F473379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 333 | 639 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100012671|Ga0070668_1000126715 |
| Length | 148 |
| Sequence | MSAPSETGGHGSGGRTADAAVQSESDRVAEFTAFRQRMNERILAEPNQVVRRFFALDTQTYQPGALDVKTKELLGLVASMVLRCDDCISYHVAQCREAGVDRDEMFEAFSVGLVVGGSIVIPHLRRAVDFLDKLEQGGEATQPAHDHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 7 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 8 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 9 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 10 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 11 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 12 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 13 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 14 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 15 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 16 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 17 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 18 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 19 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 20 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 21 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 28 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 29 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 30 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 31 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 32 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 57 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 102 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 105 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 106 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 107 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 109 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 110 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 124 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 125 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 215 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 216 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 218 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 219 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 229 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 230 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 231 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 232 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 234 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 235 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 240 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 241 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 244 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 245 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 246 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 293 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 312 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 313 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 314 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 315 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 318 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 323 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 324 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 325 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 328 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 332 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 333 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.46 |
| Metatranscriptomes | 1.06 |
| Isolates | 3.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.91 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 69.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10013411 | 3300001990 | Bacteria | 2668 |
| 2 | JGI24735J21928_10025036 | 3300002067 | Bacteria | 1802 |
| 3 | JGI25156J39149_1004997 | 3300002705 | Bacteria | 3917 |
| 4 | JGI25156J39149_1045019 | 3300002705 | Bacteria | 595 |
| 5 | JGI25162J39368_1001443 | 3300002737 | Bacteria | 12678 |
| 6 | JGI25162J39368_1001962 | 3300002737 | Bacteria | 9238 |
| 7 | JGI25162J39368_1002285 | 3300002737 | Bacteria | 7729 |
| 8 | JGI25162J39368_1002323 | 3300002737 | Bacteria | 7598 |
| 9 | JGI25162J39368_1002410 | 3300002737 | Bacteria | 7326 |
| 10 | JGI25162J39368_1015344 | 3300002737 | Bacteria | 794 |
| 11 | JGI25157J39369_1000345 | 3300002741 | Bacteria | 32775 |
| 12 | JGI25157J39369_1001104 | 3300002741 | Bacteria | 12036 |
| 13 | JGI25157J39369_1001366 | 3300002741 | Bacteria | 9533 |
| 14 | JGI25157J39369_1001483 | 3300002741 | Bacteria | 8643 |
| 15 | JGI25157J39369_1002835 | 3300002741 | Bacteria | 3921 |
| 16 | JGI25163J39215_1000517 | 3300002771 | Bacteria | 11391 |
| 17 | JGI25164J39214_1000035 | 3300002772 | Bacteria | 139987 |
| 18 | JGI25164J39214_1000214 | 3300002772 | Bacteria | 47762 |
| 19 | JGI25164J39214_1000964 | 3300002772 | Bacteria | 9234 |
| 20 | JGI25151J46595_10001223 | 3300003187 | Bacteria | 18350 |
| 21 | JGI25151J46595_10056804 | 3300003187 | Bacteria | 1281 |
| 22 | JGI25165J46597_1000226 | 3300003214 | Bacteria | 78481 |
| 23 | JGI25165J46597_1000260 | 3300003214 | Bacteria | 70453 |
| 24 | JGI25165J46597_1001786 | 3300003214 | Bacteria | 9238 |
| 25 | rootH1_10005491 | 3300003316 | Bacteria | 3532 |
| 26 | rootH1_10005491 | 3300003323 | Bacteria | 15715 |
| 27 | rootH1_10005492 | 3300003316 | Bacteria | 5293 |
| 28 | rootH1_10044861 | 3300003316 | Bacteria | 3039 |
| 29 | Ga0055538_1002032 | 3300003751 | Bacteria | 3271 |
| 30 | Ga0055533_1000336 | 3300003756 | Bacteria | 20596 |
| 31 | Ga0055527_1003185 | 3300003760 | Bacteria | 2511 |
| 32 | Ga0055535_1000323 | 3300003761 | Bacteria | 48370 |
| 33 | Ga0055535_1000642 | 3300003761 | Bacteria | 27803 |
| 34 | Ga0055535_1000810 | 3300003761 | Bacteria | 22612 |
| 35 | Ga0055535_1005001 | 3300003761 | Bacteria | 3031 |
| 36 | Ga0055535_1015573 | 3300003761 | Bacteria | 1062 |
| 37 | Ga0055542_1000442 | 3300003762 | Bacteria | 39685 |
| 38 | Ga0055542_1000522 | 3300003762 | Bacteria | 34617 |
| 39 | Ga0055542_1001347 | 3300003762 | Bacteria | 12678 |
| 40 | Ga0055542_1001348 | 3300003762 | Bacteria | 12672 |
| 41 | Ga0055529_1000233 | 3300003763 | Bacteria | 70453 |
| 42 | Ga0055529_1000367 | 3300003763 | Bacteria | 48920 |
| 43 | Ga0055529_1006460 | 3300003763 | Bacteria | 1637 |
| 44 | Ga0055526_1000145 | 3300003771 | Bacteria | 62400 |
| 45 | Ga0055526_1014252 | 3300003771 | Bacteria | 3285 |
| 46 | Ga0055537_1000551 | 3300003773 | Bacteria | 21389 |
| 47 | Ga0055524_1000211 | 3300003775 | Bacteria | 62400 |
| 48 | Ga0055524_1012932 | 3300003775 | Bacteria | 3178 |
| 49 | Ga0055524_1013700 | 3300003775 | Bacteria | 3046 |
| 50 | Ga0055524_1014505 | 3300003775 | Bacteria | 2917 |
| 51 | Ga0055536_1010890 | 3300003781 | Bacteria | 3551 |
| 52 | Ga0055536_1052790 | 3300003781 | Bacteria | 883 |
| 53 | Ga0055536_1087917 | 3300003781 | Bacteria | 577 |
| 54 | Ga0055534_1000107 | 3300003784 | Bacteria | 62400 |
| 55 | Ga0055534_1013160 | 3300003784 | Bacteria | 1599 |
| 56 | Ga0055528_1000027 | 3300003790 | Bacteria | 126420 |
| 57 | Ga0055530_10000953 | 3300003791 | Bacteria | 23664 |
| 58 | Ga0055531_10011192 | 3300003794 | Bacteria | 4361 |
| 59 | Ga0055531_10037414 | 3300003794 | Bacteria | 1477 |
| 60 | Ga0055531_10037460 | 3300003794 | Bacteria | 1474 |
| 61 | Ga0055541_1011864 | 3300003841 | Bacteria | 1266 |
| 62 | Ga0065165_1001244 | 3300005262 | Bacteria | 29035 |
| 63 | Ga0065704_10465274 | 3300005289 | Bacteria | 694 |
| 64 | Ga0065715_10007122 | 3300005293 | Bacteria | 4300 |
| 65 | Ga0065715_10541578 | 3300005293 | Bacteria | 748 |
| 66 | Ga0070658_10595004 | 3300005327 | Bacteria | 958 |
| 67 | Ga0070690_100239057 | 3300005330 | Bacteria | 1280 |
| 68 | Ga0070670_100166733 | 3300005331 | Bacteria | 1910 |
| 69 | Ga0070670_100365180 | 3300005331 | Bacteria | 1270 |
| 70 | Ga0070670_100410383 | 3300005331 | Bacteria | 1197 |
| 71 | Ga0070666_11254084 | 3300005335 | Bacteria | 553 |
| 72 | Ga0070680_100462949 | 3300005336 | Bacteria | 1083 |
| 73 | Ga0070682_100003250 | 3300005337 | Bacteria | 9016 |
| 74 | Ga0070682_100023162 | 3300005337 | Bacteria | 3686 |
| 75 | Ga0068868_101928564 | 3300005338 | Bacteria | 560 |
| 76 | Ga0070660_100873260 | 3300005339 | Bacteria | 758 |
| 77 | Ga0070660_101282204 | 3300005339 | Bacteria | 622 |
| 78 | Ga0070689_100056593 | 3300005340 | Bacteria | 3041 |
| 79 | Ga0070689_100347788 | 3300005340 | Bacteria | 1243 |
| 80 | Ga0070687_100669774 | 3300005343 | Bacteria | 721 |
| 81 | Ga0070661_100016933 | 3300005344 | Bacteria | 5162 |
| 82 | Ga0070668_100012671 | 3300005347 | Bacteria | 6277 |
| 83 | Ga0070668_100043221 | 3300005347 | Bacteria | 3455 |
| 84 | Ga0070668_100141071 | 3300005347 | Bacteria | 1942 |
| 85 | Ga0070668_101516943 | 3300005347 | Bacteria | 613 |
| 86 | Ga0070669_100029557 | 3300005353 | Bacteria | 3951 |
| 87 | Ga0070671_100170561 | 3300005355 | Bacteria | 1840 |
| 88 | Ga0070671_100300204 | 3300005355 | Bacteria | 1367 |
| 89 | Ga0070673_100137023 | 3300005364 | Bacteria | 2061 |
| 90 | Ga0070673_100186066 | 3300005364 | Bacteria | 1781 |
| 91 | Ga0070688_100071787 | 3300005365 | Bacteria | 2217 |
| 92 | Ga0070659_100088580 | 3300005366 | Bacteria | 2479 |
| 93 | Ga0070659_100150360 | 3300005366 | Bacteria | 1899 |
| 94 | Ga0070714_100056167 | 3300005435 | Bacteria | 3367 |
| 95 | Ga0070713_100002503 | 3300005436 | Bacteria | 12005 |
| 96 | Ga0070713_100857970 | 3300005436 | Bacteria | 872 |
| 97 | Ga0070710_10007695 | 3300005437 | Bacteria | 5225 |
| 98 | Ga0070711_100381287 | 3300005439 | Bacteria | 1140 |
| 99 | Ga0070663_100008950 | 3300005455 | Bacteria | 6183 |
| 100 | Ga0070663_100467095 | 3300005455 | Bacteria | 1043 |
| 101 | Ga0070662_100153509 | 3300005457 | Bacteria | 1795 |
| 102 | Ga0070681_10007152 | 3300005458 | Bacteria | 10874 |
| 103 | Ga0070681_10345721 | 3300005458 | Bacteria | 1398 |
| 104 | Ga0070681_11640454 | 3300005458 | Bacteria | 569 |
| 105 | Ga0068867_100152093 | 3300005459 | Bacteria | 1819 |
| 106 | Ga0068867_101430134 | 3300005459 | Bacteria | 642 |
| 107 | Ga0070685_10011677 | 3300005466 | Bacteria | 4602 |
| 108 | Ga0070679_100023990 | 3300005530 | Bacteria | 5975 |
| 109 | Ga0070679_100199148 | 3300005530 | Bacteria | 1969 |
| 110 | Ga0068853_100050055 | 3300005539 | Bacteria | 3593 |
| 111 | Ga0068853_100230007 | 3300005539 | Bacteria | 1696 |
| 112 | Ga0068853_100627577 | 3300005539 | Bacteria | 1022 |
| 113 | Ga0070672_100040156 | 3300005543 | Bacteria | 3588 |
| 114 | Ga0070672_100094988 | 3300005543 | Bacteria | 2411 |
| 115 | Ga0070672_100283428 | 3300005543 | Bacteria | 1401 |
| 116 | Ga0070696_100004581 | 3300005546 | Bacteria | 9229 |
| 117 | Ga0070665_100785140 | 3300005548 | Bacteria | 965 |
| 118 | Ga0068855_100101644 | 3300005563 | Bacteria | 3309 |
| 119 | Ga0068855_100368953 | 3300005563 | Bacteria | 1578 |
| 120 | Ga0068855_100960681 | 3300005563 | Bacteria | 900 |
| 121 | Ga0070664_100449639 | 3300005564 | Bacteria | 1183 |
| 122 | Ga0068857_100835603 | 3300005577 | Bacteria | 881 |
| 123 | Ga0068854_100092621 | 3300005578 | Bacteria | 2251 |
| 124 | Ga0068854_100203445 | 3300005578 | Bacteria | 1558 |
| 125 | Ga0068856_100000012 | 3300005614 | Bacteria | 166032 |
| 126 | Ga0068859_100073797 | 3300005617 | Bacteria | 3450 |
| 127 | Ga0068864_100073009 | 3300005618 | Bacteria | 2991 |
| 128 | Ga0068861_100253018 | 3300005719 | Bacteria | 1504 |
| 129 | Ga0068863_100894665 | 3300005841 | Bacteria | 888 |
| 130 | Ga0068860_100185877 | 3300005843 | Bacteria | 2009 |
| 131 | Ga0068862_100037406 | 3300005844 | Bacteria | 4114 |
| 132 | Ga0068862_100877032 | 3300005844 | Bacteria | 881 |
| 133 | Ga0075364_10082841 | 3300006051 | Bacteria | 2122 |
| 134 | Ga0075364_10132214 | 3300006051 | Bacteria | 1675 |
| 135 | Ga0075364_10195750 | 3300006051 | Bacteria | 1369 |
| 136 | Ga0075364_10250989 | 3300006051 | Bacteria | 1202 |
| 137 | Ga0097620_100073795 | 3300006931 | Bacteria | 3450 |
| 138 | Ga0105240_10031027 | 3300009093 | Bacteria | 6936 |
| 139 | Ga0105240_10054282 | 3300009093 | Bacteria | 5022 |
| 140 | Ga0105243_12142846 | 3300009148 | Bacteria | 595 |
| 141 | Ga0105243_12480019 | 3300009148 | Bacteria | 557 |
| 142 | Ga0105241_10021514 | 3300009174 | Bacteria | 4768 |
| 143 | Ga0105241_10128930 | 3300009174 | Bacteria | 2045 |
| 144 | Ga0105248_10226144 | 3300009177 | Bacteria | 2106 |
| 145 | Ga0105237_10000571 | 3300009545 | Bacteria | 51560 |
| 146 | Ga0105237_10027613 | 3300009545 | Bacteria | 5790 |
| 147 | Ga0105237_10292670 | 3300009545 | Bacteria | 1631 |
| 148 | Ga0105237_11198154 | 3300009545 | Bacteria | 766 |
| 149 | Ga0105238_10025547 | 3300009551 | Bacteria | 6022 |
| 150 | Ga0105238_10178881 | 3300009551 | Bacteria | 2098 |
| 151 | Ga0105238_10210401 | 3300009551 | Bacteria | 1921 |
| 152 | Ga0105238_10391525 | 3300009551 | Bacteria | 1382 |
| 153 | Ga0105249_10017724 | 3300009553 | Bacteria | 6325 |
| 154 | Ga0105249_11795905 | 3300009553 | Bacteria | 686 |
| 155 | Ga0105148_101412 | 3300009978 | Bacteria | 1686 |
| 156 | Ga0105028_121812 | 3300009993 | Bacteria | 696 |
| 157 | Ga0105239_10026463 | 3300010375 | Bacteria | 6384 |
| 158 | Ga0105239_10239874 | 3300010375 | Bacteria | 2035 |
| 159 | Ga0105239_10458409 | 3300010375 | Bacteria | 1447 |
| 160 | Ga0157318_1000417 | 3300012482 | Bacteria | 1790 |
| 161 | Ga0157322_1044338 | 3300012490 | Bacteria | 521 |
| 162 | Ga0157319_1005395 | 3300012497 | Bacteria | 879 |
| 163 | Ga0157314_1003366 | 3300012500 | Bacteria | 1133 |
| 164 | Ga0157315_1014045 | 3300012508 | Bacteria | 762 |
| 165 | Ga0157316_1000058 | 3300012510 | Bacteria | 4676 |
| 166 | Ga0157327_1000467 | 3300012512 | Bacteria | 2165 |
| 167 | Ga0157373_10099643 | 3300013100 | Bacteria | 2045 |
| 168 | Ga0157373_10114864 | 3300013100 | Bacteria | 1893 |
| 169 | Ga0157371_10007365 | 3300013102 | Bacteria | 8918 |
| 170 | Ga0157371_10074908 | 3300013102 | Bacteria | 2397 |
| 171 | Ga0157371_11317952 | 3300013102 | Bacteria | 559 |
| 172 | Ga0157370_10004895 | 3300013104 | Bacteria | 15182 |
| 173 | Ga0157370_10005264 | 3300013104 | Bacteria | 14552 |
| 174 | Ga0157369_10000025 | 3300013105 | Bacteria | 225515 |
| 175 | Ga0157369_10039026 | 3300013105 | Bacteria | 5191 |
| 176 | Ga0157369_10163907 | 3300013105 | Bacteria | 2345 |
| 177 | Ga0157374_11005297 | 3300013296 | Bacteria | 853 |
| 178 | Ga0163162_10032740 | 3300013306 | Bacteria | 5163 |
| 179 | Ga0163162_12063065 | 3300013306 | Bacteria | 654 |
| 180 | Ga0157372_10004340 | 3300013307 | Bacteria | 15147 |
| 181 | Ga0157372_10017019 | 3300013307 | Bacteria | 7803 |
| 182 | Ga0157372_10931684 | 3300013307 | Bacteria | 1007 |
| 183 | Ga0157375_10060484 | 3300013308 | Bacteria | 3756 |
| 184 | Ga0157375_10610965 | 3300013308 | Bacteria | 1249 |
| 185 | Ga0157375_11404660 | 3300013308 | Bacteria | 822 |
| 186 | Ga0157380_10847239 | 3300014326 | Bacteria | 935 |
| 187 | Ga0182008_10036844 | 3300014497 | Bacteria | 2447 |
| 188 | Ga0182008_10092856 | 3300014497 | Bacteria | 1489 |
| 189 | Ga0157376_10041204 | 3300014969 | Bacteria | 3780 |
| 190 | Ga0157376_10167451 | 3300014969 | Bacteria | 1998 |
| 191 | Ga0182007_10005671 | 3300015262 | Bacteria | 5449 |
| 192 | Ga0182007_10052561 | 3300015262 | Bacteria | 1342 |
| 193 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 194 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 195 | Ga0206349_1350869 | 3300020075 | Bacteria | 562 |
| 196 | Ga0206350_10084533 | 3300020080 | Bacteria | 694 |
| 197 | Ga0206354_10481788 | 3300020081 | Bacteria | 1920 |
| 198 | Ga0154015_1261614 | 3300020610 | Bacteria | 1093 |
| 199 | Ga0224712_10255302 | 3300022467 | Bacteria | 811 |
| 200 | Ga0224712_10306231 | 3300022467 | Bacteria | 744 |
| 201 | Ga0209760_100358 | 3300025207 | Bacteria | 12608 |
| 202 | Ga0209784_100068 | 3300025224 | Bacteria | 152526 |
| 203 | Ga0209566_101255 | 3300025225 | Bacteria | 8599 |
| 204 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 205 | Ga0209672_100058 | 3300025228 | Bacteria | 211992 |
| 206 | Ga0209672_100791 | 3300025228 | Bacteria | 15090 |
| 207 | Ga0209672_102029 | 3300025228 | Bacteria | 5553 |
| 208 | Ga0207427_100033 | 3300025231 | Bacteria | 338459 |
| 209 | Ga0207427_100156 | 3300025231 | Bacteria | 77311 |
| 210 | Ga0207427_100312 | 3300025231 | Bacteria | 33663 |
| 211 | Ga0207427_112102 | 3300025231 | Bacteria | 866 |
| 212 | Ga0209437_100126 | 3300025233 | Bacteria | 192521 |
| 213 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 214 | Ga0209437_100154 | 3300025233 | Bacteria | 153383 |
| 215 | Ga0209437_100493 | 3300025233 | Bacteria | 28793 |
| 216 | Ga0209437_115603 | 3300025233 | Bacteria | 1034 |
| 217 | Ga0209258_100049 | 3300025242 | Bacteria | 358328 |
| 218 | Ga0209258_100095 | 3300025242 | Bacteria | 223270 |
| 219 | Ga0209258_100245 | 3300025242 | Bacteria | 100255 |
| 220 | Ga0209258_100762 | 3300025242 | Bacteria | 20039 |
| 221 | Ga0209258_105589 | 3300025242 | Bacteria | 2099 |
| 222 | Ga0207425_1006543 | 3300025245 | Bacteria | 3175 |
| 223 | Ga0207425_1071871 | 3300025245 | Bacteria | 591 |
| 224 | Ga0209646_1000810 | 3300025246 | Bacteria | 10615 |
| 225 | Ga0209646_1001694 | 3300025246 | Bacteria | 5613 |
| 226 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 227 | Ga0209026_1000140 | 3300025250 | Bacteria | 115081 |
| 228 | Ga0209026_1000405 | 3300025250 | Bacteria | 38212 |
| 229 | Ga0209026_1004452 | 3300025250 | Bacteria | 4140 |
| 230 | Ga0209026_1004720 | 3300025250 | Bacteria | 3927 |
| 231 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 232 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 233 | Ga0209148_1000039 | 3300025254 | Bacteria | 482479 |
| 234 | Ga0209148_1000087 | 3300025254 | Bacteria | 260905 |
| 235 | Ga0209759_1000316 | 3300025256 | Bacteria | 64846 |
| 236 | Ga0209759_1000338 | 3300025256 | Bacteria | 61744 |
| 237 | Ga0209759_1001070 | 3300025256 | Bacteria | 17937 |
| 238 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 239 | Ga0209233_1000080 | 3300025261 | Bacteria | 338459 |
| 240 | Ga0209233_1000092 | 3300025261 | Bacteria | 308668 |
| 241 | Ga0209233_1016480 | 3300025261 | Bacteria | 2035 |
| 242 | Ga0209233_1045019 | 3300025261 | Bacteria | 930 |
| 243 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 244 | Ga0209455_1000034 | 3300025272 | Bacteria | 483129 |
| 245 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 246 | Ga0209455_1017113 | 3300025272 | Bacteria | 1534 |
| 247 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 248 | Ga0209673_1018362 | 3300025273 | Bacteria | 2545 |
| 249 | Ga0209130_1009349 | 3300025284 | Bacteria | 2803 |
| 250 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 251 | Ga0209675_1011075 | 3300025291 | Bacteria | 3016 |
| 252 | Ga0209675_1017295 | 3300025291 | Bacteria | 2063 |
| 253 | Ga0209675_1028531 | 3300025291 | Bacteria | 1355 |
| 254 | Ga0209676_1000540 | 3300025292 | Bacteria | 58505 |
| 255 | Ga0209676_1011200 | 3300025292 | Bacteria | 3643 |
| 256 | Ga0209676_1012303 | 3300025292 | Bacteria | 3376 |
| 257 | Ga0209676_1013870 | 3300025292 | Bacteria | 3069 |
| 258 | Ga0209676_1019284 | 3300025292 | Bacteria | 2349 |
| 259 | Ga0209676_1085599 | 3300025292 | Bacteria | 706 |
| 260 | Ga0209025_1000884 | 3300025294 | Bacteria | 46917 |
| 261 | Ga0209025_1030854 | 3300025294 | Bacteria | 2553 |
| 262 | Ga0209025_1065705 | 3300025294 | Bacteria | 1323 |
| 263 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 264 | Ga0209564_1018435 | 3300025295 | Bacteria | 2659 |
| 265 | Ga0209564_1019857 | 3300025295 | Bacteria | 2489 |
| 266 | Ga0209758_1021433 | 3300025297 | Bacteria | 3012 |
| 267 | Ga0209758_1097097 | 3300025297 | Bacteria | 848 |
| 268 | Ga0209050_1001358 | 3300025298 | Bacteria | 26798 |
| 269 | Ga0209050_1018102 | 3300025298 | Bacteria | 2759 |
| 270 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 271 | Ga0209256_1003298 | 3300025299 | Bacteria | 11510 |
| 272 | Ga0209256_1004157 | 3300025299 | Bacteria | 9342 |
| 273 | Ga0209256_1007202 | 3300025299 | Bacteria | 5574 |
| 274 | Ga0209051_1012905 | 3300025303 | Bacteria | 4010 |
| 275 | Ga0209257_1000133 | 3300025304 | Bacteria | 208808 |
| 276 | Ga0209257_1000789 | 3300025304 | Bacteria | 46344 |
| 277 | Ga0209257_1013716 | 3300025304 | Bacteria | 3566 |
| 278 | Ga0209257_1014558 | 3300025304 | Bacteria | 3368 |
| 279 | Ga0209257_1023789 | 3300025304 | Bacteria | 2141 |
| 280 | Ga0209257_1080118 | 3300025304 | Bacteria | 840 |
| 281 | Ga0207647_10007462 | 3300025904 | Bacteria | 7899 |
| 282 | Ga0207705_10247456 | 3300025909 | Bacteria | 1359 |
| 283 | Ga0207695_10001580 | 3300025913 | Bacteria | 37116 |
| 284 | Ga0207695_10028459 | 3300025913 | Bacteria | 6196 |
| 285 | Ga0207695_10245998 | 3300025913 | Bacteria | 1688 |
| 286 | Ga0207671_10002240 | 3300025914 | Bacteria | 20934 |
| 287 | Ga0207671_10002742 | 3300025914 | Bacteria | 18408 |
| 288 | Ga0207671_10148435 | 3300025914 | Bacteria | 1810 |
| 289 | Ga0207671_11269905 | 3300025914 | Bacteria | 574 |
| 290 | Ga0207693_11079434 | 3300025915 | Bacteria | 610 |
| 291 | Ga0207660_10156376 | 3300025917 | Bacteria | 1755 |
| 292 | Ga0207660_10496311 | 3300025917 | Bacteria | 990 |
| 293 | Ga0207657_10030861 | 3300025919 | Bacteria | 4858 |
| 294 | Ga0207652_10121641 | 3300025921 | Bacteria | 2323 |
| 295 | Ga0207652_10441252 | 3300025921 | Bacteria | 1173 |
| 296 | Ga0207652_10540100 | 3300025921 | Bacteria | 1048 |
| 297 | Ga0207681_10004298 | 3300025923 | Bacteria | 8793 |
| 298 | Ga0207694_10012352 | 3300025924 | Bacteria | 6434 |
| 299 | Ga0207694_10041563 | 3300025924 | Bacteria | 3543 |
| 300 | Ga0207694_10067225 | 3300025924 | Bacteria | 2797 |
| 301 | Ga0207694_10500640 | 3300025924 | Bacteria | 1017 |
| 302 | Ga0207650_10268876 | 3300025925 | Bacteria | 1385 |
| 303 | Ga0207659_10154460 | 3300025926 | Bacteria | 1795 |
| 304 | Ga0207659_10400028 | 3300025926 | Bacteria | 1148 |
| 305 | Ga0207687_11118190 | 3300025927 | Bacteria | 677 |
| 306 | Ga0207687_11673743 | 3300025927 | Bacteria | 545 |
| 307 | Ga0207700_10000795 | 3300025928 | Bacteria | 18225 |
| 308 | Ga0207664_10043143 | 3300025929 | Bacteria | 3526 |
| 309 | Ga0207644_10115377 | 3300025931 | Bacteria | 2037 |
| 310 | Ga0207644_10674058 | 3300025931 | Bacteria | 861 |
| 311 | Ga0207690_11086392 | 3300025932 | Bacteria | 667 |
| 312 | Ga0207706_10155232 | 3300025933 | Bacteria | 2013 |
| 313 | Ga0207706_10203588 | 3300025933 | Bacteria | 1736 |
| 314 | Ga0207670_10040564 | 3300025936 | Bacteria | 3056 |
| 315 | Ga0207665_10645704 | 3300025939 | Bacteria | 829 |
| 316 | Ga0207691_10001528 | 3300025940 | Bacteria | 23015 |
| 317 | Ga0207691_10023348 | 3300025940 | Bacteria | 5822 |
| 318 | Ga0207691_10273987 | 3300025940 | Bacteria | 1453 |
| 319 | Ga0207691_10631423 | 3300025940 | Bacteria | 906 |
| 320 | Ga0207711_10036599 | 3300025941 | Bacteria | 4165 |
| 321 | Ga0207689_10080614 | 3300025942 | Bacteria | 2675 |
| 322 | Ga0207689_10201100 | 3300025942 | Bacteria | 1644 |
| 323 | Ga0207679_10088910 | 3300025945 | Bacteria | 2383 |
| 324 | Ga0207679_10120196 | 3300025945 | Bacteria | 2090 |
| 325 | Ga0207667_10015765 | 3300025949 | Bacteria | 8569 |
| 326 | Ga0207667_10349651 | 3300025949 | Bacteria | 1508 |
| 327 | Ga0207667_10424542 | 3300025949 | Bacteria | 1352 |
| 328 | Ga0207651_10262039 | 3300025960 | Bacteria | 1420 |
| 329 | Ga0207712_10008296 | 3300025961 | Bacteria | 6567 |
| 330 | Ga0207712_11488316 | 3300025961 | Bacteria | 606 |
| 331 | Ga0207668_10718966 | 3300025972 | Bacteria | 879 |
| 332 | Ga0207640_10788486 | 3300025981 | Bacteria | 822 |
| 333 | Ga0207658_10104913 | 3300025986 | Bacteria | 2222 |
| 334 | Ga0207677_10521302 | 3300026023 | Bacteria | 1031 |
| 335 | Ga0207639_10011760 | 3300026041 | Bacteria | 6088 |
| 336 | Ga0207639_10056707 | 3300026041 | Bacteria | 3003 |
| 337 | Ga0207639_10390987 | 3300026041 | Bacteria | 1251 |
| 338 | Ga0207678_10009769 | 3300026067 | Bacteria | 8438 |
| 339 | Ga0207678_10026991 | 3300026067 | Bacteria | 5008 |
| 340 | Ga0207678_10166714 | 3300026067 | Bacteria | 1881 |
| 341 | Ga0207702_10000438 | 3300026078 | Bacteria | 47495 |
| 342 | Ga0207641_10558595 | 3300026088 | Bacteria | 1117 |
| 343 | Ga0207641_10621727 | 3300026088 | Bacteria | 1059 |
| 344 | Ga0207648_10010388 | 3300026089 | Bacteria | 8826 |
| 345 | Ga0207648_10180222 | 3300026089 | Bacteria | 1870 |
| 346 | Ga0207648_10270806 | 3300026089 | Bacteria | 1517 |
| 347 | Ga0207676_10328956 | 3300026095 | Bacteria | 1406 |
| 348 | Ga0207676_10988183 | 3300026095 | Bacteria | 829 |
| 349 | Ga0207674_10208622 | 3300026116 | Bacteria | 1903 |
| 350 | Ga0207675_100234700 | 3300026118 | Bacteria | 1771 |
| 351 | Ga0207675_102437747 | 3300026118 | Bacteria | 535 |
| 352 | Ga0209973_1011588 | 3300027252 | Bacteria | 1060 |
| 353 | Ga0209969_1001294 | 3300027360 | Bacteria | 3442 |
| 354 | Ga0209967_1025959 | 3300027364 | Bacteria | 868 |
| 355 | Ga0209984_1003704 | 3300027424 | Bacteria | 1763 |
| 356 | Ga0210000_1026369 | 3300027462 | Bacteria | 901 |
| 357 | Ga0209968_1026076 | 3300027526 | Bacteria | 965 |
| 358 | Ga0209999_1007295 | 3300027543 | Bacteria | 1988 |
| 359 | Ga0209982_1001664 | 3300027552 | Bacteria | 3057 |
| 360 | Ga0209983_1000584 | 3300027665 | Bacteria | 7872 |
| 361 | Ga0209974_10000815 | 3300027876 | Bacteria | 10692 |
| 362 | Ga0209974_10037703 | 3300027876 | Bacteria | 1605 |
| 363 | Ga0268266_12019055 | 3300028379 | Bacteria | 550 |
| 364 | Ga0268265_10080583 | 3300028380 | Bacteria | 2568 |
| 365 | Ga0268265_10306665 | 3300028380 | Bacteria | 1432 |
| 366 | Ga0268264_10191216 | 3300028381 | Bacteria | 1866 |
| 367 | Ga0316183_1048983 | 3300030742 | Bacteria | 1143 |
| 368 | Ga0307408_100073637 | 3300031548 | Bacteria | 2532 |
| 369 | Ga0307408_100114033 | 3300031548 | Bacteria | 2081 |
| 370 | Ga0307408_100250893 | 3300031548 | Bacteria | 1459 |
| 371 | Ga0307408_100450388 | 3300031548 | Bacteria | 1116 |
| 372 | Ga0307408_100622905 | 3300031548 | Bacteria | 961 |
| 373 | Ga0307408_100851347 | 3300031548 | Bacteria | 831 |
| 374 | Ga0307408_100870325 | 3300031548 | Bacteria | 823 |
| 375 | Ga0307408_101196351 | 3300031548 | Bacteria | 709 |
| 376 | Ga0307408_101454013 | 3300031548 | Bacteria | 647 |
| 377 | Ga0307405_10056250 | 3300031731 | Bacteria | 2466 |
| 378 | Ga0307405_10287559 | 3300031731 | Bacteria | 1241 |
| 379 | Ga0307405_10586726 | 3300031731 | Bacteria | 907 |
| 380 | Ga0307405_10915269 | 3300031731 | Bacteria | 743 |
| 381 | Ga0307405_11832863 | 3300031731 | Bacteria | 540 |
| 382 | Ga0307413_10006235 | 3300031824 | Bacteria | 5415 |
| 383 | Ga0307413_10162073 | 3300031824 | Bacteria | 1572 |
| 384 | Ga0307413_10218818 | 3300031824 | Bacteria | 1389 |
| 385 | Ga0307413_10480378 | 3300031824 | Bacteria | 993 |
| 386 | Ga0307413_10480504 | 3300031824 | Bacteria | 993 |
| 387 | Ga0307413_10532066 | 3300031824 | Bacteria | 950 |
| 388 | Ga0307413_11242313 | 3300031824 | Bacteria | 649 |
| 389 | Ga0307410_10041682 | 3300031852 | Bacteria | 3028 |
| 390 | Ga0307410_10055302 | 3300031852 | Bacteria | 2694 |
| 391 | Ga0307410_10851731 | 3300031852 | Bacteria | 778 |
| 392 | Ga0307410_11367064 | 3300031852 | Bacteria | 621 |
| 393 | Ga0307406_10000838 | 3300031901 | Bacteria | 17266 |
| 394 | Ga0307406_11005784 | 3300031901 | Bacteria | 715 |
| 395 | Ga0307407_10620350 | 3300031903 | Bacteria | 807 |
| 396 | Ga0307412_10028574 | 3300031911 | Bacteria | 3490 |
| 397 | Ga0307412_10326529 | 3300031911 | Bacteria | 1223 |
| 398 | Ga0307412_11157103 | 3300031911 | Bacteria | 691 |
| 399 | Ga0307409_100633578 | 3300031995 | Bacteria | 1061 |
| 400 | Ga0307409_100862034 | 3300031995 | Bacteria | 917 |
| 401 | Ga0307416_101752396 | 3300032002 | Bacteria | 725 |
| 402 | Ga0307414_10001544 | 3300032004 | Bacteria | 11959 |
| 403 | Ga0307414_10023667 | 3300032004 | Bacteria | 3900 |
| 404 | Ga0307414_10033019 | 3300032004 | Bacteria | 3415 |
| 405 | Ga0307414_10049413 | 3300032004 | Bacteria | 2908 |
| 406 | Ga0307414_10109834 | 3300032004 | Bacteria | 2096 |
| 407 | Ga0307414_10121773 | 3300032004 | Bacteria | 2007 |
| 408 | Ga0307414_10124384 | 3300032004 | Bacteria | 1989 |
| 409 | Ga0307414_10135860 | 3300032004 | Bacteria | 1917 |
| 410 | Ga0307414_10183629 | 3300032004 | Bacteria | 1685 |
| 411 | Ga0307414_10231277 | 3300032004 | Bacteria | 1524 |
| 412 | Ga0307414_10244630 | 3300032004 | Bacteria | 1487 |
| 413 | Ga0307414_10302621 | 3300032004 | Bacteria | 1353 |
| 414 | Ga0307414_10443970 | 3300032004 | Bacteria | 1136 |
| 415 | Ga0307414_10883857 | 3300032004 | Bacteria | 818 |
| 416 | Ga0307411_10032321 | 3300032005 | Bacteria | 3231 |
| 417 | Ga0307411_10053667 | 3300032005 | Bacteria | 2642 |
| 418 | Ga0307411_10078395 | 3300032005 | Bacteria | 2265 |
| 419 | Ga0307411_10104647 | 3300032005 | Bacteria | 2010 |
| 420 | Ga0307411_10416301 | 3300032005 | Bacteria | 1115 |
| 421 | Ga0307411_10465419 | 3300032005 | Bacteria | 1061 |
| 422 | Ga0307411_10749412 | 3300032005 | Bacteria | 855 |
| 423 | Ga0307415_100198063 | 3300032126 | Bacteria | 1591 |
| 424 | Ga0307415_101022260 | 3300032126 | Bacteria | 769 |
| 425 | Ga0373936_0206284 | 3300035113 | Bacteria | 869 |
| 426 | Ga0395899_0000175 | 3300037312 | Bacteria | 95781 |
| 427 | Ga0395899_0010682 | 3300037312 | Bacteria | 7037 |
| 428 | Ga0395899_0020288 | 3300037312 | Bacteria | 5042 |
| 429 | Ga0395899_0046819 | 3300037312 | Bacteria | 3220 |
| 430 | Ga0395899_0106492 | 3300037312 | Bacteria | 2019 |
| 431 | Ga0395899_0309338 | 3300037312 | Bacteria | 1067 |
| 432 | Ga0395900_0000012 | 3300037418 | Bacteria | 401198 |
| 433 | Ga0395900_0001866 | 3300037418 | Bacteria | 23992 |
| 434 | Ga0395900_0060477 | 3300037418 | Bacteria | 3898 |
| 435 | Ga0395900_0090150 | 3300037418 | Bacteria | 3151 |
| 436 | Ga0395900_0095564 | 3300037418 | Bacteria | 3053 |
| 437 | Ga0395898_0000034 | 3300037466 | Bacteria | 356745 |
| 438 | Ga0395898_0005801 | 3300037466 | Bacteria | 13281 |
| 439 | Ga0395898_0085697 | 3300037466 | Bacteria | 3036 |
| 440 | Ga0395898_0091058 | 3300037466 | Bacteria | 2934 |
| 441 | Ga0395898_0232327 | 3300037466 | Bacteria | 1759 |
| 442 | Ga0395898_0965243 | 3300037466 | Bacteria | 789 |
| 443 | Ga0395905_0001903 | 3300037471 | Bacteria | 24042 |
| 444 | Ga0395905_0018529 | 3300037471 | Bacteria | 6607 |
| 445 | Ga0395905_0066951 | 3300037471 | Bacteria | 3364 |
| 446 | Ga0395905_0325484 | 3300037471 | Bacteria | 1427 |
| 447 | Ga0395901_0015436 | 3300038443 | Bacteria | 7778 |
| 448 | Ga0395901_0025292 | 3300038443 | Bacteria | 6094 |
| 449 | Ga0395901_0030232 | 3300038443 | Bacteria | 5581 |
| 450 | Ga0395901_0035285 | 3300038443 | Bacteria | 5166 |
| 451 | Ga0395901_0057799 | 3300038443 | Bacteria | 4034 |
| 452 | Ga0395901_0062194 | 3300038443 | Bacteria | 3885 |
| 453 | Ga0395901_0384181 | 3300038443 | Bacteria | 1445 |
| 454 | Ga0395901_0859096 | 3300038443 | Bacteria | 892 |
| 455 | Ga0395901_0889251 | 3300038443 | Bacteria | 873 |
| 456 | Ga0395901_1158621 | 3300038443 | Bacteria | 741 |
| 457 | Ga0237816_00654 | 3300039145 | Bacteria | 2924 |
| 458 | Ga0439436_0010415 | 3300041404 | Bacteria | 2836 |
| 459 | Ga0439436_0062084 | 3300041404 | Bacteria | 1045 |
| 460 | Ga0439447_007822 | 3300041407 | Bacteria | 3354 |
| 461 | Ga0439465_0007729 | 3300041413 | Bacteria | 3411 |
| 462 | Ga0451797_0106627 | 3300041453 | Bacteria | 830 |
| 463 | Ga0451797_1394323 | 3300041453 | Bacteria | 1203 |
| 464 | Ga0451837_0995902 | 3300041494 | Bacteria | 571 |
| 465 | Ga0451837_1008743 | 3300041494 | Bacteria | 868 |
| 466 | Ga0451837_1184456 | 3300041494 | Bacteria | 1718 |
| 467 | Ga0451837_1827009 | 3300041494 | Bacteria | 2005 |
| 468 | Ga0451843_0787379 | 3300041509 | Bacteria | 817 |
| 469 | Ga0451843_1729097 | 3300041509 | Bacteria | 1031 |
| 470 | Ga0451853_2956181 | 3300041512 | Bacteria | 1157 |
| 471 | Ga0439433_0034637 | 3300041999 | Bacteria | 1163 |
| 472 | Ga0439433_0061063 | 3300041999 | Bacteria | 899 |
| 473 | Ga0439437_000407 | 3300042000 | Bacteria | 4160 |
| 474 | Ga0439448_0077191 | 3300042005 | Bacteria | 1115 |
| 475 | Ga0439432_012921 | 3300042006 | Bacteria | 2843 |
| 476 | Ga0439432_044056 | 3300042006 | Bacteria | 1406 |
| 477 | Ga0439432_192006 | 3300042006 | Bacteria | 593 |
| 478 | Ga0439457_030795 | 3300042014 | Bacteria | 1190 |
| 479 | Ga0439462_0071525 | 3300042015 | Bacteria | 942 |
| 480 | Ga0466969_0011308 | 3300044656 | Bacteria | 4725 |
| 481 | Ga0466975_0103111 | 3300044661 | Bacteria | 2029 |
| 482 | Ga0466965_0000618 | 3300044683 | Bacteria | 12967 |
| 483 | Ga0466966_0008750 | 3300044684 | Bacteria | 6701 |
| 484 | Ga0466966_0617742 | 3300044684 | Bacteria | 653 |
| 485 | Ga0466961_0003439 | 3300044693 | Bacteria | 9873 |
| 486 | Ga0466961_0007714 | 3300044693 | Bacteria | 6851 |
| 487 | Ga0466961_0016522 | 3300044693 | Bacteria | 4741 |
| 488 | Ga0466963_0111863 | 3300044694 | Bacteria | 1875 |
| 489 | Ga0466963_0827751 | 3300044694 | Bacteria | 653 |
| 490 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 491 | Ga0466971_0039815 | 3300044719 | Bacteria | 2110 |
| 492 | Ga0466971_0048443 | 3300044719 | Bacteria | 1910 |
| 493 | Ga0466970_0008881 | 3300044765 | Bacteria | 5067 |
| 494 | Ga0466957_0006427 | 3300044842 | Bacteria | 6637 |
| 495 | Ga0466957_0007212 | 3300044842 | Bacteria | 6283 |
| 496 | Ga0466959_0000068 | 3300045049 | Bacteria | 73132 |
| 497 | Ga0466959_0004901 | 3300045049 | Bacteria | 9062 |
| 498 | Ga0466959_0014419 | 3300045049 | Bacteria | 5741 |
| 499 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 500 | Ga0466958_0020415 | 3300045836 | Bacteria | 3862 |
| 501 | Ga0466958_0392664 | 3300045836 | Bacteria | 895 |
| 502 | Ga0466967_0151829 | 3300045976 | Bacteria | 2166 |
| 503 | Ga0466967_0158947 | 3300045976 | Bacteria | 2120 |
| 504 | Ga0466967_0393216 | 3300045976 | Bacteria | 1348 |
| 505 | Ga0495638_0000777 | 3300046460 | Bacteria | 33705 |
| 506 | Ga0495638_0001254 | 3300046460 | Bacteria | 23874 |
| 507 | Ga0495638_0103243 | 3300046460 | Bacteria | 1702 |
| 508 | Ga0495650_0000585 | 3300046471 | Bacteria | 50650 |
| 509 | Ga0495580_0221350 | 3300046472 | Bacteria | 1301 |
| 510 | Ga0495662_0180376 | 3300046476 | Bacteria | 1041 |
| 511 | Ga0495606_0001787 | 3300046507 | Bacteria | 27393 |
| 512 | Ga0495663_0019883 | 3300046525 | Bacteria | 1925 |
| 513 | Ga0495663_0045408 | 3300046525 | Bacteria | 1347 |
| 514 | Ga0495665_0183146 | 3300046531 | Bacteria | 1088 |
| 515 | Ga0495598_0010004 | 3300046537 | Bacteria | 2259 |
| 516 | Ga0495621_0026389 | 3300046539 | Bacteria | 1959 |
| 517 | Ga0495621_0058286 | 3300046539 | Bacteria | 1396 |
| 518 | Ga0495621_0133998 | 3300046539 | Bacteria | 965 |
| 519 | Ga0495656_0002244 | 3300046615 | Bacteria | 6390 |
| 520 | Ga0495656_0003850 | 3300046615 | Bacteria | 5105 |
| 521 | Ga0495668_0016123 | 3300046616 | Bacteria | 4347 |
| 522 | Ga0495625_0048972 | 3300046660 | Bacteria | 3039 |
| 523 | Ga0495625_0113616 | 3300046660 | Bacteria | 1849 |
| 524 | Ga0495659_0017172 | 3300046664 | Bacteria | 2394 |
| 525 | Ga0495657_0147701 | 3300046675 | Bacteria | 1461 |
| 526 | Ga0495670_0066868 | 3300046691 | Bacteria | 1814 |
| 527 | Ga0495670_0157942 | 3300046691 | Bacteria | 1191 |
| 528 | Ga0495649_0212679 | 3300046694 | Bacteria | 1001 |
| 529 | Ga0495636_0003450 | 3300047318 | Bacteria | 6134 |
| 530 | Ga0495636_0008301 | 3300047318 | Bacteria | 4100 |
| 531 | Ga0495636_0039930 | 3300047318 | Bacteria | 1944 |
| 532 | Ga0495636_0180588 | 3300047318 | Bacteria | 957 |
| 533 | Ga0496101_0184440 | 3300048904 | Bacteria | 1608 |
| 534 | Ga0496102_0130233 | 3300048905 | Bacteria | 2354 |
| 535 | Ga0496103_0244812 | 3300048906 | Bacteria | 1154 |
| 536 | Ga0496104_0114648 | 3300048907 | Bacteria | 2585 |
| 537 | Ga0496106_0093946 | 3300048909 | Bacteria | 2318 |
| 538 | Ga0496107_0026716 | 3300048910 | Bacteria | 4095 |
| 539 | Ga0496108_0124856 | 3300048911 | Bacteria | 2209 |
| 540 | Ga0496108_0292930 | 3300048911 | Bacteria | 1417 |
| 541 | Ga0496109_0173044 | 3300048912 | Bacteria | 2026 |
| 542 | Ga0496109_0248805 | 3300048912 | Bacteria | 1674 |
| 543 | Ga0496109_0287764 | 3300048912 | Bacteria | 1549 |
| 544 | Ga0496109_0344459 | 3300048912 | Bacteria | 1407 |
| 545 | Ga0496109_1520390 | 3300048912 | Bacteria | 604 |
| 546 | Ga0496110_0490866 | 3300048913 | Bacteria | 1118 |
| 547 | Ga0496111_0034807 | 3300048914 | Bacteria | 3597 |
| 548 | Ga0496112_0053094 | 3300048915 | Bacteria | 3979 |
| 549 | Ga0496112_0560021 | 3300048915 | Bacteria | 1077 |
| 550 | Ga0496113_0047904 | 3300048916 | Bacteria | 3178 |
| 551 | Ga0496113_0107861 | 3300048916 | Bacteria | 2164 |
| 552 | Ga0496113_0264778 | 3300048916 | Bacteria | 1373 |
| 553 | Ga0496114_0084162 | 3300048917 | Bacteria | 2693 |
| 554 | Ga0496114_0243016 | 3300048917 | Bacteria | 1583 |
| 555 | Ga0496114_0816454 | 3300048917 | Bacteria | 812 |
| 556 | Ga0496115_0000025 | 3300048918 | Bacteria | 151658 |
| 557 | Ga0496116_0067346 | 3300048919 | Bacteria | 2287 |
| 558 | Ga0496121_0013431 | 3300048924 | Bacteria | 8797 |
| 559 | Ga0496124_0068670 | 3300048927 | Bacteria | 2945 |
| 560 | Ga0496126_0050642 | 3300048929 | Bacteria | 3783 |
| 561 | Ga0496126_0378088 | 3300048929 | Bacteria | 1153 |
| 562 | Ga0495678_077392 | 3300049459 | Bacteria | 1203 |
| 563 | Ga0501300_002974 | 3300049523 | Bacteria | 2530 |
| 564 | Ga0501315_057022 | 3300049531 | Bacteria | 625 |
| 565 | Ga0501031_0051651 | 3300049568 | Bacteria | 2678 |
| 566 | Ga0501031_0115683 | 3300049568 | Bacteria | 1752 |
| 567 | Ga0501031_0367826 | 3300049568 | Bacteria | 930 |
| 568 | Ga0501032_0020338 | 3300049569 | Bacteria | 4624 |
| 569 | Ga0501032_0043565 | 3300049569 | Bacteria | 3038 |
| 570 | Ga0501032_0055322 | 3300049569 | Bacteria | 2669 |
| 571 | Ga0501033_0002653 | 3300049570 | Bacteria | 15039 |
| 572 | Ga0501033_0003817 | 3300049570 | Bacteria | 12258 |
| 573 | Ga0501033_0006298 | 3300049570 | Bacteria | 9302 |
| 574 | Ga0501033_0010579 | 3300049570 | Bacteria | 7073 |
| 575 | Ga0501033_0201162 | 3300049570 | Bacteria | 1423 |
| 576 | Ga0501034_0000316 | 3300049571 | Bacteria | 85497 |
| 577 | Ga0501034_0006586 | 3300049571 | Bacteria | 12463 |
| 578 | Ga0501034_0034699 | 3300049571 | Bacteria | 5115 |
| 579 | Ga0501034_0168938 | 3300049571 | Bacteria | 2155 |
| 580 | Ga0501034_0612272 | 3300049571 | Bacteria | 994 |
| 581 | Ga0501036_0124359 | 3300049572 | Bacteria | 2178 |
| 582 | Ga0501037_0012036 | 3300049573 | Bacteria | 6371 |
| 583 | Ga0501037_0033754 | 3300049573 | Bacteria | 3778 |
| 584 | Ga0501037_0619400 | 3300049573 | Bacteria | 725 |
| 585 | Ga0501037_0638977 | 3300049573 | Bacteria | 712 |
| 586 | Ga0501038_0016339 | 3300049574 | Bacteria | 6728 |
| 587 | Ga0501038_0017969 | 3300049574 | Bacteria | 6387 |
| 588 | Ga0501038_0025770 | 3300049574 | Bacteria | 5239 |
| 589 | Ga0501039_0301346 | 3300049575 | Bacteria | 1260 |
| 590 | Ga0501043_0019326 | 3300049579 | Bacteria | 5348 |
| 591 | Ga0501043_0047547 | 3300049579 | Bacteria | 3373 |
| 592 | Ga0501043_0067412 | 3300049579 | Bacteria | 2810 |
| 593 | Ga0501043_0438180 | 3300049579 | Bacteria | 983 |
| 594 | Ga0501046_0033119 | 3300049580 | Bacteria | 4178 |
| 595 | Ga0501046_0573545 | 3300049580 | Bacteria | 802 |
| 596 | Ga0501046_1032974 | 3300049580 | Bacteria | 570 |
| 597 | Ga0501047_0010880 | 3300049581 | Bacteria | 8602 |
| 598 | Ga0501047_0015109 | 3300049581 | Bacteria | 7350 |
| 599 | Ga0501047_0079026 | 3300049581 | Bacteria | 3163 |
| 600 | Ga0501047_0203150 | 3300049581 | Bacteria | 1842 |
| 601 | Ga0501048_0031705 | 3300049582 | Bacteria | 3822 |
| 602 | Ga0501070_0008880 | 3300049586 | Bacteria | 8495 |
| 603 | Ga0501070_0387426 | 3300049586 | Bacteria | 1132 |
| 604 | Ga0501071_0235342 | 3300049587 | Bacteria | 1380 |
| 605 | Ga0501073_0055773 | 3300049589 | Bacteria | 2764 |
| 606 | Ga0501074_0190666 | 3300049590 | Bacteria | 1462 |
| 607 | Ga0501077_0133414 | 3300049593 | Bacteria | 1575 |
| 608 | Ga0501202_011902 | 3300049652 | Bacteria | 1635 |
| 609 | Ga0501207_105852 | 3300049654 | Bacteria | 570 |
| 610 | Ga0501216_005920 | 3300049660 | Bacteria | 1859 |
| 611 | Ga0501217_044793 | 3300049661 | Bacteria | 1138 |
| 612 | Ga0501223_058177 | 3300049663 | Bacteria | 753 |
| 613 | Ga0501227_089745 | 3300049665 | Bacteria | 811 |
| 614 | Ga0501250_017217 | 3300049680 | Bacteria | 905 |
| 615 | Ga0501251_033642 | 3300049681 | Bacteria | 744 |
| 616 | Ga0501225_0172189 | 3300049705 | Bacteria | 672 |
| 617 | Ga0501245_028707 | 3300049708 | Bacteria | 909 |
| 618 | Ga0501080_0004656 | 3300049742 | Bacteria | 12233 |
| 619 | Ga0501241_086307 | 3300049758 | Bacteria | 659 |
| 620 | Ga0501265_000627 | 3300049762 | Bacteria | 3817 |
| 621 | Ga0501266_002927 | 3300049763 | Bacteria | 2131 |
| 622 | Ga0501268_006804 | 3300049765 | Bacteria | 1690 |
| 623 | Ga0501272_040209 | 3300049769 | Bacteria | 622 |
| 624 | Ga0501275_000601 | 3300049772 | Bacteria | 3962 |
| 625 | Ga0501275_064389 | 3300049772 | Bacteria | 565 |
| 626 | Ga0501035_0016076 | 3300049822 | Bacteria | 6905 |
| 627 | Ga0501035_0051346 | 3300049822 | Bacteria | 3692 |
| 628 | Ga0501035_0150557 | 3300049822 | Bacteria | 2019 |
| 629 | Ga0501035_0199183 | 3300049822 | Bacteria | 1718 |
| 630 | Ga0501035_0675937 | 3300049822 | Bacteria | 835 |
| 631 | Ga0501044_0010948 | 3300049823 | Bacteria | 9845 |
| 632 | Ga0501044_0013956 | 3300049823 | Bacteria | 8680 |
| 633 | Ga0501044_0043955 | 3300049823 | Bacteria | 4639 |
| 634 | Ga0501044_0126540 | 3300049823 | Bacteria | 2552 |
| 635 | Ga0501044_0714542 | 3300049823 | Bacteria | 886 |
| 636 | Ga0501044_0862009 | 3300049823 | Bacteria | 782 |
| 637 | nmdc:mga00v17_209482_c1 | 3300050491 | Bacteria | 1261 |
| 638 | nmdc:mga00v17_57252_c1 | 3300050491 | Bacteria | 2385 |
| 639 | Ga0466962_0001366 | 3300061719 | Bacteria | 11299 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100410383 | Ga0070670_1004103831 | 119 |
| 2 | 3300005335 | Ga0070666_11254084 | Ga0070666_112540841 | 119 |
| 3 | 3300005439 | Ga0070711_100381287 | Ga0070711_1003812871 | 119 |
| 4 | 3300005539 | Ga0068853_100230007 | Ga0068853_1002300072 | 119 |
| 5 | 3300005548 | Ga0070665_100785140 | Ga0070665_1007851402 | 119 |
| 6 | 3300009174 | Ga0105241_10021514 | Ga0105241_100215143 | 119 |
| 7 | 3300009545 | Ga0105237_10027613 | Ga0105237_100276132 | 119 |
| 8 | 3300009553 | Ga0105249_10017724 | Ga0105249_100177245 | 119 |
| 9 | 3300010375 | Ga0105239_10026463 | Ga0105239_100264635 | 119 |
| 10 | 3300013105 | Ga0157369_10000025 | Ga0157369_10000025195 | 119 |
| 11 | 3300022467 | Ga0224712_10306231 | Ga0224712_103062311 | 119 |
| 12 | 3300025913 | Ga0207695_10001580 | Ga0207695_1000158024 | 119 |
| 13 | 3300025914 | Ga0207671_10002240 | Ga0207671_100022405 | 119 |
| 14 | 3300025924 | Ga0207694_10012352 | Ga0207694_100123522 | 119 |
| 15 | 3300025932 | Ga0207690_11086392 | Ga0207690_110863922 | 119 |
| 16 | 3300025949 | Ga0207667_10349651 | Ga0207667_103496512 | 119 |
| 17 | 3300025961 | Ga0207712_10008296 | Ga0207712_100082965 | 119 |
| 18 | 3300026041 | Ga0207639_10390987 | Ga0207639_103909872 | 119 |
| 19 | 3300028379 | Ga0268266_12019055 | Ga0268266_120190552 | 119 |
| 20 | iso_pu_bacteria | 2537561836 | 2538833047 | 119 |
| 21 | iso_pu_bacteria | 2643221562 | 2643830909 | 119 |
| 22 | 3300003763 | Ga0055529_1006460 | Ga0055529_10064601 | 120 |
| 23 | 3300005337 | Ga0070682_100023162 | Ga0070682_1000231622 | 120 |
| 24 | 3300005455 | Ga0070663_100008950 | Ga0070663_1000089503 | 120 |
| 25 | 3300005578 | Ga0068854_100092621 | Ga0068854_1000926212 | 120 |
| 26 | 3300009093 | Ga0105240_10054282 | Ga0105240_100542822 | 120 |
| 27 | 3300009148 | Ga0105243_12480019 | Ga0105243_124800192 | 120 |
| 28 | 3300013104 | Ga0157370_10004895 | Ga0157370_1000489513 | 120 |
| 29 | 3300049570 | Ga0501033_0003817 | Ga0501033_0003817_8685_9089 | 120 |
| 30 | 3300005614 | Ga0068856_100000012 | Ga0068856_10000001272 | 121 |
| 31 | 3300013105 | Ga0157369_10039026 | Ga0157369_100390262 | 121 |
| 32 | 3300020075 | Ga0206349_1350869 | Ga0206349_13508692 | 121 |
| 33 | 3300020080 | Ga0206350_10084533 | Ga0206350_100845332 | 121 |
| 34 | 3300020081 | Ga0206354_10481788 | Ga0206354_104817881 | 121 |
| 35 | 3300020610 | Ga0154015_1261614 | Ga0154015_12616142 | 121 |
| 36 | 3300022467 | Ga0224712_10255302 | Ga0224712_102553021 | 121 |
| 37 | 3300025913 | Ga0207695_10245998 | Ga0207695_102459983 | 121 |
| 38 | 3300025981 | Ga0207640_10788486 | Ga0207640_107884861 | 121 |
| 39 | 3300026067 | Ga0207678_10009769 | Ga0207678_100097697 | 121 |
| 40 | 3300026078 | Ga0207702_10000438 | Ga0207702_1000043813 | 121 |
| 41 | 3300031901 | Ga0307406_10000838 | Ga0307406_100008387 | 122 |
| 42 | 3300003316 | rootH1_10005492 | rootH1_100054922 | 123 |
| 43 | 3300005262 | Ga0065165_1001244 | Ga0065165_100124427 | 123 |
| 44 | 3300005337 | Ga0070682_100003250 | Ga0070682_1000032507 | 123 |
| 45 | 3300005366 | Ga0070659_100150360 | Ga0070659_1001503603 | 123 |
| 46 | 3300005437 | Ga0070710_10007695 | Ga0070710_100076955 | 123 |
| 47 | 3300005539 | Ga0068853_100050055 | Ga0068853_1000500554 | 123 |
| 48 | 3300005563 | Ga0068855_100368953 | Ga0068855_1003689532 | 123 |
| 49 | 3300009551 | Ga0105238_10025547 | Ga0105238_100255472 | 123 |
| 50 | 3300012510 | Ga0157316_1000058 | Ga0157316_10000582 | 123 |
| 51 | 3300013100 | Ga0157373_10114864 | Ga0157373_101148642 | 123 |
| 52 | 3300013102 | Ga0157371_10007365 | Ga0157371_100073657 | 123 |
| 53 | 3300013307 | Ga0157372_10004340 | Ga0157372_100043407 | 123 |
| 54 | 3300025924 | Ga0207694_10041563 | Ga0207694_100415634 | 123 |
| 55 | 3300025940 | Ga0207691_10631423 | Ga0207691_106314232 | 123 |
| 56 | 3300025949 | Ga0207667_10015765 | Ga0207667_100157657 | 123 |
| 57 | 3300026041 | Ga0207639_10011760 | Ga0207639_100117602 | 123 |
| 58 | 3300042000 | Ga0439437_000407 | Ga0439437_000407_2179_2556 | 123 |
| 59 | 3300042005 | Ga0439448_0077191 | Ga0439448_0077191_98_475 | 123 |
| 60 | 3300044712 | Ga0453684_0000136 | Ga0453684_0000136_106999_107376 | 123 |
| 61 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_320515_320892 | 123 |
| 62 | 3300049571 | Ga0501034_0006586 | Ga0501034_0006586_1748_2125 | 123 |
| 63 | 3300049572 | Ga0501036_0124359 | Ga0501036_0124359_838_1215 | 123 |
| 64 | 3300049573 | Ga0501037_0012036 | Ga0501037_0012036_4546_4923 | 123 |
| 65 | 3300049593 | Ga0501077_0133414 | Ga0501077_0133414_484_861 | 123 |
| 66 | 3300049822 | Ga0501035_0199183 | Ga0501035_0199183_731_1108 | 123 |
| 67 | 3300049823 | Ga0501044_0013956 | Ga0501044_0013956_494_871 | 123 |
| 68 | iso_pu_bacteria | 2687453130 | 2687583379 | 123 |
| 69 | 3300002737 | JGI25162J39368_1001962 | JGI25162J39368_100196211 | 124 |
| 70 | 3300002737 | JGI25162J39368_1002285 | JGI25162J39368_10022853 | 124 |
| 71 | 3300002741 | JGI25157J39369_1001483 | JGI25157J39369_10014836 | 124 |
| 72 | 3300002772 | JGI25164J39214_1000964 | JGI25164J39214_10009642 | 124 |
| 73 | 3300003214 | JGI25165J46597_1001786 | JGI25165J46597_10017862 | 124 |
| 74 | 3300005364 | Ga0070673_100137023 | Ga0070673_1001370232 | 124 |
| 75 | 3300005435 | Ga0070714_100056167 | Ga0070714_1000561673 | 124 |
| 76 | 3300005436 | Ga0070713_100002503 | Ga0070713_1000025038 | 124 |
| 77 | 3300005578 | Ga0068854_100203445 | Ga0068854_1002034452 | 124 |
| 78 | 3300005841 | Ga0068863_100894665 | Ga0068863_1008946651 | 124 |
| 79 | 3300009551 | Ga0105238_10178881 | Ga0105238_101788813 | 124 |
| 80 | 3300009551 | Ga0105238_10391525 | Ga0105238_103915251 | 124 |
| 81 | 3300013104 | Ga0157370_10005264 | Ga0157370_100052648 | 124 |
| 82 | 3300014497 | Ga0182008_10036844 | Ga0182008_100368442 | 124 |
| 83 | 3300015262 | Ga0182007_10005671 | Ga0182007_100056716 | 124 |
| 84 | 3300025231 | Ga0207427_100312 | Ga0207427_10031237 | 124 |
| 85 | 3300025233 | Ga0209437_100154 | Ga0209437_10015436 | 124 |
| 86 | 3300025250 | Ga0209026_1000405 | Ga0209026_100040510 | 124 |
| 87 | 3300025261 | Ga0209233_1000092 | Ga0209233_1000092253 | 124 |
| 88 | 3300025297 | Ga0209758_1097097 | Ga0209758_10970972 | 124 |
| 89 | 3300025915 | Ga0207693_11079434 | Ga0207693_110794342 | 124 |
| 90 | 3300025924 | Ga0207694_10500640 | Ga0207694_105006402 | 124 |
| 91 | 3300025927 | Ga0207687_11118190 | Ga0207687_111181901 | 124 |
| 92 | 3300025928 | Ga0207700_10000795 | Ga0207700_100007953 | 124 |
| 93 | 3300025929 | Ga0207664_10043143 | Ga0207664_100431433 | 124 |
| 94 | 3300025931 | Ga0207644_10674058 | Ga0207644_106740582 | 124 |
| 95 | 3300026023 | Ga0207677_10521302 | Ga0207677_105213022 | 124 |
| 96 | 3300026067 | Ga0207678_10166714 | Ga0207678_101667142 | 124 |
| 97 | 3300026088 | Ga0207641_10621727 | Ga0207641_106217272 | 124 |
| 98 | 3300026116 | Ga0207674_10208622 | Ga0207674_102086223 | 124 |
| 99 | 3300041404 | Ga0439436_0062084 | Ga0439436_0062084_590_1027 | 124 |
| 100 | 3300041999 | Ga0439433_0034637 | Ga0439433_0034637_135_572 | 124 |
| 101 | 3300042006 | Ga0439432_192006 | Ga0439432_192006_68_505 | 124 |
| 102 | 3300048912 | Ga0496109_0344459 | Ga0496109_0344459_334_753 | 124 |
| 103 | 3300048915 | Ga0496112_0560021 | Ga0496112_0560021_214_633 | 124 |
| 104 | 3300048916 | Ga0496113_0107861 | Ga0496113_0107861_1034_1453 | 124 |
| 105 | 3300048927 | Ga0496124_0068670 | Ga0496124_0068670_2478_2897 | 124 |
| 106 | iso_pu_bacteria | 2643221559 | 2643818653 | 124 |
| 107 | iso_pu_bacteria | 2643221573 | 2643878304 | 124 |
| 108 | iso_pu_bacteria | 2643221586 | 2643940898 | 124 |
| 109 | iso_pu_bacteria | 2643221612 | 2644080056 | 124 |
| 110 | iso_pu_bacteria | 2643221720 | 2644659609 | 124 |
| 111 | iso_pu_bacteria | 2643221727 | 2644695652 | 124 |
| 112 | iso_pu_bacteria | 2643221728 | 2644700642 | 124 |
| 113 | iso_pu_bacteria | 8002869464 | 8002871743 | 124 |
| 114 | 3300005336 | Ga0070680_100462949 | Ga0070680_1004629491 | 125 |
| 115 | 3300005455 | Ga0070663_100467095 | Ga0070663_1004670952 | 125 |
| 116 | 3300005458 | Ga0070681_10007152 | Ga0070681_100071527 | 125 |
| 117 | 3300005530 | Ga0070679_100023990 | Ga0070679_1000239906 | 125 |
| 118 | 3300005546 | Ga0070696_100004581 | Ga0070696_1000045812 | 125 |
| 119 | 3300005563 | Ga0068855_100101644 | Ga0068855_1001016443 | 125 |
| 120 | 3300009545 | Ga0105237_10000571 | Ga0105237_100005712 | 125 |
| 121 | 3300025909 | Ga0207705_10247456 | Ga0207705_102474562 | 125 |
| 122 | 3300025914 | Ga0207671_10002742 | Ga0207671_1000274215 | 125 |
| 123 | 3300025917 | Ga0207660_10156376 | Ga0207660_101563762 | 125 |
| 124 | 3300025921 | Ga0207652_10121641 | Ga0207652_101216412 | 125 |
| 125 | 3300037471 | Ga0395905_0018529 | Ga0395905_0018529_3619_4005 | 125 |
| 126 | 3300038443 | Ga0395901_1158621 | Ga0395901_1158621_90_482 | 125 |
| 127 | 3300049568 | Ga0501031_0115683 | Ga0501031_0115683_278_664 | 125 |
| 128 | 3300049569 | Ga0501032_0020338 | Ga0501032_0020338_1698_2084 | 125 |
| 129 | 3300049570 | Ga0501033_0201162 | Ga0501033_0201162_722_1108 | 125 |
| 130 | 3300049571 | Ga0501034_0168938 | Ga0501034_0168938_970_1356 | 125 |
| 131 | 3300049579 | Ga0501043_0047547 | Ga0501043_0047547_2087_2473 | 125 |
| 132 | 3300049580 | Ga0501046_0033119 | Ga0501046_0033119_1409_1795 | 125 |
| 133 | 3300049822 | Ga0501035_0675937 | Ga0501035_0675937_82_468 | 125 |
| 134 | iso_pu_bacteria | 2571042365 | 2572255332 | 125 |
| 135 | iso_pu_bacteria | 2643221695 | 2644529864 | 125 |
| 136 | iso_pu_bacteria | 2919513703 | 2919516700 | 125 |
| 137 | iso_pu_bacteria | 2919675420 | 2919677166 | 125 |
| 138 | iso_pu_bacteria | 8003014200 | 8003016381 | 125 |
| 139 | 3300005355 | Ga0070671_100300204 | Ga0070671_1003002042 | 126 |
| 140 | 3300009177 | Ga0105248_10226144 | Ga0105248_102261442 | 126 |
| 141 | 3300009545 | Ga0105237_11198154 | Ga0105237_111981542 | 126 |
| 142 | 3300027252 | Ga0209973_1011588 | Ga0209973_10115883 | 126 |
| 143 | 3300027360 | Ga0209969_1001294 | Ga0209969_10012943 | 126 |
| 144 | 3300027364 | Ga0209967_1025959 | Ga0209967_10259593 | 126 |
| 145 | 3300027424 | Ga0209984_1003704 | Ga0209984_10037042 | 126 |
| 146 | 3300027462 | Ga0210000_1026369 | Ga0210000_10263693 | 126 |
| 147 | 3300027526 | Ga0209968_1026076 | Ga0209968_10260762 | 126 |
| 148 | 3300027543 | Ga0209999_1007295 | Ga0209999_10072953 | 126 |
| 149 | 3300027552 | Ga0209982_1001664 | Ga0209982_10016648 | 126 |
| 150 | 3300027665 | Ga0209983_1000584 | Ga0209983_100058410 | 126 |
| 151 | 3300027876 | Ga0209974_10000815 | Ga0209974_100008159 | 126 |
| 152 | 3300031548 | Ga0307408_100870325 | Ga0307408_1008703251 | 126 |
| 153 | 3300037312 | Ga0395899_0309338 | Ga0395899_0309338_269_655 | 126 |
| 154 | 3300037418 | Ga0395900_0060477 | Ga0395900_0060477_2279_2665 | 126 |
| 155 | 3300037466 | Ga0395898_0965243 | Ga0395898_0965243_99_485 | 126 |
| 156 | 3300037471 | Ga0395905_0001903 | Ga0395905_0001903_14346_14732 | 126 |
| 157 | 3300038443 | Ga0395901_0015436 | Ga0395901_0015436_1444_1830 | 126 |
| 158 | 3300038443 | Ga0395901_0859096 | Ga0395901_0859096_29_415 | 126 |
| 159 | 3300048911 | Ga0496108_0124856 | Ga0496108_0124856_166_552 | 126 |
| 160 | 3300048912 | Ga0496109_0173044 | Ga0496109_0173044_1121_1507 | 126 |
| 161 | 3300048915 | Ga0496112_0053094 | Ga0496112_0053094_3555_3941 | 126 |
| 162 | 3300048916 | Ga0496113_0264778 | Ga0496113_0264778_756_1142 | 126 |
| 163 | 3300049571 | Ga0501034_0034699 | Ga0501034_0034699_1163_1546 | 126 |
| 164 | 3300049580 | Ga0501046_1032974 | Ga0501046_1032974_128_511 | 126 |
| 165 | 3300049581 | Ga0501047_0203150 | Ga0501047_0203150_823_1206 | 126 |
| 166 | iso_pu_bacteria | 2894414249 | 2894416421 | 126 |
| 167 | 3300002705 | JGI25156J39149_1004997 | JGI25156J39149_10049972 | 127 |
| 168 | 3300002705 | JGI25156J39149_1045019 | JGI25156J39149_10450191 | 127 |
| 169 | 3300002737 | JGI25162J39368_1002410 | JGI25162J39368_10024108 | 127 |
| 170 | 3300002741 | JGI25157J39369_1001104 | JGI25157J39369_100110411 | 127 |
| 171 | 3300002741 | JGI25157J39369_1002835 | JGI25157J39369_10028352 | 127 |
| 172 | 3300002772 | JGI25164J39214_1000035 | JGI25164J39214_100003553 | 127 |
| 173 | 3300003214 | JGI25165J46597_1000226 | JGI25165J46597_100022642 | 127 |
| 174 | 3300003760 | Ga0055527_1003185 | Ga0055527_10031852 | 127 |
| 175 | 3300003761 | Ga0055535_1000810 | Ga0055535_10008109 | 127 |
| 176 | 3300003762 | Ga0055542_1000522 | Ga0055542_100052225 | 127 |
| 177 | 3300003763 | Ga0055529_1000367 | Ga0055529_100036730 | 127 |
| 178 | 3300005618 | Ga0068864_100073009 | Ga0068864_1000730092 | 127 |
| 179 | 3300005844 | Ga0068862_100877032 | Ga0068862_1008770322 | 127 |
| 180 | 3300012500 | Ga0157314_1003366 | Ga0157314_10033662 | 127 |
| 181 | 3300014326 | Ga0157380_10847239 | Ga0157380_108472392 | 127 |
| 182 | 3300025228 | Ga0209672_100058 | Ga0209672_100058179 | 127 |
| 183 | 3300025231 | Ga0207427_100033 | Ga0207427_100033101 | 127 |
| 184 | 3300025233 | Ga0209437_100493 | Ga0209437_1004932 | 127 |
| 185 | 3300025242 | Ga0209258_100095 | Ga0209258_10009543 | 127 |
| 186 | 3300025246 | Ga0209646_1001694 | Ga0209646_10016946 | 127 |
| 187 | 3300025250 | Ga0209026_1000140 | Ga0209026_10001404 | 127 |
| 188 | 3300025250 | Ga0209026_1004720 | Ga0209026_10047202 | 127 |
| 189 | 3300025254 | Ga0209148_1000039 | Ga0209148_1000039255 | 127 |
| 190 | 3300025256 | Ga0209759_1000338 | Ga0209759_10003383 | 127 |
| 191 | 3300025256 | Ga0209759_1001070 | Ga0209759_10010704 | 127 |
| 192 | 3300025261 | Ga0209233_1000080 | Ga0209233_1000080101 | 127 |
| 193 | 3300025272 | Ga0209455_1000034 | Ga0209455_1000034256 | 127 |
| 194 | 3300025939 | Ga0207665_10645704 | Ga0207665_106457042 | 127 |
| 195 | 3300026095 | Ga0207676_10328956 | Ga0207676_103289562 | 127 |
| 196 | 3300031548 | Ga0307408_100114033 | Ga0307408_1001140332 | 127 |
| 197 | 3300031548 | Ga0307408_101196351 | Ga0307408_1011963512 | 127 |
| 198 | 3300031731 | Ga0307405_10056250 | Ga0307405_100562503 | 127 |
| 199 | 3300031824 | Ga0307413_10006235 | Ga0307413_100062354 | 127 |
| 200 | 3300031824 | Ga0307413_10480378 | Ga0307413_104803782 | 127 |
| 201 | 3300031852 | Ga0307410_10041682 | Ga0307410_100416826 | 127 |
| 202 | 3300032004 | Ga0307414_10124384 | Ga0307414_101243842 | 127 |
| 203 | 3300032005 | Ga0307411_10053667 | Ga0307411_100536673 | 127 |
| 204 | 3300032005 | Ga0307411_10465419 | Ga0307411_104654191 | 127 |
| 205 | 3300032126 | Ga0307415_100198063 | Ga0307415_1001980632 | 127 |
| 206 | 3300041453 | Ga0451797_0106627 | Ga0451797_0106627_79_471 | 127 |
| 207 | 3300041509 | Ga0451843_0787379 | Ga0451843_0787379_337_729 | 127 |
| 208 | 3300041509 | Ga0451843_1729097 | Ga0451843_1729097_63_449 | 127 |
| 209 | 3300048904 | Ga0496101_0184440 | Ga0496101_0184440_473_889 | 127 |
| 210 | 3300048906 | Ga0496103_0244812 | Ga0496103_0244812_500_919 | 127 |
| 211 | 3300048910 | Ga0496107_0026716 | Ga0496107_0026716_2272_2691 | 127 |
| 212 | 3300048912 | Ga0496109_0248805 | Ga0496109_0248805_253_642 | 127 |
| 213 | 3300048913 | Ga0496110_0490866 | Ga0496110_0490866_527_946 | 127 |
| 214 | 3300048914 | Ga0496111_0034807 | Ga0496111_0034807_177_593 | 127 |
| 215 | 3300048917 | Ga0496114_0243016 | Ga0496114_0243016_172_591 | 127 |
| 216 | 3300049568 | Ga0501031_0051651 | Ga0501031_0051651_2280_2666 | 127 |
| 217 | 3300049570 | Ga0501033_0002653 | Ga0501033_0002653_5152_5538 | 127 |
| 218 | 3300049660 | Ga0501216_005920 | Ga0501216_005920_956_1348 | 127 |
| 219 | 3300049680 | Ga0501250_017217 | Ga0501250_017217_397_789 | 127 |
| 220 | 3300049708 | Ga0501245_028707 | Ga0501245_028707_40_432 | 127 |
| 221 | 3300049763 | Ga0501266_002927 | Ga0501266_002927_926_1318 | 127 |
| 222 | 3300049769 | Ga0501272_040209 | Ga0501272_040209_15_407 | 127 |
| 223 | iso_pu_bacteria | 2941489479 | 2941493381 | 127 |
| 224 | iso_pu_bacteria | 2995948881 | 2995952521 | 127 |
| 225 | 3300003761 | Ga0055535_1000642 | Ga0055535_100064218 | 128 |
| 226 | 3300003762 | Ga0055542_1000442 | Ga0055542_100044226 | 128 |
| 227 | 3300005289 | Ga0065704_10465274 | Ga0065704_104652742 | 128 |
| 228 | 3300005339 | Ga0070660_100873260 | Ga0070660_1008732602 | 128 |
| 229 | 3300005343 | Ga0070687_100669774 | Ga0070687_1006697742 | 128 |
| 230 | 3300005355 | Ga0070671_100170561 | Ga0070671_1001705612 | 128 |
| 231 | 3300005364 | Ga0070673_100186066 | Ga0070673_1001860663 | 128 |
| 232 | 3300005457 | Ga0070662_100153509 | Ga0070662_1001535093 | 128 |
| 233 | 3300005459 | Ga0068867_100152093 | Ga0068867_1001520932 | 128 |
| 234 | 3300005543 | Ga0070672_100283428 | Ga0070672_1002834282 | 128 |
| 235 | 3300005844 | Ga0068862_100037406 | Ga0068862_1000374062 | 128 |
| 236 | 3300012512 | Ga0157327_1000467 | Ga0157327_10004672 | 128 |
| 237 | 3300013100 | Ga0157373_10099643 | Ga0157373_100996433 | 128 |
| 238 | 3300025228 | Ga0209672_102029 | Ga0209672_1020294 | 128 |
| 239 | 3300025242 | Ga0209258_100245 | Ga0209258_10024525 | 128 |
| 240 | 3300025254 | Ga0209148_1000087 | Ga0209148_100008765 | 128 |
| 241 | 3300025272 | Ga0209455_1017113 | Ga0209455_10171133 | 128 |
| 242 | 3300025926 | Ga0207659_10154460 | Ga0207659_101544602 | 128 |
| 243 | 3300025931 | Ga0207644_10115377 | Ga0207644_101153773 | 128 |
| 244 | 3300025933 | Ga0207706_10203588 | Ga0207706_102035882 | 128 |
| 245 | 3300025940 | Ga0207691_10273987 | Ga0207691_102739872 | 128 |
| 246 | 3300025945 | Ga0207679_10088910 | Ga0207679_100889103 | 128 |
| 247 | 3300025960 | Ga0207651_10262039 | Ga0207651_102620392 | 128 |
| 248 | 3300025986 | Ga0207658_10104913 | Ga0207658_101049132 | 128 |
| 249 | 3300026088 | Ga0207641_10558595 | Ga0207641_105585952 | 128 |
| 250 | 3300026089 | Ga0207648_10180222 | Ga0207648_101802222 | 128 |
| 251 | 3300028380 | Ga0268265_10080583 | Ga0268265_100805832 | 128 |
| 252 | 3300031548 | Ga0307408_101454013 | Ga0307408_1014540131 | 128 |
| 253 | 3300031852 | Ga0307410_10851731 | Ga0307410_108517312 | 128 |
| 254 | 3300032005 | Ga0307411_10416301 | Ga0307411_104163013 | 128 |
| 255 | 3300032005 | Ga0307411_10749412 | Ga0307411_107494121 | 128 |
| 256 | 3300037312 | Ga0395899_0000175 | Ga0395899_0000175_13916_14308 | 128 |
| 257 | 3300037418 | Ga0395900_0000012 | Ga0395900_0000012_276032_276424 | 128 |
| 258 | 3300037466 | Ga0395898_0000034 | Ga0395898_0000034_269539_269931 | 128 |
| 259 | 3300038443 | Ga0395901_0030232 | Ga0395901_0030232_4765_5157 | 128 |
| 260 | 3300038443 | Ga0395901_0057799 | Ga0395901_0057799_3311_3703 | 128 |
| 261 | 3300039145 | Ga0237816_00654 | Ga0237816_00654_1829_2224 | 128 |
| 262 | 3300041413 | Ga0439465_0007729 | Ga0439465_0007729_386_775 | 128 |
| 263 | 3300041453 | Ga0451797_1394323 | Ga0451797_1394323_504_896 | 128 |
| 264 | 3300041494 | Ga0451837_0995902 | Ga0451837_0995902_172_561 | 128 |
| 265 | 3300041494 | Ga0451837_1184456 | Ga0451837_1184456_1174_1566 | 128 |
| 266 | 3300044656 | Ga0466969_0011308 | Ga0466969_0011308_449_841 | 128 |
| 267 | 3300044661 | Ga0466975_0103111 | Ga0466975_0103111_427_819 | 128 |
| 268 | 3300044683 | Ga0466965_0000618 | Ga0466965_0000618_2469_2861 | 128 |
| 269 | 3300044684 | Ga0466966_0008750 | Ga0466966_0008750_3712_4104 | 128 |
| 270 | 3300044684 | Ga0466966_0617742 | Ga0466966_0617742_50_442 | 128 |
| 271 | 3300044693 | Ga0466961_0003439 | Ga0466961_0003439_6095_6487 | 128 |
| 272 | 3300044693 | Ga0466961_0007714 | Ga0466961_0007714_4756_5148 | 128 |
| 273 | 3300044693 | Ga0466961_0016522 | Ga0466961_0016522_4251_4643 | 128 |
| 274 | 3300044694 | Ga0466963_0111863 | Ga0466963_0111863_1316_1708 | 128 |
| 275 | 3300044719 | Ga0466971_0039815 | Ga0466971_0039815_1093_1485 | 128 |
| 276 | 3300044719 | Ga0466971_0048443 | Ga0466971_0048443_1504_1896 | 128 |
| 277 | 3300044765 | Ga0466970_0008881 | Ga0466970_0008881_3657_4049 | 128 |
| 278 | 3300044842 | Ga0466957_0006427 | Ga0466957_0006427_6186_6578 | 128 |
| 279 | 3300044842 | Ga0466957_0007212 | Ga0466957_0007212_2754_3146 | 128 |
| 280 | 3300045049 | Ga0466959_0000068 | Ga0466959_0000068_44313_44705 | 128 |
| 281 | 3300045049 | Ga0466959_0004901 | Ga0466959_0004901_2136_2528 | 128 |
| 282 | 3300045049 | Ga0466959_0014419 | Ga0466959_0014419_3358_3750 | 128 |
| 283 | 3300045836 | Ga0466958_0020415 | Ga0466958_0020415_3149_3541 | 128 |
| 284 | 3300045836 | Ga0466958_0392664 | Ga0466958_0392664_485_877 | 128 |
| 285 | 3300045976 | Ga0466967_0151829 | Ga0466967_0151829_430_822 | 128 |
| 286 | 3300048905 | Ga0496102_0130233 | Ga0496102_0130233_1270_1701 | 128 |
| 287 | 3300048909 | Ga0496106_0093946 | Ga0496106_0093946_1081_1512 | 128 |
| 288 | 3300048912 | Ga0496109_1520390 | Ga0496109_1520390_156_569 | 128 |
| 289 | 3300048919 | Ga0496116_0067346 | Ga0496116_0067346_1062_1454 | 128 |
| 290 | 3300049570 | Ga0501033_0006298 | Ga0501033_0006298_1342_1737 | 128 |
| 291 | 3300049571 | Ga0501034_0612272 | Ga0501034_0612272_11_400 | 128 |
| 292 | 3300049574 | Ga0501038_0016339 | Ga0501038_0016339_4852_5247 | 128 |
| 293 | 3300049575 | Ga0501039_0301346 | Ga0501039_0301346_44_439 | 128 |
| 294 | 3300049579 | Ga0501043_0067412 | Ga0501043_0067412_642_1037 | 128 |
| 295 | 3300049822 | Ga0501035_0150557 | Ga0501035_0150557_1199_1594 | 128 |
| 296 | 3300049823 | Ga0501044_0043955 | Ga0501044_0043955_4200_4595 | 128 |
| 297 | 3300061719 | Ga0466962_0001366 | Ga0466962_0001366_10430_10822 | 128 |
| 298 | 3300003187 | JGI25151J46595_10001223 | JGI25151J46595_1000122315 | 129 |
| 299 | 3300003771 | Ga0055526_1000145 | Ga0055526_100014525 | 129 |
| 300 | 3300003773 | Ga0055537_1000551 | Ga0055537_10005512 | 129 |
| 301 | 3300003775 | Ga0055524_1000211 | Ga0055524_100021138 | 129 |
| 302 | 3300003781 | Ga0055536_1010890 | Ga0055536_10108902 | 129 |
| 303 | 3300003784 | Ga0055534_1000107 | Ga0055534_100010738 | 129 |
| 304 | 3300003790 | Ga0055528_1000027 | Ga0055528_100002791 | 129 |
| 305 | 3300005293 | Ga0065715_10541578 | Ga0065715_105415782 | 129 |
| 306 | 3300005331 | Ga0070670_100166733 | Ga0070670_1001667333 | 129 |
| 307 | 3300005331 | Ga0070670_100365180 | Ga0070670_1003651803 | 129 |
| 308 | 3300005339 | Ga0070660_101282204 | Ga0070660_1012822041 | 129 |
| 309 | 3300005347 | Ga0070668_100043221 | Ga0070668_1000432212 | 129 |
| 310 | 3300005347 | Ga0070668_101516943 | Ga0070668_1015169432 | 129 |
| 311 | 3300005353 | Ga0070669_100029557 | Ga0070669_1000295574 | 129 |
| 312 | 3300005366 | Ga0070659_100088580 | Ga0070659_1000885802 | 129 |
| 313 | 3300005436 | Ga0070713_100857970 | Ga0070713_1008579702 | 129 |
| 314 | 3300005458 | Ga0070681_11640454 | Ga0070681_116404541 | 129 |
| 315 | 3300006051 | Ga0075364_10132214 | Ga0075364_101322143 | 129 |
| 316 | 3300006051 | Ga0075364_10195750 | Ga0075364_101957502 | 129 |
| 317 | 3300009978 | Ga0105148_101412 | Ga0105148_1014122 | 129 |
| 318 | 3300009993 | Ga0105028_121812 | Ga0105028_1218122 | 129 |
| 319 | 3300012482 | Ga0157318_1000417 | Ga0157318_10004173 | 129 |
| 320 | 3300012490 | Ga0157322_1044338 | Ga0157322_10443381 | 129 |
| 321 | 3300012497 | Ga0157319_1005395 | Ga0157319_10053952 | 129 |
| 322 | 3300012508 | Ga0157315_1014045 | Ga0157315_10140452 | 129 |
| 323 | 3300014497 | Ga0182008_10092856 | Ga0182008_100928564 | 129 |
| 324 | 3300015689 | Ga0183360_10001 | Ga0183360_10001693 | 129 |
| 325 | 3300025245 | Ga0207425_1006543 | Ga0207425_10065432 | 129 |
| 326 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005421 | 129 |
| 327 | 3300025273 | Ga0209673_1000011 | Ga0209673_100001176 | 129 |
| 328 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004421 | 129 |
| 329 | 3300025291 | Ga0209675_1017295 | Ga0209675_10172953 | 129 |
| 330 | 3300025292 | Ga0209676_1000540 | Ga0209676_10005402 | 129 |
| 331 | 3300025294 | Ga0209025_1000884 | Ga0209025_100088418 | 129 |
| 332 | 3300025294 | Ga0209025_1065705 | Ga0209025_10657052 | 129 |
| 333 | 3300025295 | Ga0209564_1000018 | Ga0209564_100001876 | 129 |
| 334 | 3300025297 | Ga0209758_1021433 | Ga0209758_10214332 | 129 |
| 335 | 3300025299 | Ga0209256_1000021 | Ga0209256_100002124 | 129 |
| 336 | 3300025923 | Ga0207681_10004298 | Ga0207681_100042986 | 129 |
| 337 | 3300025925 | Ga0207650_10268876 | Ga0207650_102688762 | 129 |
| 338 | 3300025926 | Ga0207659_10400028 | Ga0207659_104000282 | 129 |
| 339 | 3300026118 | Ga0207675_102437747 | Ga0207675_1024377471 | 129 |
| 340 | 3300030742 | Ga0316183_1048983 | Ga0316183_10489833 | 129 |
| 341 | 3300031548 | Ga0307408_100073637 | Ga0307408_1000736372 | 129 |
| 342 | 3300031548 | Ga0307408_100250893 | Ga0307408_1002508933 | 129 |
| 343 | 3300031548 | Ga0307408_100450388 | Ga0307408_1004503882 | 129 |
| 344 | 3300031548 | Ga0307408_100622905 | Ga0307408_1006229052 | 129 |
| 345 | 3300031731 | Ga0307405_10586726 | Ga0307405_105867261 | 129 |
| 346 | 3300031731 | Ga0307405_11832863 | Ga0307405_118328631 | 129 |
| 347 | 3300031824 | Ga0307413_10532066 | Ga0307413_105320662 | 129 |
| 348 | 3300031824 | Ga0307413_11242313 | Ga0307413_112423131 | 129 |
| 349 | 3300031852 | Ga0307410_10055302 | Ga0307410_100553022 | 129 |
| 350 | 3300031852 | Ga0307410_11367064 | Ga0307410_113670641 | 129 |
| 351 | 3300031901 | Ga0307406_11005784 | Ga0307406_110057842 | 129 |
| 352 | 3300031903 | Ga0307407_10620350 | Ga0307407_106203502 | 129 |
| 353 | 3300031911 | Ga0307412_10028574 | Ga0307412_100285744 | 129 |
| 354 | 3300031911 | Ga0307412_11157103 | Ga0307412_111571032 | 129 |
| 355 | 3300031995 | Ga0307409_100633578 | Ga0307409_1006335782 | 129 |
| 356 | 3300032002 | Ga0307416_101752396 | Ga0307416_1017523962 | 129 |
| 357 | 3300032004 | Ga0307414_10109834 | Ga0307414_101098343 | 129 |
| 358 | 3300032004 | Ga0307414_10121773 | Ga0307414_101217733 | 129 |
| 359 | 3300032004 | Ga0307414_10302621 | Ga0307414_103026213 | 129 |
| 360 | 3300032004 | Ga0307414_10443970 | Ga0307414_104439701 | 129 |
| 361 | 3300032005 | Ga0307411_10032321 | Ga0307411_100323212 | 129 |
| 362 | 3300032005 | Ga0307411_10104647 | Ga0307411_101046473 | 129 |
| 363 | 3300032126 | Ga0307415_101022260 | Ga0307415_1010222602 | 129 |
| 364 | 3300037466 | Ga0395898_0232327 | Ga0395898_0232327_1255_1647 | 129 |
| 365 | 3300037471 | Ga0395905_0325484 | Ga0395905_0325484_718_1113 | 129 |
| 366 | 3300038443 | Ga0395901_0384181 | Ga0395901_0384181_691_1083 | 129 |
| 367 | 3300041404 | Ga0439436_0010415 | Ga0439436_0010415_202_594 | 129 |
| 368 | 3300041407 | Ga0439447_007822 | Ga0439447_007822_825_1226 | 129 |
| 369 | 3300041494 | Ga0451837_1827009 | Ga0451837_1827009_906_1298 | 129 |
| 370 | 3300042006 | Ga0439432_012921 | Ga0439432_012921_14_409 | 129 |
| 371 | 3300042006 | Ga0439432_044056 | Ga0439432_044056_706_1101 | 129 |
| 372 | 3300042014 | Ga0439457_030795 | Ga0439457_030795_661_1053 | 129 |
| 373 | 3300042015 | Ga0439462_0071525 | Ga0439462_0071525_515_910 | 129 |
| 374 | 3300046460 | Ga0495638_0103243 | Ga0495638_0103243_702_1103 | 129 |
| 375 | 3300046615 | Ga0495656_0003850 | Ga0495656_0003850_4509_4901 | 129 |
| 376 | 3300046616 | Ga0495668_0016123 | Ga0495668_0016123_3197_3598 | 129 |
| 377 | 3300046691 | Ga0495670_0157942 | Ga0495670_0157942_494_886 | 129 |
| 378 | 3300047318 | Ga0495636_0039930 | Ga0495636_0039930_346_738 | 129 |
| 379 | 3300048911 | Ga0496108_0292930 | Ga0496108_0292930_941_1339 | 129 |
| 380 | 3300048924 | Ga0496121_0013431 | Ga0496121_0013431_1956_2357 | 129 |
| 381 | 3300049531 | Ga0501315_057022 | Ga0501315_057022_59_454 | 129 |
| 382 | 3300049568 | Ga0501031_0367826 | Ga0501031_0367826_495_887 | 129 |
| 383 | 3300049569 | Ga0501032_0043565 | Ga0501032_0043565_244_636 | 129 |
| 384 | 3300049573 | Ga0501037_0033754 | Ga0501037_0033754_2477_2869 | 129 |
| 385 | 3300049574 | Ga0501038_0017969 | Ga0501038_0017969_95_487 | 129 |
| 386 | 3300049586 | Ga0501070_0008880 | Ga0501070_0008880_440_832 | 129 |
| 387 | 3300049587 | Ga0501071_0235342 | Ga0501071_0235342_174_566 | 129 |
| 388 | 3300049589 | Ga0501073_0055773 | Ga0501073_0055773_94_486 | 129 |
| 389 | 3300049590 | Ga0501074_0190666 | Ga0501074_0190666_52_453 | 129 |
| 390 | 3300049652 | Ga0501202_011902 | Ga0501202_011902_785_1180 | 129 |
| 391 | 3300049654 | Ga0501207_105852 | Ga0501207_105852_23_418 | 129 |
| 392 | 3300049663 | Ga0501223_058177 | Ga0501223_058177_205_600 | 129 |
| 393 | 3300049665 | Ga0501227_089745 | Ga0501227_089745_351_746 | 129 |
| 394 | 3300049681 | Ga0501251_033642 | Ga0501251_033642_327_722 | 129 |
| 395 | 3300049705 | Ga0501225_0172189 | Ga0501225_0172189_76_471 | 129 |
| 396 | 3300049742 | Ga0501080_0004656 | Ga0501080_0004656_1216_1608 | 129 |
| 397 | 3300049758 | Ga0501241_086307 | Ga0501241_086307_224_619 | 129 |
| 398 | 3300049765 | Ga0501268_006804 | Ga0501268_006804_329_724 | 129 |
| 399 | 3300049772 | Ga0501275_064389 | Ga0501275_064389_148_543 | 129 |
| 400 | 3300049822 | Ga0501035_0016076 | Ga0501035_0016076_5908_6300 | 129 |
| 401 | 3300049823 | Ga0501044_0010948 | Ga0501044_0010948_2561_2953 | 129 |
| 402 | iso_pu_bacteria | 2643221593 | 2643975748 | 129 |
| 403 | iso_pu_bacteria | 2739367700 | 2739731950 | 129 |
| 404 | iso_pu_bacteria | 2884411467 | 2884413318 | 129 |
| 405 | iso_pu_bacteria | 2928963466 | 2928964645 | 129 |
| 406 | 3300003187 | JGI25151J46595_10056804 | JGI25151J46595_100568042 | 130 |
| 407 | 3300003771 | Ga0055526_1014252 | Ga0055526_10142523 | 130 |
| 408 | 3300003775 | Ga0055524_1012932 | Ga0055524_10129323 | 130 |
| 409 | 3300003775 | Ga0055524_1013700 | Ga0055524_10137001 | 130 |
| 410 | 3300003775 | Ga0055524_1014505 | Ga0055524_10145052 | 130 |
| 411 | 3300003781 | Ga0055536_1052790 | Ga0055536_10527901 | 130 |
| 412 | 3300003781 | Ga0055536_1087917 | Ga0055536_10879171 | 130 |
| 413 | 3300003784 | Ga0055534_1013160 | Ga0055534_10131602 | 130 |
| 414 | 3300003791 | Ga0055530_10000953 | Ga0055530_100009539 | 130 |
| 415 | 3300003794 | Ga0055531_10011192 | Ga0055531_100111921 | 130 |
| 416 | 3300003794 | Ga0055531_10037414 | Ga0055531_100374141 | 130 |
| 417 | 3300003794 | Ga0055531_10037460 | Ga0055531_100374603 | 130 |
| 418 | 3300005327 | Ga0070658_10595004 | Ga0070658_105950041 | 130 |
| 419 | 3300005458 | Ga0070681_10345721 | Ga0070681_103457211 | 130 |
| 420 | 3300005459 | Ga0068867_101430134 | Ga0068867_1014301341 | 130 |
| 421 | 3300005530 | Ga0070679_100199148 | Ga0070679_1001991482 | 130 |
| 422 | 3300005543 | Ga0070672_100040156 | Ga0070672_1000401561 | 130 |
| 423 | 3300005563 | Ga0068855_100960681 | Ga0068855_1009606812 | 130 |
| 424 | 3300005564 | Ga0070664_100449639 | Ga0070664_1004496393 | 130 |
| 425 | 3300005719 | Ga0068861_100253018 | Ga0068861_1002530182 | 130 |
| 426 | 3300006051 | Ga0075364_10082841 | Ga0075364_100828413 | 130 |
| 427 | 3300006051 | Ga0075364_10250989 | Ga0075364_102509892 | 130 |
| 428 | 3300009093 | Ga0105240_10031027 | Ga0105240_100310278 | 130 |
| 429 | 3300009148 | Ga0105243_12142846 | Ga0105243_121428462 | 130 |
| 430 | 3300009174 | Ga0105241_10128930 | Ga0105241_101289302 | 130 |
| 431 | 3300013102 | Ga0157371_10074908 | Ga0157371_100749083 | 130 |
| 432 | 3300013102 | Ga0157371_11317952 | Ga0157371_113179522 | 130 |
| 433 | 3300013306 | Ga0163162_12063065 | Ga0163162_120630651 | 130 |
| 434 | 3300013307 | Ga0157372_10017019 | Ga0157372_100170197 | 130 |
| 435 | 3300013307 | Ga0157372_10931684 | Ga0157372_109316842 | 130 |
| 436 | 3300013308 | Ga0157375_10610965 | Ga0157375_106109652 | 130 |
| 437 | 3300025245 | Ga0207425_1071871 | Ga0207425_10718711 | 130 |
| 438 | 3300025273 | Ga0209673_1018362 | Ga0209673_10183623 | 130 |
| 439 | 3300025284 | Ga0209130_1009349 | Ga0209130_10093493 | 130 |
| 440 | 3300025291 | Ga0209675_1011075 | Ga0209675_10110752 | 130 |
| 441 | 3300025291 | Ga0209675_1028531 | Ga0209675_10285311 | 130 |
| 442 | 3300025292 | Ga0209676_1011200 | Ga0209676_10112002 | 130 |
| 443 | 3300025292 | Ga0209676_1012303 | Ga0209676_10123034 | 130 |
| 444 | 3300025292 | Ga0209676_1013870 | Ga0209676_10138702 | 130 |
| 445 | 3300025292 | Ga0209676_1019284 | Ga0209676_10192842 | 130 |
| 446 | 3300025292 | Ga0209676_1085599 | Ga0209676_10855991 | 130 |
| 447 | 3300025294 | Ga0209025_1030854 | Ga0209025_10308543 | 130 |
| 448 | 3300025295 | Ga0209564_1018435 | Ga0209564_10184353 | 130 |
| 449 | 3300025295 | Ga0209564_1019857 | Ga0209564_10198573 | 130 |
| 450 | 3300025298 | Ga0209050_1001358 | Ga0209050_100135819 | 130 |
| 451 | 3300025298 | Ga0209050_1018102 | Ga0209050_10181023 | 130 |
| 452 | 3300025299 | Ga0209256_1003298 | Ga0209256_10032982 | 130 |
| 453 | 3300025299 | Ga0209256_1004157 | Ga0209256_100415711 | 130 |
| 454 | 3300025299 | Ga0209256_1007202 | Ga0209256_10072021 | 130 |
| 455 | 3300025303 | Ga0209051_1012905 | Ga0209051_10129053 | 130 |
| 456 | 3300025304 | Ga0209257_1000133 | Ga0209257_100013353 | 130 |
| 457 | 3300025304 | Ga0209257_1000789 | Ga0209257_10007891 | 130 |
| 458 | 3300025304 | Ga0209257_1013716 | Ga0209257_10137162 | 130 |
| 459 | 3300025304 | Ga0209257_1014558 | Ga0209257_10145581 | 130 |
| 460 | 3300025304 | Ga0209257_1023789 | Ga0209257_10237891 | 130 |
| 461 | 3300025304 | Ga0209257_1080118 | Ga0209257_10801182 | 130 |
| 462 | 3300025913 | Ga0207695_10028459 | Ga0207695_100284593 | 130 |
| 463 | 3300025914 | Ga0207671_11269905 | Ga0207671_112699051 | 130 |
| 464 | 3300025917 | Ga0207660_10496311 | Ga0207660_104963112 | 130 |
| 465 | 3300025919 | Ga0207657_10030861 | Ga0207657_100308614 | 130 |
| 466 | 3300025921 | Ga0207652_10441252 | Ga0207652_104412522 | 130 |
| 467 | 3300025921 | Ga0207652_10540100 | Ga0207652_105401002 | 130 |
| 468 | 3300025927 | Ga0207687_11673743 | Ga0207687_116737431 | 130 |
| 469 | 3300025940 | Ga0207691_10001528 | Ga0207691_1000152822 | 130 |
| 470 | 3300025945 | Ga0207679_10120196 | Ga0207679_101201963 | 130 |
| 471 | 3300025949 | Ga0207667_10424542 | Ga0207667_104245423 | 130 |
| 472 | 3300026089 | Ga0207648_10270806 | Ga0207648_102708063 | 130 |
| 473 | 3300026095 | Ga0207676_10988183 | Ga0207676_109881831 | 130 |
| 474 | 3300026118 | Ga0207675_100234700 | Ga0207675_1002347003 | 130 |
| 475 | 3300027876 | Ga0209974_10037703 | Ga0209974_100377032 | 130 |
| 476 | 3300031731 | Ga0307405_10287559 | Ga0307405_102875592 | 130 |
| 477 | 3300031824 | Ga0307413_10218818 | Ga0307413_102188183 | 130 |
| 478 | 3300032004 | Ga0307414_10001544 | Ga0307414_100015448 | 130 |
| 479 | 3300032004 | Ga0307414_10049413 | Ga0307414_100494133 | 130 |
| 480 | 3300032004 | Ga0307414_10135860 | Ga0307414_101358602 | 130 |
| 481 | 3300032004 | Ga0307414_10183629 | Ga0307414_101836291 | 130 |
| 482 | 3300032005 | Ga0307411_10078395 | Ga0307411_100783953 | 130 |
| 483 | 3300037312 | Ga0395899_0010682 | Ga0395899_0010682_5686_6087 | 130 |
| 484 | 3300037312 | Ga0395899_0020288 | Ga0395899_0020288_4481_4876 | 130 |
| 485 | 3300037312 | Ga0395899_0046819 | Ga0395899_0046819_162_557 | 130 |
| 486 | 3300037312 | Ga0395899_0106492 | Ga0395899_0106492_992_1387 | 130 |
| 487 | 3300037418 | Ga0395900_0001866 | Ga0395900_0001866_11489_11884 | 130 |
| 488 | 3300037418 | Ga0395900_0090150 | Ga0395900_0090150_287_688 | 130 |
| 489 | 3300037418 | Ga0395900_0095564 | Ga0395900_0095564_797_1192 | 130 |
| 490 | 3300037466 | Ga0395898_0005801 | Ga0395898_0005801_5816_6211 | 130 |
| 491 | 3300037466 | Ga0395898_0085697 | Ga0395898_0085697_1321_1722 | 130 |
| 492 | 3300037466 | Ga0395898_0091058 | Ga0395898_0091058_1935_2330 | 130 |
| 493 | 3300037471 | Ga0395905_0066951 | Ga0395905_0066951_401_802 | 130 |
| 494 | 3300038443 | Ga0395901_0025292 | Ga0395901_0025292_1734_2129 | 130 |
| 495 | 3300038443 | Ga0395901_0035285 | Ga0395901_0035285_1321_1722 | 130 |
| 496 | 3300038443 | Ga0395901_0062194 | Ga0395901_0062194_825_1220 | 130 |
| 497 | 3300041494 | Ga0451837_1008743 | Ga0451837_1008743_207_605 | 130 |
| 498 | 3300041999 | Ga0439433_0061063 | Ga0439433_0061063_486_887 | 130 |
| 499 | 3300045976 | Ga0466967_0158947 | Ga0466967_0158947_878_1273 | 130 |
| 500 | 3300046525 | Ga0495663_0019883 | Ga0495663_0019883_1145_1543 | 130 |
| 501 | 3300046525 | Ga0495663_0045408 | Ga0495663_0045408_494_892 | 130 |
| 502 | 3300046537 | Ga0495598_0010004 | Ga0495598_0010004_57_455 | 130 |
| 503 | 3300046539 | Ga0495621_0058286 | Ga0495621_0058286_922_1320 | 130 |
| 504 | 3300046615 | Ga0495656_0002244 | Ga0495656_0002244_5426_5833 | 130 |
| 505 | 3300047318 | Ga0495636_0008301 | Ga0495636_0008301_2828_3235 | 130 |
| 506 | 3300048912 | Ga0496109_0287764 | Ga0496109_0287764_365_763 | 130 |
| 507 | 3300049569 | Ga0501032_0055322 | Ga0501032_0055322_929_1324 | 130 |
| 508 | 3300049570 | Ga0501033_0010579 | Ga0501033_0010579_5617_6012 | 130 |
| 509 | 3300049573 | Ga0501037_0638977 | Ga0501037_0638977_148_543 | 130 |
| 510 | 3300049574 | Ga0501038_0025770 | Ga0501038_0025770_4053_4448 | 130 |
| 511 | 3300049579 | Ga0501043_0019326 | Ga0501043_0019326_4326_4721 | 130 |
| 512 | 3300049581 | Ga0501047_0015109 | Ga0501047_0015109_1228_1623 | 130 |
| 513 | 3300049581 | Ga0501047_0079026 | Ga0501047_0079026_2201_2596 | 130 |
| 514 | 3300049822 | Ga0501035_0051346 | Ga0501035_0051346_2072_2467 | 130 |
| 515 | 3300049823 | Ga0501044_0714542 | Ga0501044_0714542_262_657 | 130 |
| 516 | 3300050491 | nmdc:mga00v17_209482_c1 | nmdc:mga00v17_209482_c1_82_477 | 130 |
| 517 | 3300050491 | nmdc:mga00v17_57252_c1 | nmdc:mga00v17_57252_c1_1859_2254 | 130 |
| 518 | 3300003316 | rootH1_10005491 | rootH1_100054913 | 131 |
| 519 | 3300014969 | Ga0157376_10041204 | Ga0157376_100412044 | 131 |
| 520 | 3300031548 | Ga0307408_100851347 | Ga0307408_1008513471 | 131 |
| 521 | 3300031824 | Ga0307413_10162073 | Ga0307413_101620733 | 131 |
| 522 | 3300031995 | Ga0307409_100862034 | Ga0307409_1008620342 | 131 |
| 523 | 3300032004 | Ga0307414_10023667 | Ga0307414_100236672 | 131 |
| 524 | 3300032004 | Ga0307414_10033019 | Ga0307414_100330193 | 131 |
| 525 | 3300032004 | Ga0307414_10244630 | Ga0307414_102446301 | 131 |
| 526 | 3300035113 | Ga0373936_0206284 | Ga0373936_0206284_281_694 | 131 |
| 527 | 3300046472 | Ga0495580_0221350 | Ga0495580_0221350_741_1154 | 131 |
| 528 | 3300046476 | Ga0495662_0180376 | Ga0495662_0180376_279_692 | 131 |
| 529 | 3300046531 | Ga0495665_0183146 | Ga0495665_0183146_514_927 | 131 |
| 530 | 3300046539 | Ga0495621_0133998 | Ga0495621_0133998_224_634 | 131 |
| 531 | 3300046664 | Ga0495659_0017172 | Ga0495659_0017172_1537_1947 | 131 |
| 532 | 3300046691 | Ga0495670_0066868 | Ga0495670_0066868_206_619 | 131 |
| 533 | 3300048917 | Ga0496114_0816454 | Ga0496114_0816454_159_572 | 131 |
| 534 | 3300049582 | Ga0501048_0031705 | Ga0501048_0031705_659_1060 | 131 |
| 535 | 3300049661 | Ga0501217_044793 | Ga0501217_044793_545_961 | 131 |
| 536 | 3300049823 | Ga0501044_0862009 | Ga0501044_0862009_275_682 | 131 |
| 537 | 3300003316 | rootH1_10044861 | rootH1_100448612 | 132 |
| 538 | 3300005293 | Ga0065715_10007122 | Ga0065715_100071226 | 132 |
| 539 | 3300005330 | Ga0070690_100239057 | Ga0070690_1002390571 | 132 |
| 540 | 3300005338 | Ga0068868_101928564 | Ga0068868_1019285641 | 132 |
| 541 | 3300005340 | Ga0070689_100347788 | Ga0070689_1003477883 | 132 |
| 542 | 3300005347 | Ga0070668_100012671 | Ga0070668_1000126715 | 132 |
| 543 | 3300005347 | Ga0070668_100141071 | Ga0070668_1001410711 | 132 |
| 544 | 3300005539 | Ga0068853_100627577 | Ga0068853_1006275772 | 132 |
| 545 | 3300005543 | Ga0070672_100094988 | Ga0070672_1000949883 | 132 |
| 546 | 3300005577 | Ga0068857_100835603 | Ga0068857_1008356031 | 132 |
| 547 | 3300005617 | Ga0068859_100073797 | Ga0068859_1000737973 | 132 |
| 548 | 3300006931 | Ga0097620_100073795 | Ga0097620_1000737952 | 132 |
| 549 | 3300013308 | Ga0157375_10060484 | Ga0157375_100604841 | 132 |
| 550 | 3300025933 | Ga0207706_10155232 | Ga0207706_101552321 | 132 |
| 551 | 3300025940 | Ga0207691_10023348 | Ga0207691_100233483 | 132 |
| 552 | 3300025942 | Ga0207689_10080614 | Ga0207689_100806141 | 132 |
| 553 | 3300025972 | Ga0207668_10718966 | Ga0207668_107189661 | 132 |
| 554 | 3300026041 | Ga0207639_10056707 | Ga0207639_100567073 | 132 |
| 555 | 3300026089 | Ga0207648_10010388 | Ga0207648_100103886 | 132 |
| 556 | 3300031731 | Ga0307405_10915269 | Ga0307405_109152691 | 132 |
| 557 | 3300031824 | Ga0307413_10480504 | Ga0307413_104805042 | 132 |
| 558 | 3300031911 | Ga0307412_10326529 | Ga0307412_103265291 | 132 |
| 559 | 3300032004 | Ga0307414_10231277 | Ga0307414_102312771 | 132 |
| 560 | 3300032004 | Ga0307414_10883857 | Ga0307414_108838571 | 132 |
| 561 | 3300038443 | Ga0395901_0889251 | Ga0395901_0889251_65_466 | 132 |
| 562 | 3300041512 | Ga0451853_2956181 | Ga0451853_2956181_236_658 | 132 |
| 563 | 3300046539 | Ga0495621_0026389 | Ga0495621_0026389_822_1235 | 132 |
| 564 | 3300046675 | Ga0495657_0147701 | Ga0495657_0147701_24_449 | 132 |
| 565 | 3300047318 | Ga0495636_0003450 | Ga0495636_0003450_3427_3840 | 132 |
| 566 | 3300047318 | Ga0495636_0180588 | Ga0495636_0180588_10_423 | 132 |
| 567 | 3300049571 | Ga0501034_0000316 | Ga0501034_0000316_9409_9828 | 132 |
| 568 | 3300049573 | Ga0501037_0619400 | Ga0501037_0619400_311_715 | 132 |
| 569 | 3300049579 | Ga0501043_0438180 | Ga0501043_0438180_551_955 | 132 |
| 570 | 3300049580 | Ga0501046_0573545 | Ga0501046_0573545_218_622 | 132 |
| 571 | 3300049581 | Ga0501047_0010880 | Ga0501047_0010880_7936_8340 | 132 |
| 572 | 3300049586 | Ga0501070_0387426 | Ga0501070_0387426_442_843 | 132 |
| 573 | 3300002737 | JGI25162J39368_1001443 | JGI25162J39368_10014431 | 133 |
| 574 | 3300002737 | JGI25162J39368_1002323 | JGI25162J39368_10023237 | 133 |
| 575 | 3300002737 | JGI25162J39368_1015344 | JGI25162J39368_10153441 | 133 |
| 576 | 3300002741 | JGI25157J39369_1000345 | JGI25157J39369_10003452 | 133 |
| 577 | 3300002741 | JGI25157J39369_1001366 | JGI25157J39369_10013667 | 133 |
| 578 | 3300002771 | JGI25163J39215_1000517 | JGI25163J39215_10005172 | 133 |
| 579 | 3300002772 | JGI25164J39214_1000214 | JGI25164J39214_100021411 | 133 |
| 580 | 3300003214 | JGI25165J46597_1000260 | JGI25165J46597_100026012 | 133 |
| 581 | 3300003751 | Ga0055538_1002032 | Ga0055538_10020323 | 133 |
| 582 | 3300003756 | Ga0055533_1000336 | Ga0055533_10003367 | 133 |
| 583 | 3300003761 | Ga0055535_1000323 | Ga0055535_100032312 | 133 |
| 584 | 3300003761 | Ga0055535_1015573 | Ga0055535_10155731 | 133 |
| 585 | 3300003762 | Ga0055542_1001347 | Ga0055542_10013471 | 133 |
| 586 | 3300003762 | Ga0055542_1001348 | Ga0055542_10013481 | 133 |
| 587 | 3300003763 | Ga0055529_1000233 | Ga0055529_100023312 | 133 |
| 588 | 3300003841 | Ga0055541_1011864 | Ga0055541_10118642 | 133 |
| 589 | 3300005340 | Ga0070689_100056593 | Ga0070689_1000565933 | 133 |
| 590 | 3300005344 | Ga0070661_100016933 | Ga0070661_1000169333 | 133 |
| 591 | 3300005365 | Ga0070688_100071787 | Ga0070688_1000717872 | 133 |
| 592 | 3300005466 | Ga0070685_10011677 | Ga0070685_100116773 | 133 |
| 593 | 3300005843 | Ga0068860_100185877 | Ga0068860_1001858771 | 133 |
| 594 | 3300009551 | Ga0105238_10210401 | Ga0105238_102104012 | 133 |
| 595 | 3300013306 | Ga0163162_10032740 | Ga0163162_100327405 | 133 |
| 596 | 3300014969 | Ga0157376_10167451 | Ga0157376_101674512 | 133 |
| 597 | 3300015262 | Ga0182007_10052561 | Ga0182007_100525612 | 133 |
| 598 | 3300025207 | Ga0209760_100358 | Ga0209760_10035811 | 133 |
| 599 | 3300025224 | Ga0209784_100068 | Ga0209784_100068100 | 133 |
| 600 | 3300025225 | Ga0209566_101255 | Ga0209566_1012557 | 133 |
| 601 | 3300025226 | Ga0209674_100012 | Ga0209674_100012615 | 133 |
| 602 | 3300025228 | Ga0209672_100791 | Ga0209672_1007913 | 133 |
| 603 | 3300025231 | Ga0207427_100156 | Ga0207427_10015671 | 133 |
| 604 | 3300025231 | Ga0207427_112102 | Ga0207427_1121022 | 133 |
| 605 | 3300025233 | Ga0209437_100126 | Ga0209437_10012627 | 133 |
| 606 | 3300025233 | Ga0209437_100147 | Ga0209437_10014771 | 133 |
| 607 | 3300025233 | Ga0209437_115603 | Ga0209437_1156031 | 133 |
| 608 | 3300025242 | Ga0209258_100049 | Ga0209258_10004937 | 133 |
| 609 | 3300025242 | Ga0209258_105589 | Ga0209258_1055892 | 133 |
| 610 | 3300025246 | Ga0209646_1000810 | Ga0209646_10008103 | 133 |
| 611 | 3300025250 | Ga0209026_1000099 | Ga0209026_1000099100 | 133 |
| 612 | 3300025250 | Ga0209026_1004452 | Ga0209026_10044525 | 133 |
| 613 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021459 | 133 |
| 614 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010983 | 133 |
| 615 | 3300025256 | Ga0209759_1000316 | Ga0209759_100031658 | 133 |
| 616 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009187 | 133 |
| 617 | 3300025261 | Ga0209233_1016480 | Ga0209233_10164803 | 133 |
| 618 | 3300025261 | Ga0209233_1045019 | Ga0209233_10450192 | 133 |
| 619 | 3300025272 | Ga0209455_1000086 | Ga0209455_1000086188 | 133 |
| 620 | 3300025924 | Ga0207694_10067225 | Ga0207694_100672252 | 133 |
| 621 | 3300025936 | Ga0207670_10040564 | Ga0207670_100405643 | 133 |
| 622 | 3300026067 | Ga0207678_10026991 | Ga0207678_100269913 | 133 |
| 623 | 3300028380 | Ga0268265_10306665 | Ga0268265_103066652 | 133 |
| 624 | 3300028381 | Ga0268264_10191216 | Ga0268264_101912163 | 133 |
| 625 | 3300046460 | Ga0495638_0000777 | Ga0495638_0000777_883_1290 | 133 |
| 626 | 3300046460 | Ga0495638_0001254 | Ga0495638_0001254_12370_12777 | 133 |
| 627 | 3300046471 | Ga0495650_0000585 | Ga0495650_0000585_34196_34603 | 133 |
| 628 | 3300046507 | Ga0495606_0001787 | Ga0495606_0001787_14854_15261 | 133 |
| 629 | 3300046660 | Ga0495625_0048972 | Ga0495625_0048972_2375_2782 | 133 |
| 630 | 3300046660 | Ga0495625_0113616 | Ga0495625_0113616_599_1006 | 133 |
| 631 | 3300046694 | Ga0495649_0212679 | Ga0495649_0212679_68_475 | 133 |
| 632 | 3300048907 | Ga0496104_0114648 | Ga0496104_0114648_1724_2131 | 133 |
| 633 | 3300048917 | Ga0496114_0084162 | Ga0496114_0084162_722_1129 | 133 |
| 634 | 3300048929 | Ga0496126_0050642 | Ga0496126_0050642_1907_2314 | 133 |
| 635 | 3300048929 | Ga0496126_0378088 | Ga0496126_0378088_348_755 | 133 |
| 636 | 3300049459 | Ga0495678_077392 | Ga0495678_077392_287_694 | 133 |
| 637 | 3300049523 | Ga0501300_002974 | Ga0501300_002974_1116_1523 | 133 |
| 638 | 3300049762 | Ga0501265_000627 | Ga0501265_000627_3004_3411 | 133 |
| 639 | 3300049772 | Ga0501275_000601 | Ga0501275_000601_2814_3221 | 133 |
| 640 | 3300049823 | Ga0501044_0126540 | Ga0501044_0126540_650_1063 | 133 |
| 641 | 3300001990 | JGI24737J22298_10013411 | JGI24737J22298_100134114 | 134 |
| 642 | 3300002067 | JGI24735J21928_10025036 | JGI24735J21928_100250363 | 134 |
| 643 | 3300003761 | Ga0055535_1005001 | Ga0055535_10050013 | 134 |
| 644 | 3300009545 | Ga0105237_10292670 | Ga0105237_102926703 | 134 |
| 645 | 3300009553 | Ga0105249_11795905 | Ga0105249_117959051 | 134 |
| 646 | 3300010375 | Ga0105239_10239874 | Ga0105239_102398743 | 134 |
| 647 | 3300010375 | Ga0105239_10458409 | Ga0105239_104584092 | 134 |
| 648 | 3300013105 | Ga0157369_10163907 | Ga0157369_101639073 | 134 |
| 649 | 3300013296 | Ga0157374_11005297 | Ga0157374_110052972 | 134 |
| 650 | 3300013308 | Ga0157375_11404660 | Ga0157375_114046602 | 134 |
| 651 | 3300015687 | Ga0183368_1003 | Ga0183368_1003861 | 134 |
| 652 | 3300025242 | Ga0209258_100762 | Ga0209258_1007625 | 134 |
| 653 | 3300025904 | Ga0207647_10007462 | Ga0207647_100074626 | 134 |
| 654 | 3300025914 | Ga0207671_10148435 | Ga0207671_101484353 | 134 |
| 655 | 3300025941 | Ga0207711_10036599 | Ga0207711_100365994 | 134 |
| 656 | 3300025942 | Ga0207689_10201100 | Ga0207689_102011003 | 134 |
| 657 | 3300025961 | Ga0207712_11488316 | Ga0207712_114883161 | 134 |
| 658 | 3300044694 | Ga0466963_0827751 | Ga0466963_0827751_90_494 | 134 |
| 659 | 3300045976 | Ga0466967_0393216 | Ga0466967_0393216_653_1057 | 134 |
| 660 | 3300048916 | Ga0496113_0047904 | Ga0496113_0047904_639_1043 | 134 |
| 661 | 3300048918 | Ga0496115_0000025 | Ga0496115_0000025_135785_136189 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kon-assembly1.cif.gz_A | crystal structure of e.coli yebc | 0.8458 | 54 | 98 |
| 1vke-assembly1.cif.gz_F | crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution | 0.8305 | 31 | 126 |
| 1vke-assembly1.cif.gz_F | crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution | 0.8143 | 31 | 126 |
| 1vke-assembly1.cif.gz_A | crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution | 0.7457 | 16 | 127 |
| 1p8c-assembly1.cif.gz_B | crystal structure of tm1620 (apc4843) from thermotoga maritima | 0.7402 | 16 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vkeC00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8519 | 33 | 127 | 1.20.1290.10 |
| 1vkeB00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8394 | 33 | 127 | 1.20.1290.10 |
| 1vkeF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8305 | 31 | 126 | 1.20.1290.10 |
| 1vkeF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8143 | 31 | 126 | 1.20.1290.10 |
| 1vkeC00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8033 | 33 | 127 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z1R3G8-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9974 | 55 | 122 |
GO:0051920
|
| AF-A0A4Y7U3X9-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9945 | 56 | 124 |
GO:0051920
|
| AF-A0A3M1P315-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9914 | 52 | 124 |
GO:0051920
|
| AF-A0A2N2NMT7-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9896 | 52 | 124 |
GO:0051920
|
| AF-A0A520IVB4-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.97 | 47 | 121 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar