635
252 Ga0075434_100209203 3300006871 Unclassified 1971
253 Ga0075434_100876875 3300006871 Unclassified 912
254 Ga0075429_100096236 3300006880 Bacteria 2582
255 Ga0068865_100129755 3300006881 Bacteria 1887
256 Ga0068865_100273617 3300006881 Bacteria 1342
257 Ga0068865_100529034 3300006881 Bacteria 987
258 Ga0075436_100092788 3300006914 Bacteria 2099
259 Ga0075436_101343189 3300006914 Unclassified 541
260 Ga0097620_100008136 3300006931 Bacteria 10632
261 Ga0097620_100061048 3300006931 Bacteria 3799
262 Ga0097620_100139921 3300006931 Bacteria 2494
263 Ga0097620_100149501 3300006931 Bacteria 2411
264 Ga0097620_100266113 3300006931 Bacteria 1806
265 Ga0097620_100282827 3300006931 Unclassified 1751
266 Ga0097620_100586157 3300006931 Bacteria 1208
267 Ga0097620_100853201 3300006931 Bacteria 997
268 Ga0097620_101055297 3300006931 Unclassified 893
269 Ga0097620_101110545 3300006931 Unclassified 870
270 Ga0097620_101203189 3300006931 Archaea 834
271 Ga0075435_100003148 3300007076 Bacteria 11155
272 Ga0075435_100246914 3300007076 Unclassified 1519
273 Ga0099795_10212859 3300007788 Unclassified 820
274 Ga0099795_10266669 3300007788 Unclassified 743
275 Ga0105240_10039765 3300009093 Bacteria 6020
276 Ga0105240_10886558 3300009093 Bacteria 961
277 Ga0111539_10038271 3300009094 Bacteria 5786
278 Ga0111539_10076896 3300009094 Bacteria 3930
279 Ga0111539_10098220 3300009094 Bacteria 3440
280 Ga0111539_10290994 3300009094 Bacteria 1901
281 Ga0111539_10795095 3300009094 Bacteria 1101
282 Ga0111539_11292240 3300009094 Bacteria 847
283 Ga0105245_10021070 3300009098 Bacteria 5718
284 Ga0105245_10087577 3300009098 Bacteria 2858
285 Ga0105245_10105160 3300009098 Bacteria 2618
286 Ga0105247_10011072 3300009101 Bacteria 5443
287 Ga0114129_10152136 3300009147 Unclassified 3166
288 Ga0114129_10560789 3300009147 Bacteria 1484
289 Ga0114129_11499005 3300009147 Unclassified 829
290 Ga0114129_11670967 3300009147 Unclassified 778
291 Ga0114129_12337654 3300009147 Unclassified 641
292 Ga0105243_10392677 3300009148 Unclassified 1286
293 Ga0105243_10480418 3300009148 Bacteria 1172
294 Ga0105243_11808069 3300009148 Archaea 642
295 Ga0105241_10443791 3300009174 Bacteria 1147
296 Ga0105241_11351626 3300009174 Bacteria 680
297 Ga0105242_10040109 3300009176 Bacteria 3772
298 Ga0105242_10081955 3300009176 Bacteria 2699
299 Ga0105242_10873901 3300009176 Bacteria 897
300 Ga0105248_10012713 3300009177 Bacteria 9288
301 Ga0105248_10016697 3300009177 Bacteria 8081
302 Ga0105248_10147607 3300009177 Unclassified 2654
303 Ga0105248_10343732 3300009177 Archaea 1680
304 Ga0105248_10376695 3300009177 Bacteria 1598
305 Ga0105248_10749130 3300009177 Bacteria 1102
306 Ga0105248_12788511 3300009177 Unclassified 557
307 Ga0105238_10630599 3300009551 Bacteria 1081
308 Ga0105238_11405115 3300009551 Bacteria 725
309 Ga0105249_10000182 3300009553 Bacteria 73467
310 Ga0105249_10013317 3300009553 Bacteria 7262
311 Ga0105249_11282879 3300009553 Bacteria 804
312 Ga0099796_10567216 3300010159 Bacteria 511
313 Ga0105239_12204528 3300010375 Bacteria 641
314 Ga0105246_10133502 3300011119 Bacteria 1857
315 Ga0105246_10140078 3300011119 Bacteria 1818
316 Ga0105246_10154402 3300011119 Bacteria 1742
317 Ga0105246_10528273 3300011119 Bacteria 1007
318 Ga0157369_10073719 3300013105 Bacteria 3662
319 Ga0157374_10005772 3300013296 Bacteria 10447
320 Ga0157374_10524731 3300013296 Unclassified 1190
321 Ga0157374_11114785 3300013296 Bacteria 810
322 Ga0157378_10481020 3300013297 Unclassified 1237
323 Ga0157378_10578753 3300013297 Unclassified 1132
324 Ga0157378_10940107 3300013297 Bacteria 897
325 Ga0157378_11714476 3300013297 Unclassified 675
326 Ga0157378_12152645 3300013297 Unclassified 609
327 Ga0163162_10091980 3300013306 Bacteria 3116
328 Ga0163162_10300998 3300013306 Bacteria 1736
329 Ga0163162_10358670 3300013306 Unclassified 1591
330 Ga0157375_10236291 3300013308 Bacteria 1987
331 Ga0157375_10655377 3300013308 Unclassified 1206
332 Ga0157375_11624837 3300013308 Bacteria 764
333 Ga0157375_11708351 3300013308 Bacteria 745
334 Ga0157375_12154389 3300013308 Bacteria 664
335 Ga0163163_10008708 3300014325 Bacteria 9025
336 Ga0163163_10226472 3300014325 Bacteria 1919
337 Ga0163163_10519543 3300014325 Bacteria 1253
338 Ga0163163_11144980 3300014325 Unclassified 841
339 Ga0163163_11410326 3300014325 Bacteria 758
340 Ga0163163_12373316 3300014325 Bacteria 589
341 Ga0157380_10237373 3300014326 Bacteria 1641
342 Ga0157380_10296274 3300014326 Bacteria 1488
343 Ga0157380_10410777 3300014326 Bacteria 1287
344 Ga0157380_10816630 3300014326 Bacteria 951
345 Ga0157377_10260035 3300014745 Bacteria 1129
346 Ga0157377_10789689 3300014745 Bacteria 699
347 Ga0157379_10040715 3300014968 Bacteria 4148
348 Ga0157379_10041656 3300014968 Bacteria 4099
349 Ga0157379_10071635 3300014968 Bacteria 3100
350 Ga0157379_11753238 3300014968 Bacteria 609
351 Ga0157376_10018282 3300014969 Bacteria 5369
352 Ga0157376_10028229 3300014969 Bacteria 4458
353 Ga0157376_10036669 3300014969 Bacteria 3974
354 Ga0157376_10093640 3300014969 Bacteria 2609
355 Ga0157376_10172439 3300014969 Unclassified 1971
356 Ga0157376_10433947 3300014969 Bacteria 1277
357 Ga0207666_1009081 3300025271 Bacteria 1338
358 Ga0207697_10030192 3300025315 Bacteria 2218
359 Ga0207656_10054451 3300025321 Bacteria 1739
360 Ga0207653_10054460 3300025885 Bacteria 1338
361 Ga0207682_10073963 3300025893 Bacteria 1448
362 Ga0207642_10039001 3300025899 Bacteria 2060
363 Ga0207710_10013426 3300025900 Bacteria 3446
364 Ga0207688_10377824 3300025901 Bacteria 876
365 Ga0207680_10051906 3300025903 Bacteria 2454
366 Ga0207680_10156834 3300025903 Bacteria 1523
367 Ga0207647_10388961 3300025904 Bacteria 787
368 Ga0207647_10434019 3300025904 Unclassified 737
369 Ga0207685_10466500 3300025905 Unclassified 659
370 Ga0207699_10044655 3300025906 Unclassified 2581
371 Ga0207645_10086341 3300025907 Bacteria 2016
372 Ga0207645_10404308 3300025907 Bacteria 919
373 Ga0207643_10005644 3300025908 Bacteria 6690
374 Ga0207643_10027486 3300025908 Unclassified 3154
375 Ga0207643_10199487 3300025908 Bacteria 1218
376 Ga0207684_10100443 3300025910 Bacteria 2472
377 Ga0207654_10333357 3300025911 Bacteria 1040
378 Ga0207654_10541324 3300025911 Bacteria 826
379 Ga0207707_10002331 3300025912 Bacteria 17099
380 Ga0207695_10098513 3300025913 Bacteria 2922
381 Ga0207660_10078893 3300025917 Bacteria 2414
382 Ga0207660_10129911 3300025917 Bacteria 1916
383 Ga0207662_10006037 3300025918 Bacteria 6511
384 Ga0207662_10131960 3300025918 Bacteria 1576
385 Ga0207662_10784737 3300025918 Bacteria 671
386 Ga0207649_10229968 3300025920 Bacteria 1325
387 Ga0207649_10677644 3300025920 Bacteria 798
388 Ga0207652_10177492 3300025921 Unclassified 1913
389 Ga0207646_10000005 3300025922 Bacteria 523896
390 Ga0207646_10213937 3300025922 Bacteria 1741
391 Ga0207646_10649260 3300025922 Bacteria 945
392 Ga0207681_10002833 3300025923 Bacteria 10975
393 Ga0207681_10181784 3300025923 Bacteria 1602
394 Ga0207681_10414341 3300025923 Bacteria 1090
395 Ga0207694_11136540 3300025924 Bacteria 661
396 Ga0207650_10037170 3300025925 Bacteria 3547
397 Ga0207650_10071265 3300025925 Bacteria 2614
398 Ga0207650_10116418 3300025925 Bacteria 2075
399 Ga0207650_10392811 3300025925 Bacteria 1147
400 Ga0207650_10476642 3300025925 Bacteria 1041
401 Ga0207659_10004564 3300025926 Bacteria 8374
402 Ga0207659_10009311 3300025926 Bacteria 6132
403 Ga0207659_10075213 3300025926 Bacteria 2477
404 Ga0207659_10140147 3300025926 Bacteria 1876
405 Ga0207659_10211235 3300025926 Unclassified 1555
406 Ga0207659_10214879 3300025926 Bacteria 1543
407 Ga0207687_10028425 3300025927 Bacteria 3756
408 Ga0207687_10431668 3300025927 Unclassified 1089
409 Ga0207644_10044383 3300025931 Bacteria 3158
410 Ga0207644_10147934 3300025931 Bacteria 1815
411 Ga0207644_10774055 3300025931 Bacteria 802
412 Ga0207644_10911801 3300025931 Unclassified 737
413 Ga0207706_10080619 3300025933 Unclassified 2862
414 Ga0207706_10670085 3300025933 Bacteria 888
415 Ga0207686_10065762 3300025934 Bacteria 2313
416 Ga0207686_10515169 3300025934 Unclassified 930
417 Ga0207686_10605263 3300025934 Bacteria 863
418 Ga0207709_10077526 3300025935 Bacteria 2131
419 Ga0207709_10279372 3300025935 Unclassified 1233
420 Ga0207670_10005144 3300025936 Bacteria 7149
421 Ga0207670_10043284 3300025936 Bacteria 2972
422 Ga0207670_10684135 3300025936 Unclassified 848
423 Ga0207669_10108544 3300025937 Bacteria 1854
424 Ga0207669_10126398 3300025937 Bacteria 1747
425 Ga0207669_10559842 3300025937 Unclassified 924
426 Ga0207669_11042614 3300025937 Unclassified 689
427 Ga0207665_10052202 3300025939 Unclassified 2754
428 Ga0207691_10063783 3300025940 Bacteria 3340
429 Ga0207691_10090278 3300025940 Unclassified 2747
430 Ga0207691_10146651 3300025940 Bacteria 2077
431 Ga0207691_10227586 3300025940 Unclassified 1615
432 Ga0207691_10785184 3300025940 Bacteria 801
433 Ga0207691_11251229 3300025940 Bacteria 614
434 Ga0207711_10016981 3300025941 Bacteria 6045
435 Ga0207711_10019080 3300025941 Bacteria 5705
436 Ga0207711_10697282 3300025941 Bacteria 947
437 Ga0207711_11684745 3300025941 Unclassified 577
438 Ga0207689_10029115 3300025942 Bacteria 4615
439 Ga0207689_10089714 3300025942 Bacteria 2525
440 Ga0207689_10256063 3300025942 Bacteria 1448
441 Ga0207689_11368388 3300025942 Bacteria 594
442 Ga0207661_10227638 3300025944 Bacteria 1650
443 Ga0207679_10136904 3300025945 Bacteria 1973
444 Ga0207679_10927422 3300025945 Bacteria 797
445 Ga0207651_10030586 3300025960 Archaea 3431
446 Ga0207651_10088252 3300025960 Bacteria 2260
447 Ga0207651_10107092 3300025960 Unclassified 2089
448 Ga0207651_10922076 3300025960 Unclassified 778
449 Ga0207651_10931858 3300025960 Bacteria 774
450 Ga0207712_10000063 3300025961 Bacteria 133704
451 Ga0207712_10613650 3300025961 Bacteria 942
452 Ga0207668_10001620 3300025972 Bacteria 13148
453 Ga0207668_10197839 3300025972 Bacteria 1598
454 Ga0207640_10219179 3300025981 Bacteria 1455
455 Ga0207658_10134519 3300025986 Bacteria 1991
456 Ga0207658_10767350 3300025986 Unclassified 874
457 Ga0207677_10018548 3300026023 Bacteria 4178
458 Ga0207677_10215836 3300026023 Bacteria 1535
459 Ga0207677_10263549 3300026023 Bacteria 1406
460 Ga0207677_10360007 3300026023 Bacteria 1222
461 Ga0207703_10004498 3300026035 Bacteria 11442
462 Ga0207703_10023908 3300026035 Bacteria 4805
463 Ga0207703_10134964 3300026035 Bacteria 2135
464 Ga0207703_10170408 3300026035 Bacteria 1914
465 Ga0207703_10688354 3300026035 Bacteria 972
466 Ga0207639_10298134 3300026041 Bacteria 1424
467 Ga0207708_10020209 3300026075 Bacteria 5022
468 Ga0207708_10036795 3300026075 Bacteria 3728
469 Ga0207708_10049016 3300026075 Bacteria 3216
470 Ga0207708_10381391 3300026075 Bacteria 1162
471 Ga0207702_12225006 3300026078 Bacteria 537
472 Ga0207641_10045110 3300026088 Unclassified 3710
473 Ga0207641_10048860 3300026088 Bacteria 3573
474 Ga0207641_10091025 3300026088 Bacteria 2669
475 Ga0207641_10092906 3300026088 Unclassified 2643
476 Ga0207641_10282042 3300026088 Unclassified 1563
477 Ga0207641_11063194 3300026088 Unclassified 807
478 Ga0207641_11763458 3300026088 Bacteria 621
479 Ga0207648_10000844 3300026089 Bacteria 34567
480 Ga0207648_10081967 3300026089 Bacteria 2813
481 Ga0207648_10284180 3300026089 Bacteria 1480
482 Ga0207648_10383397 3300026089 Bacteria 1271
483 Ga0207676_10058395 3300026095 Bacteria 3043
484 Ga0207676_10072530 3300026095 Bacteria 2768
485 Ga0207676_10132112 3300026095 Bacteria 2124
486 Ga0207676_10198270 3300026095 Unclassified 1772
487 Ga0207676_10280606 3300026095 Unclassified 1512
488 Ga0207674_10009268 3300026116 Bacteria 11279
489 Ga0207674_10119086 3300026116 Bacteria 2609
490 Ga0207674_10981151 3300026116 Bacteria 814
491 Ga0207674_11827751 3300026116 Bacteria 574
492 Ga0207675_100001335 3300026118 Bacteria 24751
493 Ga0207675_100113852 3300026118 Bacteria 2554
494 Ga0207675_100218887 3300026118 Bacteria 1834
495 Ga0207675_100861803 3300026118 Unclassified 921
496 Ga0207683_10047044 3300026121 Bacteria 3778
497 Ga0207683_10083670 3300026121 Bacteria 2836
498 Ga0207698_10272137 3300026142 Bacteria 1562
499 Ga0209588_1010128 3300027671 Unclassified 2829
500 Ga0209813_10136239 3300027866 Bacteria 868
501 Ga0207428_10056271 3300027907 Bacteria 3126
502 Ga0207428_10271485 3300027907 Bacteria 1260
503 Ga0207428_11008650 3300027907 Unclassified 585
504 Ga0268266_10009932 3300028379 Bacteria 8358
505 Ga0268266_10261848 3300028379 Bacteria 1603
506 Ga0268266_11289845 3300028379 Unclassified 706
507 Ga0268265_10006637 3300028380 Bacteria 7830
508 Ga0268265_10346621 3300028380 Unclassified 1354
509 Ga0268265_11665896 3300028380 Bacteria 643
510 Ga0268264_10112212 3300028381 Unclassified 2390
511 Ga0268264_10533758 3300028381 Bacteria 1149
512 Ga0268264_10871876 3300028381 Unclassified 902
513 Ga0268264_10912349 3300028381 Bacteria 882
514 Ga0268264_10917398 3300028381 Bacteria 880
515 Ga0265338_10837648 3300028800 Unclassified 629
516 Ga0316181_1222148 3300030744 Bacteria 2209
517 Ga0265760_10025103 3300031090 Bacteria 1739
518 Ga0307414_10266110 3300032004 Unclassified 1433
519 Ga0373949_0056869 3300035090 Bacteria 998
520 Ga0373951_0077844 3300035091 Bacteria 854
521 Ga0373952_0250388 3300035092 Unclassified 536
522 Ga0373932_0035450 3300035112 Bacteria 1411
523 Ga0373936_0229540 3300035113 Unclassified 825
524 Ga0373939_0242188 3300035114 Bacteria 699
525 Ga0373941_0012238 3300035115 Bacteria 2239
526 Ga0373954_0267417 3300035118 Bacteria 842
527 Ga0373954_0284684 3300035118 Unclassified 815
528 Ga0373956_0014364 3300035119 Bacteria 3308
529 Ga0373956_0026411 3300035119 Bacteria 2515
530 Ga0373957_0434288 3300035120 Unclassified 567
531 Ga0373943_0579272 3300035170 Bacteria 660
532 Ga0373955_0069612 3300035172 Unclassified 1964
533 Ga0373955_0099850 3300035172 Bacteria 1664
534 Ga0373955_0870082 3300035172 Unclassified 554
535 Ga0373961_0089640 3300035241 Bacteria 980
536 Ga0373931_0233620 3300035691 Bacteria 1112
537 Ga0373931_0671456 3300035691 Bacteria 682
538 Ga0373935_0068728 3300035692 Unclassified 2280
539 Ga0373935_0217476 3300035692 Bacteria 1326
540 Ga0373935_1449759 3300035692 Unclassified 513
541 Ga0373927_0455479 3300035695 Unclassified 845
542 Ga0373927_0621610 3300035695 Bacteria 714
543 Ga0373933_0108697 3300035724 Bacteria 1728
544 Ga0373937_0119345 3300036401 Bacteria 2457
545 Ga0373937_0172060 3300036401 Bacteria 2032
546 Ga0373925_0133519 3300037068 Bacteria 1937
547 Ga0373925_0458778 3300037068 Bacteria 1044
548 Ga0451807_1483177 3300041486 Bacteria 738
549 Ga0451851_0572458 3300041507 Bacteria 592
550 Ga0451853_3616473 3300041512 Bacteria 1024
551 Ga0439435_0029068 3300042436 Bacteria 1490
552 Ga0451577_0001736 3300042876 Bacteria 28096
553 Ga0451577_0030092 3300042876 Bacteria 4906
554 Ga0451577_0961838 3300042876 Unclassified 768
555 Ga0451577_0992767 3300042876 Unclassified 754
556 Ga0451577_1651333 3300042876 Unclassified 564
557 Ga0453683_0004523 3300044673 Bacteria 9847
558 Ga0453683_0040415 3300044673 Bacteria 2928
559 Ga0453684_0001021 3300044712 Bacteria 89961
560 Ga0453684_0088609 3300044712 Bacteria 3831
561 Ga0453684_0206297 3300044712 Bacteria 2287
562 Ga0453684_1041784 3300044712 Unclassified 868
563 Ga0453684_2278021 3300044712 Unclassified 539
564 Ga0451576_0087303 3300045051 Bacteria 3244
565 Ga0451576_0101461 3300045051 Bacteria 2993
566 Ga0451576_0325012 3300045051 Bacteria 1610
567 Ga0466967_1035044 3300045976 Bacteria 818
568 Ga0495603_0006905 3300046455 Bacteria 6813
569 Ga0495580_0059640 3300046472 Bacteria 2682
570 Ga0495580_0755189 3300046472 Archaea 633
571 Ga0495582_0338614 3300046473 Unclassified 866
572 Ga0495639_0247178 3300046475 Unclassified 881
573 Ga0495662_0043266 3300046476 Bacteria 2174
574 Ga0495594_0023874 3300046499 Unclassified 3280
575 Ga0495607_0473772 3300046501 Unclassified 559
576 Ga0495608_0024536 3300046511 Unclassified 4121
577 Ga0495630_1108629 3300046517 Bacteria 600
578 Ga0495630_1233074 3300046517 Unclassified 565
579 Ga0495663_0097205 3300046525 Bacteria 966
580 Ga0495663_0153885 3300046525 Bacteria 786
581 Ga0495642_0057380 3300046528 Unclassified 1610
582 Ga0495642_0100233 3300046528 Bacteria 1232
583 Ga0495640_0326446 3300046533 Unclassified 950
584 Ga0495621_0212581 3300046539 Bacteria 781
585 Ga0495645_0031447 3300046543 Bacteria 3868
586 Ga0495645_0736936 3300046543 Unclassified 596
587 Ga0495633_0421100 3300046558 Bacteria 604
588 Ga0495667_0605302 3300046559 Bacteria 682
589 Ga0495611_0253885 3300046648 Bacteria 815
590 Ga0495659_0002267 3300046664 Bacteria 6239
591 Ga0495659_0034483 3300046664 Bacteria 1780
592 Ga0495659_0074444 3300046664 Bacteria 1277
593 Ga0495659_0335553 3300046664 Unclassified 644
594 Ga0495588_0005306 3300046674 Bacteria 5730
595 Ga0495657_0053302 3300046675 Unclassified 2707
596 Ga0495599_0259922 3300046678 Bacteria 1055
597 Ga0495647_0002231 3300046681 Bacteria 6070
598 Ga0495658_0103481 3300046683 Unclassified 1703
599 Ga0495658_0319597 3300046683 Bacteria 984
600 Ga0495658_0678133 3300046683 Bacteria 660
601 Ga0495669_0007901 3300046684 Bacteria 4466
602 Ga0495613_0115078 3300046689 Bacteria 1936
603 Ga0495624_0831148 3300046690 Unclassified 545
604 Ga0495670_0044274 3300046691 Bacteria 2222
605 Ga0495600_0132661 3300046809 Bacteria 1619
606 Ga0495636_0043461 3300047318 Unclassified 1869
607 Ga0495636_0057754 3300047318 Bacteria 1635
608 Ga0495674_0858532 3300047319 Bacteria 703
609 Ga0495685_134363 3300047447 Unclassified 808
610 Ga0495684_0009675 3300047471 Bacteria 7433
611 Ga0496100_0253325 3300048903 Bacteria 1303
612 Ga0496102_0624138 3300048905 Bacteria 1001
613 Ga0496104_0179552 3300048907 Bacteria 2027
614 Ga0496104_0276825 3300048907 Bacteria 1591
615 Ga0496104_0636252 3300048907 Unclassified 976
616 Ga0496104_1176686 3300048907 Bacteria 670
617 Ga0496105_1147989 3300048908 Bacteria 574
618 Ga0496106_0395936 3300048909 Bacteria 1110
619 Ga0496106_1079208 3300048909 Unclassified 630
620 Ga0496108_0296490 3300048911 Unclassified 1408
621 Ga0496109_1533391 3300048912 Unclassified 601
622 Ga0496109_1846267 3300048912 Unclassified 537
623 Ga0496110_0657457 3300048913 Bacteria 948
624 Ga0496111_0809733 3300048914 Bacteria 678
625 Ga0496112_0012702 3300048915 Bacteria 7745
626 Ga0496112_1054240 3300048915 Unclassified 732
627 Ga0496112_1242032 3300048915 Bacteria 661
628 Ga0496113_0012726 3300048916 Bacteria 5666
629 Ga0496113_0498141 3300048916 Unclassified 978
630 Ga0496114_0057539 3300048917 Bacteria 3246
631 Ga0501039_1543135 3300049575 Bacteria 510
632 Ga0501072_0303396 3300049588 Archaea 1269
633 Ga0501076_0962294 3300049592 Bacteria 703
634 Ga0501081_1408374 3300049743 Unclassified 529
635 Ga0501241_002671 3300049758 Bacteria 3432
636 nmdc:mga00v17_576177_c1 3300050491 Bacteria 727
637 nmdc:mga06z11_930370_c1 3300050494 Bacteria 530
638 nmdc:mga06z11_97271_c1 3300050494 Bacteria 1609
639 nmdc:mga04h51_132875_c1 3300050495 Bacteria 938
640 nmdc:mga07m45_531293_c1 3300050496 Bacteria 681
641 nmdc:mga05p37_151491_c2 3300050507 Bacteria 1484
642 nmdc:mga05p37_2000542_c1 3300050507 Bacteria 548
643 nmdc:mga05p37_2703_c1 3300050507 Bacteria 20615
644 nmdc:mga08y16_174979_c1 3300050511 Bacteria 2229
645 nmdc:mga08y16_889174_c1 3300050511 Bacteria 878
646 nmdc:mga0n895_1547270_c1 3300050512 Unclassified 629
647 nmdc:mga0n895_1704806_c1 3300050512 Bacteria 593
648 nmdc:mga0n895_20877_c1 3300050512 Bacteria 6118
649 nmdc:mga0n895_625324_c1 3300050512 Bacteria 1077
650 nmdc:mga0rr50_283386_c1 3300050513 Bacteria 1383
651 nmdc:mga0rr50_8733_c1 3300050513 Bacteria 6322
652 nmdc:mga08x19_1094867_c1 3300050514 Unclassified 565
653 nmdc:mga08x19_21010_c1 3300050514 Bacteria 4027
654 nmdc:mga0a205_22081_c1 3300050515 Bacteria 6023
655 nmdc:mga0a205_37742_c1 3300050515 Bacteria 4646
656 nmdc:mga0a205_435073_c1 3300050515 Bacteria 1173
657 nmdc:mga0a205_6451_c1 3300050515 Bacteria 10607
658 nmdc:mga0sz30_432419_c1 3300050516 Bacteria 590
659 Ga0495595_0025258 3300053084 Bacteria 2632
660 Ga0495595_0361961 3300053084 Bacteria 733
661 Ga0495619_0473554 3300053085 Bacteria 862

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100157101 Ga0070665_1001571013 108
2 3300005347 Ga0070668_100006903 Ga0070668_1000069037 110
3 3300009553 Ga0105249_10000182 Ga0105249_1000018219 110
4 3300025961 Ga0207712_10000063 Ga0207712_1000006316 110
5 3300025972 Ga0207668_10001620 Ga0207668_100016205 110
6 3300005456 Ga0070678_101864115 Ga0070678_1018641151 114
7 3300041486 Ga0451807_1483177 Ga0451807_1483177_136_579 114
8 3300042876 Ga0451577_1651333 Ga0451577_1651333_30_461 115
9 3300007788 Ga0099795_10212859 Ga0099795_102128592 116
10 3300025901 Ga0207688_10377824 Ga0207688_103778242 116
11 3300041507 Ga0451851_0572458 Ga0451851_0572458_10_474 121
12 3300046525 Ga0495663_0153885 Ga0495663_0153885_30_404 121
13 3300035120 Ga0373957_0434288 Ga0373957_0434288_89_532 122
14 3300046511 Ga0495608_0024536 Ga0495608_0024536_1111_1554 122
15 3300046675 Ga0495657_0053302 Ga0495657_0053302_234_677 122
16 3300047471 Ga0495684_0009675 Ga0495684_0009675_4981_5424 122
17 3300028800 Ga0265338_10837648 Ga0265338_108376482 123
18 3300046683 Ga0495658_0319597 Ga0495658_0319597_20_457 123
19 3300009093 Ga0105240_10039765 Ga0105240_100397652 124
20 3300025913 Ga0207695_10098513 Ga0207695_100985133 124
21 3300035113 Ga0373936_0229540 Ga0373936_0229540_356_745 126
22 3300005331 Ga0070670_100562322 Ga0070670_1005623221 129
23 3300025925 Ga0207650_10476642 Ga0207650_104766422 129
24 3300035090 Ga0373949_0056869 Ga0373949_0056869_574_972 129
25 3300014969 Ga0157376_10018282 Ga0157376_100182821 130
26 3300041512 Ga0451853_3616473 Ga0451853_3616473_266_700 130
27 3300005468 Ga0070707_100001201 Ga0070707_10000120113 132
28 3300025922 Ga0207646_10000005 Ga0207646_10000005227 132
29 3300042876 Ga0451577_0030092 Ga0451577_0030092_3227_3688 133
30 3300044673 Ga0453683_0004523 Ga0453683_0004523_6462_6923 133
31 3300044712 Ga0453684_0088609 Ga0453684_0088609_2658_3119 133
32 3300045976 Ga0466967_1035044 Ga0466967_1035044_29_463 133
33 3300005445 Ga0070708_101149493 Ga0070708_1011494932 134
34 3300005467 Ga0070706_100003738 Ga0070706_1000037389 134
35 3300005471 Ga0070698_100718544 Ga0070698_1007185442 134
36 3300025910 Ga0207684_10100443 Ga0207684_101004433 134
37 3300042876 Ga0451577_0001736 Ga0451577_0001736_27147_27578 134
38 3300042876 Ga0451577_0992767 Ga0451577_0992767_216_677 134
39 3300044712 Ga0453684_0001021 Ga0453684_0001021_36266_36697 134
40 3300005335 Ga0070666_10581630 Ga0070666_105816301 137
41 3300005354 Ga0070675_100186100 Ga0070675_1001861003 137
42 3300005355 Ga0070671_100326498 Ga0070671_1003264983 137
43 3300005434 Ga0070709_10020457 Ga0070709_100204571 137
44 3300007788 Ga0099795_10266669 Ga0099795_102666692 137
45 3300009176 Ga0105242_10873901 Ga0105242_108739012 137
46 3300010159 Ga0099796_10567216 Ga0099796_105672161 137
47 3300014325 Ga0163163_11410326 Ga0163163_114103261 137
48 3300014326 Ga0157380_10410777 Ga0157380_104107772 137
49 3300025926 Ga0207659_10211235 Ga0207659_102112353 137
50 3300025931 Ga0207644_10774055 Ga0207644_107740551 137
51 3300025934 Ga0207686_10605263 Ga0207686_106052631 137
52 3300025937 Ga0207669_11042614 Ga0207669_110426142 137
53 3300027671 Ga0209588_1010128 Ga0209588_10101283 137
54 3300049743 Ga0501081_1408374 Ga0501081_1408374_65_502 137
55 3300005289 Ga0065704_10109235 Ga0065704_101092352 138
56 3300005290 Ga0065712_10791296 Ga0065712_107912961 138
57 3300005293 Ga0065715_10266221 Ga0065715_102662212 138
58 3300005293 Ga0065715_10382998 Ga0065715_103829981 138
59 3300005293 Ga0065715_10513686 Ga0065715_105136861 138
60 3300005293 Ga0065715_10622608 Ga0065715_106226082 138
61 3300005327 Ga0070658_10948661 Ga0070658_109486612 138
62 3300005328 Ga0070676_10264070 Ga0070676_102640702 138
63 3300005328 Ga0070676_10449532 Ga0070676_104495322 138
64 3300005329 Ga0070683_100316938 Ga0070683_1003169382 138
65 3300005330 Ga0070690_100314059 Ga0070690_1003140591 138
66 3300005330 Ga0070690_100382182 Ga0070690_1003821821 138
67 3300005330 Ga0070690_100643807 Ga0070690_1006438072 138
68 3300005331 Ga0070670_100009375 Ga0070670_1000093758 138
69 3300005331 Ga0070670_100014551 Ga0070670_1000145515 138
70 3300005331 Ga0070670_100047394 Ga0070670_1000473945 138
71 3300005331 Ga0070670_100163400 Ga0070670_1001634003 138
72 3300005331 Ga0070670_100467902 Ga0070670_1004679021 138
73 3300005331 Ga0070670_100531684 Ga0070670_1005316843 138
74 3300005333 Ga0070677_10066906 Ga0070677_100669063 138
75 3300005333 Ga0070677_10088607 Ga0070677_100886073 138
76 3300005334 Ga0068869_100054687 Ga0068869_1000546874 138
77 3300005334 Ga0068869_100077034 Ga0068869_1000770342 138
78 3300005334 Ga0068869_100574364 Ga0068869_1005743642 138
79 3300005334 Ga0068869_100884767 Ga0068869_1008847671 138
80 3300005335 Ga0070666_10315140 Ga0070666_103151401 138
81 3300005335 Ga0070666_10408260 Ga0070666_104082601 138
82 3300005336 Ga0070680_100100391 Ga0070680_1001003911 138
83 3300005336 Ga0070680_100192659 Ga0070680_1001926593 138
84 3300005336 Ga0070680_100887199 Ga0070680_1008871991 138
85 3300005338 Ga0068868_100014509 Ga0068868_1000145094 138
86 3300005338 Ga0068868_100219258 Ga0068868_1002192582 138
87 3300005338 Ga0068868_100231602 Ga0068868_1002316022 138
88 3300005338 Ga0068868_100431206 Ga0068868_1004312062 138
89 3300005338 Ga0068868_101621920 Ga0068868_1016219201 138
90 3300005340 Ga0070689_100003333 Ga0070689_1000033338 138
91 3300005340 Ga0070689_100562615 Ga0070689_1005626151 138
92 3300005340 Ga0070689_100594899 Ga0070689_1005948991 138
93 3300005340 Ga0070689_100600633 Ga0070689_1006006331 138
94 3300005341 Ga0070691_10025029 Ga0070691_100250293 138
95 3300005341 Ga0070691_10189877 Ga0070691_101898772 138
96 3300005341 Ga0070691_10541967 Ga0070691_105419671 138
97 3300005343 Ga0070687_100034188 Ga0070687_1000341884 138
98 3300005344 Ga0070661_100204768 Ga0070661_1002047682 138
99 3300005345 Ga0070692_10053084 Ga0070692_100530842 138
100 3300005347 Ga0070668_100115454 Ga0070668_1001154542 138
101 3300005347 Ga0070668_100862997 Ga0070668_1008629971 138
102 3300005353 Ga0070669_100005999 Ga0070669_1000059999 138
103 3300005353 Ga0070669_100009468 Ga0070669_1000094682 138
104 3300005353 Ga0070669_100085548 Ga0070669_1000855483 138
105 3300005353 Ga0070669_100346644 Ga0070669_1003466442 138
106 3300005354 Ga0070675_100004565 Ga0070675_1000045656 138
107 3300005354 Ga0070675_100197198 Ga0070675_1001971981 138
108 3300005354 Ga0070675_100444907 Ga0070675_1004449072 138
109 3300005355 Ga0070671_100063375 Ga0070671_1000633754 138
110 3300005355 Ga0070671_100124237 Ga0070671_1001242373 138
111 3300005355 Ga0070671_100303478 Ga0070671_1003034781 138
112 3300005355 Ga0070671_100731449 Ga0070671_1007314492 138
113 3300005356 Ga0070674_100079871 Ga0070674_1000798713 138
114 3300005356 Ga0070674_100624990 Ga0070674_1006249901 138
115 3300005356 Ga0070674_100782503 Ga0070674_1007825031 138
116 3300005364 Ga0070673_100027570 Ga0070673_1000275702 138
117 3300005364 Ga0070673_100052628 Ga0070673_1000526283 138
118 3300005364 Ga0070673_100102851 Ga0070673_1001028513 138
119 3300005364 Ga0070673_100632236 Ga0070673_1006322361 138
120 3300005364 Ga0070673_100863396 Ga0070673_1008633962 138
121 3300005364 Ga0070673_101049826 Ga0070673_1010498262 138
122 3300005365 Ga0070688_100036177 Ga0070688_1000361774 138
123 3300005365 Ga0070688_100331297 Ga0070688_1003312972 138
124 3300005365 Ga0070688_101605933 Ga0070688_1016059331 138
125 3300005366 Ga0070659_100765813 Ga0070659_1007658132 138
126 3300005367 Ga0070667_100014018 Ga0070667_1000140186 138
127 3300005367 Ga0070667_100059796 Ga0070667_1000597963 138
128 3300005367 Ga0070667_100924853 Ga0070667_1009248532 138
129 3300005367 Ga0070667_100954696 Ga0070667_1009546962 138
130 3300005367 Ga0070667_101036043 Ga0070667_1010360432 138
131 3300005434 Ga0070709_10138767 Ga0070709_101387672 138
132 3300005436 Ga0070713_100028665 Ga0070713_1000286655 138
133 3300005438 Ga0070701_10002357 Ga0070701_100023578 138
134 3300005438 Ga0070701_10158003 Ga0070701_101580032 138
135 3300005438 Ga0070701_10290527 Ga0070701_102905272 138
136 3300005438 Ga0070701_10514434 Ga0070701_105144342 138
137 3300005439 Ga0070711_101069735 Ga0070711_1010697351 138
138 3300005440 Ga0070705_100000037 Ga0070705_10000003735 138
139 3300005440 Ga0070705_101339951 Ga0070705_1013399511 138
140 3300005441 Ga0070700_100051603 Ga0070700_1000516033 138
141 3300005441 Ga0070700_100069990 Ga0070700_1000699901 138
142 3300005441 Ga0070700_100245856 Ga0070700_1002458562 138
143 3300005441 Ga0070700_100570034 Ga0070700_1005700341 138
144 3300005441 Ga0070700_101129841 Ga0070700_1011298412 138
145 3300005444 Ga0070694_100005480 Ga0070694_1000054808 138
146 3300005444 Ga0070694_100135736 Ga0070694_1001357362 138
147 3300005444 Ga0070694_100150397 Ga0070694_1001503972 138
148 3300005444 Ga0070694_100228084 Ga0070694_1002280844 138
149 3300005444 Ga0070694_100376059 Ga0070694_1003760592 138
150 3300005444 Ga0070694_100462243 Ga0070694_1004622432 138
151 3300005444 Ga0070694_100532433 Ga0070694_1005324332 138
152 3300005444 Ga0070694_100602804 Ga0070694_1006028041 138
153 3300005445 Ga0070708_100042068 Ga0070708_1000420683 138
154 3300005455 Ga0070663_100889066 Ga0070663_1008890662 138
155 3300005456 Ga0070678_100028655 Ga0070678_1000286553 138
156 3300005456 Ga0070678_100090163 Ga0070678_1000901632 138
157 3300005457 Ga0070662_100041354 Ga0070662_1000413542 138
158 3300005457 Ga0070662_100206567 Ga0070662_1002065671 138
159 3300005457 Ga0070662_100623348 Ga0070662_1006233482 138
160 3300005458 Ga0070681_10027374 Ga0070681_100273742 138
161 3300005459 Ga0068867_100000265 Ga0068867_1000002657 138
162 3300005459 Ga0068867_100130170 Ga0068867_1001301702 138
163 3300005466 Ga0070685_10249553 Ga0070685_102495531 138
164 3300005466 Ga0070685_10844433 Ga0070685_108444331 138
165 3300005466 Ga0070685_11048592 Ga0070685_110485921 138
166 3300005467 Ga0070706_100269592 Ga0070706_1002695923 138
167 3300005467 Ga0070706_100605121 Ga0070706_1006051211 138
168 3300005468 Ga0070707_100688457 Ga0070707_1006884571 138
169 3300005468 Ga0070707_101029950 Ga0070707_1010299501 138
170 3300005468 Ga0070707_101263492 Ga0070707_1012634921 138
171 3300005471 Ga0070698_100020353 Ga0070698_1000203534 138
172 3300005518 Ga0070699_100181207 Ga0070699_1001812073 138
173 3300005518 Ga0070699_100437039 Ga0070699_1004370392 138
174 3300005518 Ga0070699_102041868 Ga0070699_1020418681 138
175 3300005530 Ga0070679_100020171 Ga0070679_1000201712 138
176 3300005530 Ga0070679_101653619 Ga0070679_1016536191 138
177 3300005535 Ga0070684_100055686 Ga0070684_1000556862 138
178 3300005535 Ga0070684_101600719 Ga0070684_1016007191 138
179 3300005536 Ga0070697_100025013 Ga0070697_1000250134 138
180 3300005536 Ga0070697_100035381 Ga0070697_1000353814 138
181 3300005536 Ga0070697_100233130 Ga0070697_1002331301 138
182 3300005536 Ga0070697_100491683 Ga0070697_1004916832 138
183 3300005539 Ga0068853_100475661 Ga0068853_1004756611 138
184 3300005543 Ga0070672_100056393 Ga0070672_1000563933 138
185 3300005543 Ga0070672_100078985 Ga0070672_1000789854 138
186 3300005543 Ga0070672_100098450 Ga0070672_1000984502 138
187 3300005543 Ga0070672_100118866 Ga0070672_1001188662 138
188 3300005543 Ga0070672_100156607 Ga0070672_1001566072 138
189 3300005543 Ga0070672_100277346 Ga0070672_1002773462 138
190 3300005544 Ga0070686_100798685 Ga0070686_1007986852 138
191 3300005545 Ga0070695_100001493 Ga0070695_1000014937 138
192 3300005545 Ga0070695_100142118 Ga0070695_1001421183 138
193 3300005545 Ga0070695_100186564 Ga0070695_1001865642 138
194 3300005545 Ga0070695_100957812 Ga0070695_1009578122 138
195 3300005545 Ga0070695_101592368 Ga0070695_1015923681 138
196 3300005546 Ga0070696_100000139 Ga0070696_10000013910 138
197 3300005547 Ga0070693_100719677 Ga0070693_1007196771 138
198 3300005548 Ga0070665_100002281 Ga0070665_10000228113 138
199 3300005548 Ga0070665_101790414 Ga0070665_1017904141 138
200 3300005549 Ga0070704_100058662 Ga0070704_1000586625 138
201 3300005549 Ga0070704_100236602 Ga0070704_1002366022 138
202 3300005549 Ga0070704_100725711 Ga0070704_1007257111 138
203 3300005549 Ga0070704_101252564 Ga0070704_1012525641 138
204 3300005563 Ga0068855_101144913 Ga0068855_1011449131 138
205 3300005564 Ga0070664_100011848 Ga0070664_1000118482 138
206 3300005564 Ga0070664_100338092 Ga0070664_1003380922 138
207 3300005564 Ga0070664_100898856 Ga0070664_1008988562 138
208 3300005577 Ga0068857_100030919 Ga0068857_1000309196 138
209 3300005577 Ga0068857_100442222 Ga0068857_1004422222 138
210 3300005578 Ga0068854_100048700 Ga0068854_1000487003 138
211 3300005615 Ga0070702_100001352 Ga0070702_1000013525 138
212 3300005615 Ga0070702_100014861 Ga0070702_1000148612 138
213 3300005615 Ga0070702_100080529 Ga0070702_1000805293 138
214 3300005616 Ga0068852_100212705 Ga0068852_1002127052 138
215 3300005616 Ga0068852_100395631 Ga0068852_1003956311 138
216 3300005616 Ga0068852_100626788 Ga0068852_1006267881 138
217 3300005616 Ga0068852_100752774 Ga0068852_1007527742 138
218 3300005617 Ga0068859_100008136 Ga0068859_1000081368 138
219 3300005617 Ga0068859_100061047 Ga0068859_1000610473 138
220 3300005617 Ga0068859_100139918 Ga0068859_1001399183 138
221 3300005617 Ga0068859_100149513 Ga0068859_1001495134 138
222 3300005617 Ga0068859_100266103 Ga0068859_1002661032 138
223 3300005617 Ga0068859_100282822 Ga0068859_1002828223 138
224 3300005617 Ga0068859_100586155 Ga0068859_1005861552 138
225 3300005617 Ga0068859_100853168 Ga0068859_1008531682 138
226 3300005617 Ga0068859_101110656 Ga0068859_1011106562 138
227 3300005617 Ga0068859_101203199 Ga0068859_1012031991 138
228 3300005618 Ga0068864_100024466 Ga0068864_1000244666 138
229 3300005618 Ga0068864_100139734 Ga0068864_1001397343 138
230 3300005618 Ga0068864_100220586 Ga0068864_1002205863 138
231 3300005618 Ga0068864_100224395 Ga0068864_1002243952 138
232 3300005618 Ga0068864_100411615 Ga0068864_1004116151 138
233 3300005718 Ga0068866_10014712 Ga0068866_100147124 138
234 3300005718 Ga0068866_10816868 Ga0068866_108168681 138
235 3300005719 Ga0068861_100003999 Ga0068861_1000039992 138
236 3300005719 Ga0068861_100575608 Ga0068861_1005756083 138
237 3300005719 Ga0068861_100595739 Ga0068861_1005957391 138
238 3300005834 Ga0068851_10073785 Ga0068851_100737852 138
239 3300005834 Ga0068851_10632961 Ga0068851_106329611 138
240 3300005840 Ga0068870_10002276 Ga0068870_100022764 138
241 3300005840 Ga0068870_10021401 Ga0068870_100214012 138
242 3300005840 Ga0068870_10116139 Ga0068870_101161393 138
243 3300005841 Ga0068863_100008012 Ga0068863_1000080128 138
244 3300005841 Ga0068863_100065528 Ga0068863_1000655285 138
245 3300005841 Ga0068863_100137664 Ga0068863_1001376642 138
246 3300005841 Ga0068863_100330393 Ga0068863_1003303932 138
247 3300005841 Ga0068863_100378544 Ga0068863_1003785443 138
248 3300005841 Ga0068863_101073862 Ga0068863_1010738621 138
249 3300005842 Ga0068858_100017955 Ga0068858_1000179554 138
250 3300005842 Ga0068858_100044696 Ga0068858_1000446962 138
251 3300005842 Ga0068858_100109092 Ga0068858_1001090923 138
252 3300005842 Ga0068858_100562876 Ga0068858_1005628762 138
253 3300005843 Ga0068860_100027062 Ga0068860_1000270623 138
254 3300005843 Ga0068860_100156293 Ga0068860_1001562933 138
255 3300005843 Ga0068860_100177629 Ga0068860_1001776292 138
256 3300005843 Ga0068860_100582643 Ga0068860_1005826432 138
257 3300005843 Ga0068860_102144439 Ga0068860_1021444392 138
258 3300005844 Ga0068862_100047227 Ga0068862_1000472274 138
259 3300005844 Ga0068862_100279952 Ga0068862_1002799522 138
260 3300005844 Ga0068862_100368737 Ga0068862_1003687373 138
261 3300005844 Ga0068862_101915203 Ga0068862_1019152031 138
262 3300005937 Ga0081455_10049151 Ga0081455_100491513 138
263 3300005937 Ga0081455_11025349 Ga0081455_110253491 138
264 3300006038 Ga0075365_10579676 Ga0075365_105796761 138
265 3300006042 Ga0075368_10136287 Ga0075368_101362872 138
266 3300006048 Ga0075363_100460400 Ga0075363_1004604002 138
267 3300006051 Ga0075364_10021461 Ga0075364_100214612 138
268 3300006058 Ga0075432_10236886 Ga0075432_102368862 138
269 3300006163 Ga0070715_10865485 Ga0070715_108654851 138
270 3300006173 Ga0070716_100143342 Ga0070716_1001433422 138
271 3300006178 Ga0075367_10049319 Ga0075367_100493193 138
272 3300006186 Ga0075369_10210019 Ga0075369_102100192 138
273 3300006237 Ga0097621_100064160 Ga0097621_1000641605 138
274 3300006237 Ga0097621_100148642 Ga0097621_1001486422 138
275 3300006237 Ga0097621_100208888 Ga0097621_1002088883 138
276 3300006237 Ga0097621_101183110 Ga0097621_1011831101 138
277 3300006353 Ga0075370_10305278 Ga0075370_103052782 138
278 3300006358 Ga0068871_100436581 Ga0068871_1004365812 138
279 3300006358 Ga0068871_100455679 Ga0068871_1004556791 138
280 3300006358 Ga0068871_100559085 Ga0068871_1005590852 138
281 3300006358 Ga0068871_100562861 Ga0068871_1005628613 138
282 3300006358 Ga0068871_100831364 Ga0068871_1008313641 138
283 3300006844 Ga0075428_100015340 Ga0075428_1000153408 138
284 3300006844 Ga0075428_101279264 Ga0075428_1012792642 138
285 3300006852 Ga0075433_10010141 Ga0075433_100101413 138
286 3300006852 Ga0075433_10072163 Ga0075433_100721634 138
287 3300006852 Ga0075433_10137458 Ga0075433_101374582 138
288 3300006852 Ga0075433_10562128 Ga0075433_105621281 138
289 3300006871 Ga0075434_100010589 Ga0075434_1000105898 138
290 3300006871 Ga0075434_100116584 Ga0075434_1001165844 138
291 3300006871 Ga0075434_100120821 Ga0075434_1001208214 138
292 3300006871 Ga0075434_100209203 Ga0075434_1002092033 138
293 3300006871 Ga0075434_100876875 Ga0075434_1008768751 138
294 3300006880 Ga0075429_100096236 Ga0075429_1000962362 138
295 3300006881 Ga0068865_100129755 Ga0068865_1001297552 138
296 3300006881 Ga0068865_100273617 Ga0068865_1002736172 138
297 3300006881 Ga0068865_100529034 Ga0068865_1005290342 138
298 3300006914 Ga0075436_100092788 Ga0075436_1000927882 138
299 3300006914 Ga0075436_101343189 Ga0075436_1013431891 138
300 3300006931 Ga0097620_100008136 Ga0097620_1000081368 138
301 3300006931 Ga0097620_100061048 Ga0097620_1000610485 138
302 3300006931 Ga0097620_100139921 Ga0097620_1001399212 138
303 3300006931 Ga0097620_100149501 Ga0097620_1001495014 138
304 3300006931 Ga0097620_100266113 Ga0097620_1002661132 138
305 3300006931 Ga0097620_100282827 Ga0097620_1002828272 138
306 3300006931 Ga0097620_100586157 Ga0097620_1005861572 138
307 3300006931 Ga0097620_100853201 Ga0097620_1008532012 138
308 3300006931 Ga0097620_101055297 Ga0097620_1010552972 138
309 3300006931 Ga0097620_101110545 Ga0097620_1011105452 138
310 3300006931 Ga0097620_101203189 Ga0097620_1012031892 138
311 3300007076 Ga0075435_100003148 Ga0075435_1000031488 138
312 3300007076 Ga0075435_100246914 Ga0075435_1002469142 138
313 3300009093 Ga0105240_10886558 Ga0105240_108865582 138
314 3300009094 Ga0111539_10038271 Ga0111539_100382717 138
315 3300009094 Ga0111539_10076896 Ga0111539_100768965 138
316 3300009094 Ga0111539_10098220 Ga0111539_100982203 138
317 3300009094 Ga0111539_10290994 Ga0111539_102909942 138
318 3300009094 Ga0111539_10795095 Ga0111539_107950952 138
319 3300009094 Ga0111539_11292240 Ga0111539_112922401 138
320 3300009098 Ga0105245_10021070 Ga0105245_100210707 138
321 3300009098 Ga0105245_10087577 Ga0105245_100875772 138
322 3300009098 Ga0105245_10105160 Ga0105245_101051602 138
323 3300009101 Ga0105247_10011072 Ga0105247_100110725 138
324 3300009147 Ga0114129_10152136 Ga0114129_101521361 138
325 3300009147 Ga0114129_10560789 Ga0114129_105607893 138
326 3300009147 Ga0114129_11499005 Ga0114129_114990051 138
327 3300009147 Ga0114129_11670967 Ga0114129_116709672 138
328 3300009147 Ga0114129_12337654 Ga0114129_123376541 138
329 3300009148 Ga0105243_10392677 Ga0105243_103926773 138
330 3300009148 Ga0105243_10480418 Ga0105243_104804182 138
331 3300009148 Ga0105243_11808069 Ga0105243_118080691 138
332 3300009174 Ga0105241_10443791 Ga0105241_104437912 138
333 3300009174 Ga0105241_11351626 Ga0105241_113516262 138
334 3300009176 Ga0105242_10040109 Ga0105242_100401094 138
335 3300009176 Ga0105242_10081955 Ga0105242_100819552 138
336 3300009177 Ga0105248_10012713 Ga0105248_100127134 138
337 3300009177 Ga0105248_10016697 Ga0105248_100166976 138
338 3300009177 Ga0105248_10147607 Ga0105248_101476073 138
339 3300009177 Ga0105248_10343732 Ga0105248_103437322 138
340 3300009177 Ga0105248_10376695 Ga0105248_103766952 138
341 3300009177 Ga0105248_10749130 Ga0105248_107491302 138
342 3300009177 Ga0105248_12788511 Ga0105248_127885112 138
343 3300009551 Ga0105238_10630599 Ga0105238_106305992 138
344 3300009551 Ga0105238_11405115 Ga0105238_114051152 138
345 3300009553 Ga0105249_10013317 Ga0105249_100133172 138
346 3300009553 Ga0105249_11282879 Ga0105249_112828792 138
347 3300010375 Ga0105239_12204528 Ga0105239_122045281 138
348 3300011119 Ga0105246_10133502 Ga0105246_101335023 138
349 3300011119 Ga0105246_10140078 Ga0105246_101400781 138
350 3300011119 Ga0105246_10154402 Ga0105246_101544022 138
351 3300011119 Ga0105246_10528273 Ga0105246_105282732 138
352 3300013105 Ga0157369_10073719 Ga0157369_100737192 138
353 3300013296 Ga0157374_10005772 Ga0157374_100057724 138
354 3300013296 Ga0157374_10524731 Ga0157374_105247313 138
355 3300013296 Ga0157374_11114785 Ga0157374_111147852 138
356 3300013297 Ga0157378_10481020 Ga0157378_104810203 138
357 3300013297 Ga0157378_10578753 Ga0157378_105787532 138
358 3300013297 Ga0157378_10940107 Ga0157378_109401072 138
359 3300013297 Ga0157378_11714476 Ga0157378_117144762 138
360 3300013297 Ga0157378_12152645 Ga0157378_121526451 138
361 3300013306 Ga0163162_10091980 Ga0163162_100919802 138
362 3300013306 Ga0163162_10300998 Ga0163162_103009982 138
363 3300013306 Ga0163162_10358670 Ga0163162_103586702 138
364 3300013308 Ga0157375_10236291 Ga0157375_102362913 138
365 3300013308 Ga0157375_10655377 Ga0157375_106553773 138
366 3300013308 Ga0157375_11624837 Ga0157375_116248371 138
367 3300013308 Ga0157375_11708351 Ga0157375_117083512 138
368 3300013308 Ga0157375_12154389 Ga0157375_121543891 138
369 3300014325 Ga0163163_10008708 Ga0163163_100087085 138
370 3300014325 Ga0163163_10226472 Ga0163163_102264722 138
371 3300014325 Ga0163163_10519543 Ga0163163_105195432 138
372 3300014325 Ga0163163_11144980 Ga0163163_111449802 138
373 3300014325 Ga0163163_12373316 Ga0163163_123733161 138
374 3300014326 Ga0157380_10237373 Ga0157380_102373732 138
375 3300014326 Ga0157380_10296274 Ga0157380_102962743 138
376 3300014326 Ga0157380_10816630 Ga0157380_108166302 138
377 3300014745 Ga0157377_10260035 Ga0157377_102600352 138
378 3300014745 Ga0157377_10789689 Ga0157377_107896891 138
379 3300014968 Ga0157379_10040715 Ga0157379_100407152 138
380 3300014968 Ga0157379_10041656 Ga0157379_100416562 138
381 3300014968 Ga0157379_10071635 Ga0157379_100716352 138
382 3300014968 Ga0157379_11753238 Ga0157379_117532381 138
383 3300014969 Ga0157376_10028229 Ga0157376_100282292 138
384 3300014969 Ga0157376_10036669 Ga0157376_100366691 138
385 3300014969 Ga0157376_10093640 Ga0157376_100936403 138
386 3300014969 Ga0157376_10172439 Ga0157376_101724393 138
387 3300014969 Ga0157376_10433947 Ga0157376_104339471 138
388 3300025271 Ga0207666_1009081 Ga0207666_10090811 138
389 3300025315 Ga0207697_10030192 Ga0207697_100301923 138
390 3300025321 Ga0207656_10054451 Ga0207656_100544512 138
391 3300025885 Ga0207653_10054460 Ga0207653_100544602 138
392 3300025893 Ga0207682_10073963 Ga0207682_100739633 138
393 3300025899 Ga0207642_10039001 Ga0207642_100390012 138
394 3300025900 Ga0207710_10013426 Ga0207710_100134264 138
395 3300025903 Ga0207680_10051906 Ga0207680_100519063 138
396 3300025903 Ga0207680_10156834 Ga0207680_101568342 138
397 3300025904 Ga0207647_10388961 Ga0207647_103889611 138
398 3300025904 Ga0207647_10434019 Ga0207647_104340191 138
399 3300025905 Ga0207685_10466500 Ga0207685_104665001 138
400 3300025906 Ga0207699_10044655 Ga0207699_100446552 138
401 3300025907 Ga0207645_10086341 Ga0207645_100863413 138
402 3300025907 Ga0207645_10404308 Ga0207645_104043081 138
403 3300025908 Ga0207643_10005644 Ga0207643_100056444 138
404 3300025908 Ga0207643_10027486 Ga0207643_100274866 138
405 3300025908 Ga0207643_10199487 Ga0207643_101994873 138
406 3300025911 Ga0207654_10333357 Ga0207654_103333571 138
407 3300025911 Ga0207654_10541324 Ga0207654_105413241 138
408 3300025912 Ga0207707_10002331 Ga0207707_1000233120 138
409 3300025917 Ga0207660_10078893 Ga0207660_100788932 138
410 3300025917 Ga0207660_10129911 Ga0207660_101299113 138
411 3300025918 Ga0207662_10006037 Ga0207662_100060371 138
412 3300025918 Ga0207662_10131960 Ga0207662_101319601 138
413 3300025918 Ga0207662_10784737 Ga0207662_107847371 138
414 3300025920 Ga0207649_10229968 Ga0207649_102299683 138
415 3300025920 Ga0207649_10677644 Ga0207649_106776441 138
416 3300025921 Ga0207652_10177492 Ga0207652_101774922 138
417 3300025922 Ga0207646_10213937 Ga0207646_102139372 138
418 3300025922 Ga0207646_10649260 Ga0207646_106492601 138
419 3300025923 Ga0207681_10002833 Ga0207681_100028332 138
420 3300025923 Ga0207681_10181784 Ga0207681_101817842 138
421 3300025923 Ga0207681_10414341 Ga0207681_104143412 138
422 3300025924 Ga0207694_11136540 Ga0207694_111365401 138
423 3300025925 Ga0207650_10037170 Ga0207650_100371703 138
424 3300025925 Ga0207650_10071265 Ga0207650_100712651 138
425 3300025925 Ga0207650_10116418 Ga0207650_101164181 138
426 3300025925 Ga0207650_10392811 Ga0207650_103928111 138
427 3300025926 Ga0207659_10004564 Ga0207659_100045643 138
428 3300025926 Ga0207659_10009311 Ga0207659_100093115 138
429 3300025926 Ga0207659_10075213 Ga0207659_100752131 138
430 3300025926 Ga0207659_10140147 Ga0207659_101401473 138
431 3300025926 Ga0207659_10214879 Ga0207659_102148792 138
432 3300025927 Ga0207687_10028425 Ga0207687_100284253 138
433 3300025927 Ga0207687_10431668 Ga0207687_104316682 138
434 3300025931 Ga0207644_10044383 Ga0207644_100443831 138
435 3300025931 Ga0207644_10147934 Ga0207644_101479342 138
436 3300025931 Ga0207644_10911801 Ga0207644_109118011 138
437 3300025933 Ga0207706_10080619 Ga0207706_100806194 138
438 3300025933 Ga0207706_10670085 Ga0207706_106700852 138
439 3300025934 Ga0207686_10065762 Ga0207686_100657623 138
440 3300025934 Ga0207686_10515169 Ga0207686_105151692 138
441 3300025935 Ga0207709_10077526 Ga0207709_100775263 138
442 3300025935 Ga0207709_10279372 Ga0207709_102793722 138
443 3300025936 Ga0207670_10005144 Ga0207670_100051448 138
444 3300025936 Ga0207670_10043284 Ga0207670_100432842 138
445 3300025936 Ga0207670_10684135 Ga0207670_106841352 138
446 3300025937 Ga0207669_10108544 Ga0207669_101085442 138
447 3300025937 Ga0207669_10126398 Ga0207669_101263981 138
448 3300025937 Ga0207669_10559842 Ga0207669_105598422 138
449 3300025939 Ga0207665_10052202 Ga0207665_100522022 138
450 3300025940 Ga0207691_10063783 Ga0207691_100637833 138
451 3300025940 Ga0207691_10090278 Ga0207691_100902783 138
452 3300025940 Ga0207691_10146651 Ga0207691_101466512 138
453 3300025940 Ga0207691_10227586 Ga0207691_102275862 138
454 3300025940 Ga0207691_10785184 Ga0207691_107851841 138
455 3300025940 Ga0207691_11251229 Ga0207691_112512291 138
456 3300025941 Ga0207711_10016981 Ga0207711_100169816 138
457 3300025941 Ga0207711_10019080 Ga0207711_100190804 138
458 3300025941 Ga0207711_10697282 Ga0207711_106972822 138
459 3300025941 Ga0207711_11684745 Ga0207711_116847451 138
460 3300025942 Ga0207689_10029115 Ga0207689_100291154 138
461 3300025942 Ga0207689_10089714 Ga0207689_100897142 138
462 3300025942 Ga0207689_10256063 Ga0207689_102560632 138
463 3300025942 Ga0207689_11368388 Ga0207689_113683881 138
464 3300025944 Ga0207661_10227638 Ga0207661_102276383 138
465 3300025945 Ga0207679_10136904 Ga0207679_101369042 138
466 3300025945 Ga0207679_10927422 Ga0207679_109274222 138
467 3300025960 Ga0207651_10030586 Ga0207651_100305862 138
468 3300025960 Ga0207651_10088252 Ga0207651_100882523 138
469 3300025960 Ga0207651_10107092 Ga0207651_101070923 138
470 3300025960 Ga0207651_10922076 Ga0207651_109220761 138
471 3300025960 Ga0207651_10931858 Ga0207651_109318581 138
472 3300025961 Ga0207712_10613650 Ga0207712_106136501 138
473 3300025972 Ga0207668_10197839 Ga0207668_101978392 138
474 3300025981 Ga0207640_10219179 Ga0207640_102191792 138
475 3300025986 Ga0207658_10134519 Ga0207658_101345193 138
476 3300025986 Ga0207658_10767350 Ga0207658_107673501 138
477 3300026023 Ga0207677_10018548 Ga0207677_100185485 138
478 3300026023 Ga0207677_10215836 Ga0207677_102158362 138
479 3300026023 Ga0207677_10263549 Ga0207677_102635492 138
480 3300026023 Ga0207677_10360007 Ga0207677_103600072 138
481 3300026035 Ga0207703_10004498 Ga0207703_1000449814 138
482 3300026035 Ga0207703_10023908 Ga0207703_100239084 138
483 3300026035 Ga0207703_10134964 Ga0207703_101349642 138
484 3300026035 Ga0207703_10170408 Ga0207703_101704082 138
485 3300026035 Ga0207703_10688354 Ga0207703_106883542 138
486 3300026041 Ga0207639_10298134 Ga0207639_102981342 138
487 3300026075 Ga0207708_10020209 Ga0207708_100202096 138
488 3300026075 Ga0207708_10036795 Ga0207708_100367952 138
489 3300026075 Ga0207708_10049016 Ga0207708_100490163 138
490 3300026075 Ga0207708_10381391 Ga0207708_103813912 138
491 3300026078 Ga0207702_12225006 Ga0207702_122250061 138
492 3300026088 Ga0207641_10045110 Ga0207641_100451104 138
493 3300026088 Ga0207641_10048860 Ga0207641_100488602 138
494 3300026088 Ga0207641_10091025 Ga0207641_100910252 138
495 3300026088 Ga0207641_10092906 Ga0207641_100929062 138
496 3300026088 Ga0207641_10282042 Ga0207641_102820423 138
497 3300026088 Ga0207641_11063194 Ga0207641_110631942 138
498 3300026088 Ga0207641_11763458 Ga0207641_117634581 138
499 3300026089 Ga0207648_10000844 Ga0207648_100008447 138
500 3300026089 Ga0207648_10081967 Ga0207648_100819671 138
501 3300026089 Ga0207648_10284180 Ga0207648_102841802 138
502 3300026089 Ga0207648_10383397 Ga0207648_103833973 138
503 3300026095 Ga0207676_10058395 Ga0207676_100583954 138
504 3300026095 Ga0207676_10072530 Ga0207676_100725301 138
505 3300026095 Ga0207676_10132112 Ga0207676_101321123 138
506 3300026095 Ga0207676_10198270 Ga0207676_101982702 138
507 3300026095 Ga0207676_10280606 Ga0207676_102806062 138
508 3300026116 Ga0207674_10009268 Ga0207674_1000926814 138
509 3300026116 Ga0207674_10119086 Ga0207674_101190862 138
510 3300026116 Ga0207674_10981151 Ga0207674_109811512 138
511 3300026116 Ga0207674_11827751 Ga0207674_118277511 138
512 3300026118 Ga0207675_100001335 Ga0207675_10000133524 138
513 3300026118 Ga0207675_100113852 Ga0207675_1001138524 138
514 3300026118 Ga0207675_100218887 Ga0207675_1002188872 138
515 3300026118 Ga0207675_100861803 Ga0207675_1008618031 138
516 3300026121 Ga0207683_10047044 Ga0207683_100470444 138
517 3300026121 Ga0207683_10083670 Ga0207683_100836703 138
518 3300026142 Ga0207698_10272137 Ga0207698_102721372 138
519 3300027866 Ga0209813_10136239 Ga0209813_101362392 138
520 3300027907 Ga0207428_10056271 Ga0207428_100562713 138
521 3300027907 Ga0207428_10271485 Ga0207428_102714853 138
522 3300027907 Ga0207428_11008650 Ga0207428_110086501 138
523 3300028379 Ga0268266_10009932 Ga0268266_100099327 138
524 3300028379 Ga0268266_10261848 Ga0268266_102618482 138
525 3300028379 Ga0268266_11289845 Ga0268266_112898451 138
526 3300028380 Ga0268265_10006637 Ga0268265_100066372 138
527 3300028380 Ga0268265_10346621 Ga0268265_103466212 138
528 3300028380 Ga0268265_11665896 Ga0268265_116658961 138
529 3300028381 Ga0268264_10112212 Ga0268264_101122123 138
530 3300028381 Ga0268264_10533758 Ga0268264_105337582 138
531 3300028381 Ga0268264_10871876 Ga0268264_108718762 138
532 3300028381 Ga0268264_10912349 Ga0268264_109123491 138
533 3300028381 Ga0268264_10917398 Ga0268264_109173982 138
534 3300031090 Ga0265760_10025103 Ga0265760_100251032 138
535 3300035091 Ga0373951_0077844 Ga0373951_0077844_297_734 138
536 3300035092 Ga0373952_0250388 Ga0373952_0250388_15_452 138
537 3300035112 Ga0373932_0035450 Ga0373932_0035450_900_1337 138
538 3300035114 Ga0373939_0242188 Ga0373939_0242188_65_502 138
539 3300035115 Ga0373941_0012238 Ga0373941_0012238_1277_1714 138
540 3300035118 Ga0373954_0267417 Ga0373954_0267417_218_655 138
541 3300035118 Ga0373954_0284684 Ga0373954_0284684_359_799 138
542 3300035119 Ga0373956_0014364 Ga0373956_0014364_964_1398 138
543 3300035119 Ga0373956_0026411 Ga0373956_0026411_1909_2346 138
544 3300035170 Ga0373943_0579272 Ga0373943_0579272_101_538 138
545 3300035172 Ga0373955_0069612 Ga0373955_0069612_1300_1743 138
546 3300035172 Ga0373955_0099850 Ga0373955_0099850_688_1125 138
547 3300035172 Ga0373955_0870082 Ga0373955_0870082_23_463 138
548 3300035241 Ga0373961_0089640 Ga0373961_0089640_299_736 138
549 3300035691 Ga0373931_0233620 Ga0373931_0233620_138_575 138
550 3300035691 Ga0373931_0671456 Ga0373931_0671456_149_586 138
551 3300035692 Ga0373935_0068728 Ga0373935_0068728_989_1429 138
552 3300035692 Ga0373935_0217476 Ga0373935_0217476_217_654 138
553 3300035692 Ga0373935_1449759 Ga0373935_1449759_11_448 138
554 3300035695 Ga0373927_0455479 Ga0373927_0455479_392_832 138
555 3300035695 Ga0373927_0621610 Ga0373927_0621610_45_482 138
556 3300035724 Ga0373933_0108697 Ga0373933_0108697_49_486 138
557 3300036401 Ga0373937_0119345 Ga0373937_0119345_202_639 138
558 3300036401 Ga0373937_0172060 Ga0373937_0172060_846_1283 138
559 3300037068 Ga0373925_0133519 Ga0373925_0133519_218_658 138
560 3300037068 Ga0373925_0458778 Ga0373925_0458778_150_587 138
561 3300042436 Ga0439435_0029068 Ga0439435_0029068_968_1402 138
562 3300042876 Ga0451577_0961838 Ga0451577_0961838_266_703 138
563 3300044673 Ga0453683_0040415 Ga0453683_0040415_1659_2099 138
564 3300044712 Ga0453684_0206297 Ga0453684_0206297_1605_2045 138
565 3300044712 Ga0453684_1041784 Ga0453684_1041784_350_787 138
566 3300044712 Ga0453684_2278021 Ga0453684_2278021_82_519 138
567 3300045051 Ga0451576_0087303 Ga0451576_0087303_2756_3193 138
568 3300045051 Ga0451576_0101461 Ga0451576_0101461_2333_2770 138
569 3300045051 Ga0451576_0325012 Ga0451576_0325012_904_1341 138
570 3300046455 Ga0495603_0006905 Ga0495603_0006905_664_1101 138
571 3300046472 Ga0495580_0059640 Ga0495580_0059640_568_1008 138
572 3300046472 Ga0495580_0755189 Ga0495580_0755189_59_487 138
573 3300046473 Ga0495582_0338614 Ga0495582_0338614_369_809 138
574 3300046475 Ga0495639_0247178 Ga0495639_0247178_180_617 138
575 3300046476 Ga0495662_0043266 Ga0495662_0043266_168_608 138
576 3300046499 Ga0495594_0023874 Ga0495594_0023874_2375_2812 138
577 3300046501 Ga0495607_0473772 Ga0495607_0473772_62_499 138
578 3300046517 Ga0495630_1108629 Ga0495630_1108629_67_504 138
579 3300046517 Ga0495630_1233074 Ga0495630_1233074_46_474 138
580 3300046525 Ga0495663_0097205 Ga0495663_0097205_62_499 138
581 3300046528 Ga0495642_0057380 Ga0495642_0057380_134_571 138
582 3300046528 Ga0495642_0100233 Ga0495642_0100233_582_1019 138
583 3300046533 Ga0495640_0326446 Ga0495640_0326446_448_885 138
584 3300046539 Ga0495621_0212581 Ga0495621_0212581_41_478 138
585 3300046543 Ga0495645_0031447 Ga0495645_0031447_1709_2146 138
586 3300046543 Ga0495645_0736936 Ga0495645_0736936_37_474 138
587 3300046558 Ga0495633_0421100 Ga0495633_0421100_15_452 138
588 3300046559 Ga0495667_0605302 Ga0495667_0605302_175_612 138
589 3300046648 Ga0495611_0253885 Ga0495611_0253885_301_738 138
590 3300046664 Ga0495659_0002267 Ga0495659_0002267_5492_5929 138
591 3300046664 Ga0495659_0034483 Ga0495659_0034483_279_716 138
592 3300046664 Ga0495659_0074444 Ga0495659_0074444_96_533 138
593 3300046664 Ga0495659_0335553 Ga0495659_0335553_158_595 138
594 3300046674 Ga0495588_0005306 Ga0495588_0005306_188_625 138
595 3300046678 Ga0495599_0259922 Ga0495599_0259922_122_559 138
596 3300046681 Ga0495647_0002231 Ga0495647_0002231_5111_5551 138
597 3300046683 Ga0495658_0103481 Ga0495658_0103481_63_500 138
598 3300046683 Ga0495658_0678133 Ga0495658_0678133_82_519 138
599 3300046684 Ga0495669_0007901 Ga0495669_0007901_2675_3112 138
600 3300046689 Ga0495613_0115078 Ga0495613_0115078_566_1003 138
601 3300046690 Ga0495624_0831148 Ga0495624_0831148_42_482 138
602 3300046691 Ga0495670_0044274 Ga0495670_0044274_1635_2072 138
603 3300046809 Ga0495600_0132661 Ga0495600_0132661_491_928 138
604 3300047318 Ga0495636_0043461 Ga0495636_0043461_637_1074 138
605 3300047318 Ga0495636_0057754 Ga0495636_0057754_502_939 138
606 3300047319 Ga0495674_0858532 Ga0495674_0858532_52_486 138
607 3300047447 Ga0495685_134363 Ga0495685_134363_235_672 138
608 3300048903 Ga0496100_0253325 Ga0496100_0253325_358_798 138
609 3300048905 Ga0496102_0624138 Ga0496102_0624138_514_951 138
610 3300048907 Ga0496104_0179552 Ga0496104_0179552_712_1149 138
611 3300048907 Ga0496104_0276825 Ga0496104_0276825_987_1424 138
612 3300048907 Ga0496104_0636252 Ga0496104_0636252_252_695 138
613 3300048907 Ga0496104_1176686 Ga0496104_1176686_131_571 138
614 3300048908 Ga0496105_1147989 Ga0496105_1147989_65_508 138
615 3300048909 Ga0496106_0395936 Ga0496106_0395936_351_788 138
616 3300048909 Ga0496106_1079208 Ga0496106_1079208_76_513 138
617 3300048911 Ga0496108_0296490 Ga0496108_0296490_27_464 138
618 3300048912 Ga0496109_1533391 Ga0496109_1533391_58_498 138
619 3300048912 Ga0496109_1846267 Ga0496109_1846267_21_455 138
620 3300048913 Ga0496110_0657457 Ga0496110_0657457_303_740 138
621 3300048914 Ga0496111_0809733 Ga0496111_0809733_13_453 138
622 3300048915 Ga0496112_0012702 Ga0496112_0012702_1486_1923 138
623 3300048915 Ga0496112_1054240 Ga0496112_1054240_126_560 138
624 3300048915 Ga0496112_1242032 Ga0496112_1242032_102_542 138
625 3300048916 Ga0496113_0012726 Ga0496113_0012726_4901_5338 138
626 3300048916 Ga0496113_0498141 Ga0496113_0498141_396_830 138
627 3300048917 Ga0496114_0057539 Ga0496114_0057539_1220_1657 138
628 3300049575 Ga0501039_1543135 Ga0501039_1543135_27_461 138
629 3300049588 Ga0501072_0303396 Ga0501072_0303396_655_1119 138
630 3300049592 Ga0501076_0962294 Ga0501076_0962294_150_614 138
631 3300050491 nmdc:mga00v17_576177_c1 nmdc:mga00v17_576177_c1_160_597 138
632 3300050494 nmdc:mga06z11_930370_c1 nmdc:mga06z11_930370_c1_71_508 138
633 3300050494 nmdc:mga06z11_97271_c1 nmdc:mga06z11_97271_c1_1134_1571 138
634 3300050495 nmdc:mga04h51_132875_c1 nmdc:mga04h51_132875_c1_80_517 138
635 3300050496 nmdc:mga07m45_531293_c1 nmdc:mga07m45_531293_c1_219_656 138
636 3300050507 nmdc:mga05p37_151491_c2 nmdc:mga05p37_151491_c2_949_1386 138
637 3300050507 nmdc:mga05p37_2000542_c1 nmdc:mga05p37_2000542_c1_89_526 138
638 3300050507 nmdc:mga05p37_2703_c1 nmdc:mga05p37_2703_c1_7212_7649 138
639 3300050511 nmdc:mga08y16_174979_c1 nmdc:mga08y16_174979_c1_228_665 138
640 3300050511 nmdc:mga08y16_889174_c1 nmdc:mga08y16_889174_c1_231_668 138
641 3300050512 nmdc:mga0n895_1547270_c1 nmdc:mga0n895_1547270_c1_95_532 138
642 3300050512 nmdc:mga0n895_1704806_c1 nmdc:mga0n895_1704806_c1_142_579 138
643 3300050512 nmdc:mga0n895_20877_c1 nmdc:mga0n895_20877_c1_1940_2377 138
644 3300050512 nmdc:mga0n895_625324_c1 nmdc:mga0n895_625324_c1_508_945 138
645 3300050513 nmdc:mga0rr50_283386_c1 nmdc:mga0rr50_283386_c1_620_1057 138
646 3300050513 nmdc:mga0rr50_8733_c1 nmdc:mga0rr50_8733_c1_774_1211 138
647 3300050514 nmdc:mga08x19_1094867_c1 nmdc:mga08x19_1094867_c1_103_540 138
648 3300050514 nmdc:mga08x19_21010_c1 nmdc:mga08x19_21010_c1_2272_2709 138
649 3300050515 nmdc:mga0a205_22081_c1 nmdc:mga0a205_22081_c1_924_1361 138
650 3300050515 nmdc:mga0a205_37742_c1 nmdc:mga0a205_37742_c1_2221_2658 138
651 3300050515 nmdc:mga0a205_435073_c1 nmdc:mga0a205_435073_c1_225_662 138
652 3300050515 nmdc:mga0a205_6451_c1 nmdc:mga0a205_6451_c1_6204_6641 138
653 3300050516 nmdc:mga0sz30_432419_c1 nmdc:mga0sz30_432419_c1_128_565 138
654 3300053084 Ga0495595_0025258 Ga0495595_0025258_2052_2489 138
655 3300053084 Ga0495595_0361961 Ga0495595_0361961_227_670 138
656 3300053085 Ga0495619_0473554 Ga0495619_0473554_369_806 138
657 3300030744 Ga0316181_1222148 Ga0316181_12221481 141
658 3300032004 Ga0307414_10266110 Ga0307414_102661102 141
659 3300049758 Ga0501241_002671 Ga0501241_002671_1118_1549 141
660 3300003323 rootH1_10076471 rootH1_100764715 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20136

DUF6526

Family of unknown function (DUF6526)

9

154

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tmh-assembly1.cif.gz_K cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.8887 18 60
1xvl-assembly3.cif.gz_C the three-dimensional structure of mntc from synechocystis 6803 0.8005 18 64
6sdk-assembly1.cif.gz_B crystal structure of bacterial parb dimer bound to cdp 0.7475 80 133
7nfu-assembly2.cif.gz_B crystal structure of c-terminally truncated geobacillus thermoleovorans nucleoid occlusion protein noc 0.7296 67 131
6kkm-assembly1.cif.gz_G-2 crystal structure of rbcl-raf1 complex from anabaena sp. pcc 7120 0.7222 69 131
ID Description Score Start End Superfamily
5jg7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8841 18 64 3.40.50.1980
af_Q2G118_97_208_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.805 95 131 1.10.10.2830
1vz0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.7259 79 129 1.10.10.2830
af_B4FTT4_81_159_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.58 17 69 1.10.287.70
4v1gB00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5201 9 64 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A4V2A2Y4-F1-model_v4 Uncharacterized protein 0.9751 60 143
AF-A0A519Z5M5-F1-model_v4 Uncharacterized protein 0.9572 59 143
AF-A0A223V3F7-F1-model_v4 Uncharacterized protein 0.956 64 143
AF-A0A4V2A2Y4-F1-model_v4 Uncharacterized protein 0.9529 60 143
AF-A0A0E9MYA1-F1-model_v4 Uncharacterized protein 0.9496 43 143

Feature Viewer

pLDDT pTM Quality
90.1 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map