F473379

General Info

Members Datasets Scaffolds Average Seq Length
661 333 639 131

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100012671|Ga0070668_1000126715
Length 148
Sequence MSAPSETGGHGSGGRTADAAVQSESDRVAEFTAFRQRMNERILAEPNQVVRRFFALDTQTYQPGALDVKTKELLGLVASMVLRCDDCISYHVAQCREAGVDRDEMFEAFSVGLVVGGSIVIPHLRRAVDFLDKLEQGGEATQPAHDHG

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221593 Lysobacter sp. Root690 Isolate Unclassified
8 2643221612 Lysobacter sp. Root76 Isolate Unclassified
9 2643221695 Lysobacter sp. Root494 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221727 Lysobacter sp. Root96 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
14 2739367700 Dyella sp. YR388 Isolate Unclassified
15 2884411467 Dyella sp. AD56 Isolate Rhizosphere
16 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
17 2919513703 Luteimonas sp. 3794 Isolate Unclassified
18 2919675420 Luteimonas terrae 4099 Isolate Unclassified
19 2928963466 Dyella japonica 1073 Isolate Unclassified
20 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
21 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
35 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
36 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
37 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
40 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
50 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
54 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
57 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
58 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
102 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
105 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
106 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
107 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
108 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
109 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
110 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
124 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
125 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
229 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
230 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
231 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
232 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
233 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
234 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
240 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
241 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
244 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
245 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
246 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
264 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
292 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
293 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
312 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
313 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
314 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
315 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
316 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
317 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
318 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
319 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
320 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
323 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
324 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
325 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
326 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
327 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
332 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
333 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 1.06
Isolates 3.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.91
Nodule 0
Rhizoplane 3.93
Rhizosphere 69.29
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10013411 3300001990 Bacteria 2668
2 JGI24735J21928_10025036 3300002067 Bacteria 1802
3 JGI25156J39149_1004997 3300002705 Bacteria 3917
4 JGI25156J39149_1045019 3300002705 Bacteria 595
5 JGI25162J39368_1001443 3300002737 Bacteria 12678
6 JGI25162J39368_1001962 3300002737 Bacteria 9238
7 JGI25162J39368_1002285 3300002737 Bacteria 7729
8 JGI25162J39368_1002323 3300002737 Bacteria 7598
9 JGI25162J39368_1002410 3300002737 Bacteria 7326
10 JGI25162J39368_1015344 3300002737 Bacteria 794
11 JGI25157J39369_1000345 3300002741 Bacteria 32775
12 JGI25157J39369_1001104 3300002741 Bacteria 12036
13 JGI25157J39369_1001366 3300002741 Bacteria 9533
14 JGI25157J39369_1001483 3300002741 Bacteria 8643
15 JGI25157J39369_1002835 3300002741 Bacteria 3921
16 JGI25163J39215_1000517 3300002771 Bacteria 11391
17 JGI25164J39214_1000035 3300002772 Bacteria 139987
18 JGI25164J39214_1000214 3300002772 Bacteria 47762
19 JGI25164J39214_1000964 3300002772 Bacteria 9234
20 JGI25151J46595_10001223 3300003187 Bacteria 18350
21 JGI25151J46595_10056804 3300003187 Bacteria 1281
22 JGI25165J46597_1000226 3300003214 Bacteria 78481
23 JGI25165J46597_1000260 3300003214 Bacteria 70453
24 JGI25165J46597_1001786 3300003214 Bacteria 9238
25 rootH1_10005491 3300003316 Bacteria 3532
26 rootH1_10005491 3300003323 Bacteria 15715
27 rootH1_10005492 3300003316 Bacteria 5293
28 rootH1_10044861 3300003316 Bacteria 3039
29 Ga0055538_1002032 3300003751 Bacteria 3271
30 Ga0055533_1000336 3300003756 Bacteria 20596
31 Ga0055527_1003185 3300003760 Bacteria 2511
32 Ga0055535_1000323 3300003761 Bacteria 48370
33 Ga0055535_1000642 3300003761 Bacteria 27803
34 Ga0055535_1000810 3300003761 Bacteria 22612
35 Ga0055535_1005001 3300003761 Bacteria 3031
36 Ga0055535_1015573 3300003761 Bacteria 1062
37 Ga0055542_1000442 3300003762 Bacteria 39685
38 Ga0055542_1000522 3300003762 Bacteria 34617
39 Ga0055542_1001347 3300003762 Bacteria 12678
40 Ga0055542_1001348 3300003762 Bacteria 12672
41 Ga0055529_1000233 3300003763 Bacteria 70453
42 Ga0055529_1000367 3300003763 Bacteria 48920
43 Ga0055529_1006460 3300003763 Bacteria 1637
44 Ga0055526_1000145 3300003771 Bacteria 62400
45 Ga0055526_1014252 3300003771 Bacteria 3285
46 Ga0055537_1000551 3300003773 Bacteria 21389
47 Ga0055524_1000211 3300003775 Bacteria 62400
48 Ga0055524_1012932 3300003775 Bacteria 3178
49 Ga0055524_1013700 3300003775 Bacteria 3046
50 Ga0055524_1014505 3300003775 Bacteria 2917
51 Ga0055536_1010890 3300003781 Bacteria 3551
52 Ga0055536_1052790 3300003781 Bacteria 883
53 Ga0055536_1087917 3300003781 Bacteria 577
54 Ga0055534_1000107 3300003784 Bacteria 62400
55 Ga0055534_1013160 3300003784 Bacteria 1599
56 Ga0055528_1000027 3300003790 Bacteria 126420
57 Ga0055530_10000953 3300003791 Bacteria 23664
58 Ga0055531_10011192 3300003794 Bacteria 4361
59 Ga0055531_10037414 3300003794 Bacteria 1477
60 Ga0055531_10037460 3300003794 Bacteria 1474
61 Ga0055541_1011864 3300003841 Bacteria 1266
62 Ga0065165_1001244 3300005262 Bacteria 29035
63 Ga0065704_10465274 3300005289 Bacteria 694
64 Ga0065715_10007122 3300005293 Bacteria 4300
65 Ga0065715_10541578 3300005293 Bacteria 748
66 Ga0070658_10595004 3300005327 Bacteria 958
67 Ga0070690_100239057 3300005330 Bacteria 1280
68 Ga0070670_100166733 3300005331 Bacteria 1910
69 Ga0070670_100365180 3300005331 Bacteria 1270
70 Ga0070670_100410383 3300005331 Bacteria 1197
71 Ga0070666_11254084 3300005335 Bacteria 553
72 Ga0070680_100462949 3300005336 Bacteria 1083
73 Ga0070682_100003250 3300005337 Bacteria 9016
74 Ga0070682_100023162 3300005337 Bacteria 3686
75 Ga0068868_101928564 3300005338 Bacteria 560
76 Ga0070660_100873260 3300005339 Bacteria 758
77 Ga0070660_101282204 3300005339 Bacteria 622
78 Ga0070689_100056593 3300005340 Bacteria 3041
79 Ga0070689_100347788 3300005340 Bacteria 1243
80 Ga0070687_100669774 3300005343 Bacteria 721
81 Ga0070661_100016933 3300005344 Bacteria 5162
82 Ga0070668_100012671 3300005347 Bacteria 6277
83 Ga0070668_100043221 3300005347 Bacteria 3455
84 Ga0070668_100141071 3300005347 Bacteria 1942
85 Ga0070668_101516943 3300005347 Bacteria 613
86 Ga0070669_100029557 3300005353 Bacteria 3951
87 Ga0070671_100170561 3300005355 Bacteria 1840
88 Ga0070671_100300204 3300005355 Bacteria 1367
89 Ga0070673_100137023 3300005364 Bacteria 2061
90 Ga0070673_100186066 3300005364 Bacteria 1781
91 Ga0070688_100071787 3300005365 Bacteria 2217
92 Ga0070659_100088580 3300005366 Bacteria 2479
93 Ga0070659_100150360 3300005366 Bacteria 1899
94 Ga0070714_100056167 3300005435 Bacteria 3367
95 Ga0070713_100002503 3300005436 Bacteria 12005
96 Ga0070713_100857970 3300005436 Bacteria 872
97 Ga0070710_10007695 3300005437 Bacteria 5225
98 Ga0070711_100381287 3300005439 Bacteria 1140
99 Ga0070663_100008950 3300005455 Bacteria 6183
100 Ga0070663_100467095 3300005455 Bacteria 1043
101 Ga0070662_100153509 3300005457 Bacteria 1795
102 Ga0070681_10007152 3300005458 Bacteria 10874
103 Ga0070681_10345721 3300005458 Bacteria 1398
104 Ga0070681_11640454 3300005458 Bacteria 569
105 Ga0068867_100152093 3300005459 Bacteria 1819
106 Ga0068867_101430134 3300005459 Bacteria 642
107 Ga0070685_10011677 3300005466 Bacteria 4602
108 Ga0070679_100023990 3300005530 Bacteria 5975
109 Ga0070679_100199148 3300005530 Bacteria 1969
110 Ga0068853_100050055 3300005539 Bacteria 3593
111 Ga0068853_100230007 3300005539 Bacteria 1696
112 Ga0068853_100627577 3300005539 Bacteria 1022
113 Ga0070672_100040156 3300005543 Bacteria 3588
114 Ga0070672_100094988 3300005543 Bacteria 2411
115 Ga0070672_100283428 3300005543 Bacteria 1401
116 Ga0070696_100004581 3300005546 Bacteria 9229
117 Ga0070665_100785140 3300005548 Bacteria 965
118 Ga0068855_100101644 3300005563 Bacteria 3309
119 Ga0068855_100368953 3300005563 Bacteria 1578
120 Ga0068855_100960681 3300005563 Bacteria 900
121 Ga0070664_100449639 3300005564 Bacteria 1183
122 Ga0068857_100835603 3300005577 Bacteria 881
123 Ga0068854_100092621 3300005578 Bacteria 2251
124 Ga0068854_100203445 3300005578 Bacteria 1558
125 Ga0068856_100000012 3300005614 Bacteria 166032
126 Ga0068859_100073797 3300005617 Bacteria 3450
127 Ga0068864_100073009 3300005618 Bacteria 2991
128 Ga0068861_100253018 3300005719 Bacteria 1504
129 Ga0068863_100894665 3300005841 Bacteria 888
130 Ga0068860_100185877 3300005843 Bacteria 2009
131 Ga0068862_100037406 3300005844 Bacteria 4114
132 Ga0068862_100877032 3300005844 Bacteria 881
133 Ga0075364_10082841 3300006051 Bacteria 2122
134 Ga0075364_10132214 3300006051 Bacteria 1675
135 Ga0075364_10195750 3300006051 Bacteria 1369
136 Ga0075364_10250989 3300006051 Bacteria 1202
137 Ga0097620_100073795 3300006931 Bacteria 3450
138 Ga0105240_10031027 3300009093 Bacteria 6936
139 Ga0105240_10054282 3300009093 Bacteria 5022
140 Ga0105243_12142846 3300009148 Bacteria 595
141 Ga0105243_12480019 3300009148 Bacteria 557
142 Ga0105241_10021514 3300009174 Bacteria 4768
143 Ga0105241_10128930 3300009174 Bacteria 2045
144 Ga0105248_10226144 3300009177 Bacteria 2106
145 Ga0105237_10000571 3300009545 Bacteria 51560
146 Ga0105237_10027613 3300009545 Bacteria 5790
147 Ga0105237_10292670 3300009545 Bacteria 1631
148 Ga0105237_11198154 3300009545 Bacteria 766
149 Ga0105238_10025547 3300009551 Bacteria 6022
150 Ga0105238_10178881 3300009551 Bacteria 2098
151 Ga0105238_10210401 3300009551 Bacteria 1921
152 Ga0105238_10391525 3300009551 Bacteria 1382
153 Ga0105249_10017724 3300009553 Bacteria 6325
154 Ga0105249_11795905 3300009553 Bacteria 686
155 Ga0105148_101412 3300009978 Bacteria 1686
156 Ga0105028_121812 3300009993 Bacteria 696
157 Ga0105239_10026463 3300010375 Bacteria 6384
158 Ga0105239_10239874 3300010375 Bacteria 2035
159 Ga0105239_10458409 3300010375 Bacteria 1447
160 Ga0157318_1000417 3300012482 Bacteria 1790
161 Ga0157322_1044338 3300012490 Bacteria 521
162 Ga0157319_1005395 3300012497 Bacteria 879
163 Ga0157314_1003366 3300012500 Bacteria 1133
164 Ga0157315_1014045 3300012508 Bacteria 762
165 Ga0157316_1000058 3300012510 Bacteria 4676
166 Ga0157327_1000467 3300012512 Bacteria 2165
167 Ga0157373_10099643 3300013100 Bacteria 2045
168 Ga0157373_10114864 3300013100 Bacteria 1893
169 Ga0157371_10007365 3300013102 Bacteria 8918
170 Ga0157371_10074908 3300013102 Bacteria 2397
171 Ga0157371_11317952 3300013102 Bacteria 559
172 Ga0157370_10004895 3300013104 Bacteria 15182
173 Ga0157370_10005264 3300013104 Bacteria 14552
174 Ga0157369_10000025 3300013105 Bacteria 225515
175 Ga0157369_10039026 3300013105 Bacteria 5191
176 Ga0157369_10163907 3300013105 Bacteria 2345
177 Ga0157374_11005297 3300013296 Bacteria 853
178 Ga0163162_10032740 3300013306 Bacteria 5163
179 Ga0163162_12063065 3300013306 Bacteria 654
180 Ga0157372_10004340 3300013307 Bacteria 15147
181 Ga0157372_10017019 3300013307 Bacteria 7803
182 Ga0157372_10931684 3300013307 Bacteria 1007
183 Ga0157375_10060484 3300013308 Bacteria 3756
184 Ga0157375_10610965 3300013308 Bacteria 1249
185 Ga0157375_11404660 3300013308 Bacteria 822
186 Ga0157380_10847239 3300014326 Bacteria 935
187 Ga0182008_10036844 3300014497 Bacteria 2447
188 Ga0182008_10092856 3300014497 Bacteria 1489
189 Ga0157376_10041204 3300014969 Bacteria 3780
190 Ga0157376_10167451 3300014969 Bacteria 1998
191 Ga0182007_10005671 3300015262 Bacteria 5449
192 Ga0182007_10052561 3300015262 Bacteria 1342
193 Ga0183368_1003 3300015687 Bacteria 1276390
194 Ga0183360_10001 3300015689 Bacteria 3943671
195 Ga0206349_1350869 3300020075 Bacteria 562
196 Ga0206350_10084533 3300020080 Bacteria 694
197 Ga0206354_10481788 3300020081 Bacteria 1920
198 Ga0154015_1261614 3300020610 Bacteria 1093
199 Ga0224712_10255302 3300022467 Bacteria 811
200 Ga0224712_10306231 3300022467 Bacteria 744
201 Ga0209760_100358 3300025207 Bacteria 12608
202 Ga0209784_100068 3300025224 Bacteria 152526
203 Ga0209566_101255 3300025225 Bacteria 8599
204 Ga0209674_100012 3300025226 Bacteria 950162
205 Ga0209672_100058 3300025228 Bacteria 211992
206 Ga0209672_100791 3300025228 Bacteria 15090
207 Ga0209672_102029 3300025228 Bacteria 5553
208 Ga0207427_100033 3300025231 Bacteria 338459
209 Ga0207427_100156 3300025231 Bacteria 77311
210 Ga0207427_100312 3300025231 Bacteria 33663
211 Ga0207427_112102 3300025231 Bacteria 866
212 Ga0209437_100126 3300025233 Bacteria 192521
213 Ga0209437_100147 3300025233 Bacteria 161997
214 Ga0209437_100154 3300025233 Bacteria 153383
215 Ga0209437_100493 3300025233 Bacteria 28793
216 Ga0209437_115603 3300025233 Bacteria 1034
217 Ga0209258_100049 3300025242 Bacteria 358328
218 Ga0209258_100095 3300025242 Bacteria 223270
219 Ga0209258_100245 3300025242 Bacteria 100255
220 Ga0209258_100762 3300025242 Bacteria 20039
221 Ga0209258_105589 3300025242 Bacteria 2099
222 Ga0207425_1006543 3300025245 Bacteria 3175
223 Ga0207425_1071871 3300025245 Bacteria 591
224 Ga0209646_1000810 3300025246 Bacteria 10615
225 Ga0209646_1001694 3300025246 Bacteria 5613
226 Ga0209026_1000099 3300025250 Bacteria 161750
227 Ga0209026_1000140 3300025250 Bacteria 115081
228 Ga0209026_1000405 3300025250 Bacteria 38212
229 Ga0209026_1004452 3300025250 Bacteria 4140
230 Ga0209026_1004720 3300025250 Bacteria 3927
231 Ga0209148_1000002 3300025254 Bacteria 2399500
232 Ga0209148_1000010 3300025254 Bacteria 1265567
233 Ga0209148_1000039 3300025254 Bacteria 482479
234 Ga0209148_1000087 3300025254 Bacteria 260905
235 Ga0209759_1000316 3300025256 Bacteria 64846
236 Ga0209759_1000338 3300025256 Bacteria 61744
237 Ga0209759_1001070 3300025256 Bacteria 17937
238 Ga0209233_1000009 3300025261 Bacteria 1265567
239 Ga0209233_1000080 3300025261 Bacteria 338459
240 Ga0209233_1000092 3300025261 Bacteria 308668
241 Ga0209233_1016480 3300025261 Bacteria 2035
242 Ga0209233_1045019 3300025261 Bacteria 930
243 Ga0209565_1000005 3300025263 Bacteria 947317
244 Ga0209455_1000034 3300025272 Bacteria 483129
245 Ga0209455_1000086 3300025272 Bacteria 244650
246 Ga0209455_1017113 3300025272 Bacteria 1534
247 Ga0209673_1000011 3300025273 Bacteria 586604
248 Ga0209673_1018362 3300025273 Bacteria 2545
249 Ga0209130_1009349 3300025284 Bacteria 2803
250 Ga0209675_1000004 3300025291 Bacteria 947166
251 Ga0209675_1011075 3300025291 Bacteria 3016
252 Ga0209675_1017295 3300025291 Bacteria 2063
253 Ga0209675_1028531 3300025291 Bacteria 1355
254 Ga0209676_1000540 3300025292 Bacteria 58505
255 Ga0209676_1011200 3300025292 Bacteria 3643
256 Ga0209676_1012303 3300025292 Bacteria 3376
257 Ga0209676_1013870 3300025292 Bacteria 3069
258 Ga0209676_1019284 3300025292 Bacteria 2349
259 Ga0209676_1085599 3300025292 Bacteria 706
260 Ga0209025_1000884 3300025294 Bacteria 46917
261 Ga0209025_1030854 3300025294 Bacteria 2553
262 Ga0209025_1065705 3300025294 Bacteria 1323
263 Ga0209564_1000018 3300025295 Bacteria 586913
264 Ga0209564_1018435 3300025295 Bacteria 2659
265 Ga0209564_1019857 3300025295 Bacteria 2489
266 Ga0209758_1021433 3300025297 Bacteria 3012
267 Ga0209758_1097097 3300025297 Bacteria 848
268 Ga0209050_1001358 3300025298 Bacteria 26798
269 Ga0209050_1018102 3300025298 Bacteria 2759
270 Ga0209256_1000021 3300025299 Bacteria 537097
271 Ga0209256_1003298 3300025299 Bacteria 11510
272 Ga0209256_1004157 3300025299 Bacteria 9342
273 Ga0209256_1007202 3300025299 Bacteria 5574
274 Ga0209051_1012905 3300025303 Bacteria 4010
275 Ga0209257_1000133 3300025304 Bacteria 208808
276 Ga0209257_1000789 3300025304 Bacteria 46344
277 Ga0209257_1013716 3300025304 Bacteria 3566
278 Ga0209257_1014558 3300025304 Bacteria 3368
279 Ga0209257_1023789 3300025304 Bacteria 2141
280 Ga0209257_1080118 3300025304 Bacteria 840
281 Ga0207647_10007462 3300025904 Bacteria 7899
282 Ga0207705_10247456 3300025909 Bacteria 1359
283 Ga0207695_10001580 3300025913 Bacteria 37116
284 Ga0207695_10028459 3300025913 Bacteria 6196
285 Ga0207695_10245998 3300025913 Bacteria 1688
286 Ga0207671_10002240 3300025914 Bacteria 20934
287 Ga0207671_10002742 3300025914 Bacteria 18408
288 Ga0207671_10148435 3300025914 Bacteria 1810
289 Ga0207671_11269905 3300025914 Bacteria 574
290 Ga0207693_11079434 3300025915 Bacteria 610
291 Ga0207660_10156376 3300025917 Bacteria 1755
292 Ga0207660_10496311 3300025917 Bacteria 990
293 Ga0207657_10030861 3300025919 Bacteria 4858
294 Ga0207652_10121641 3300025921 Bacteria 2323
295 Ga0207652_10441252 3300025921 Bacteria 1173
296 Ga0207652_10540100 3300025921 Bacteria 1048
297 Ga0207681_10004298 3300025923 Bacteria 8793
298 Ga0207694_10012352 3300025924 Bacteria 6434
299 Ga0207694_10041563 3300025924 Bacteria 3543
300 Ga0207694_10067225 3300025924 Bacteria 2797
301 Ga0207694_10500640 3300025924 Bacteria 1017
302 Ga0207650_10268876 3300025925 Bacteria 1385
303 Ga0207659_10154460 3300025926 Bacteria 1795
304 Ga0207659_10400028 3300025926 Bacteria 1148
305 Ga0207687_11118190 3300025927 Bacteria 677
306 Ga0207687_11673743 3300025927 Bacteria 545
307 Ga0207700_10000795 3300025928 Bacteria 18225
308 Ga0207664_10043143 3300025929 Bacteria 3526
309 Ga0207644_10115377 3300025931 Bacteria 2037
310 Ga0207644_10674058 3300025931 Bacteria 861
311 Ga0207690_11086392 3300025932 Bacteria 667
312 Ga0207706_10155232 3300025933 Bacteria 2013
313 Ga0207706_10203588 3300025933 Bacteria 1736
314 Ga0207670_10040564 3300025936 Bacteria 3056
315 Ga0207665_10645704 3300025939 Bacteria 829
316 Ga0207691_10001528 3300025940 Bacteria 23015
317 Ga0207691_10023348 3300025940 Bacteria 5822
318 Ga0207691_10273987 3300025940 Bacteria 1453
319 Ga0207691_10631423 3300025940 Bacteria 906
320 Ga0207711_10036599 3300025941 Bacteria 4165
321 Ga0207689_10080614 3300025942 Bacteria 2675
322 Ga0207689_10201100 3300025942 Bacteria 1644
323 Ga0207679_10088910 3300025945 Bacteria 2383
324 Ga0207679_10120196 3300025945 Bacteria 2090
325 Ga0207667_10015765 3300025949 Bacteria 8569
326 Ga0207667_10349651 3300025949 Bacteria 1508
327 Ga0207667_10424542 3300025949 Bacteria 1352
328 Ga0207651_10262039 3300025960 Bacteria 1420
329 Ga0207712_10008296 3300025961 Bacteria 6567
330 Ga0207712_11488316 3300025961 Bacteria 606
331 Ga0207668_10718966 3300025972 Bacteria 879
332 Ga0207640_10788486 3300025981 Bacteria 822
333 Ga0207658_10104913 3300025986 Bacteria 2222
334 Ga0207677_10521302 3300026023 Bacteria 1031
335 Ga0207639_10011760 3300026041 Bacteria 6088
336 Ga0207639_10056707 3300026041 Bacteria 3003
337 Ga0207639_10390987 3300026041 Bacteria 1251
338 Ga0207678_10009769 3300026067 Bacteria 8438
339 Ga0207678_10026991 3300026067 Bacteria 5008
340 Ga0207678_10166714 3300026067 Bacteria 1881
341 Ga0207702_10000438 3300026078 Bacteria 47495
342 Ga0207641_10558595 3300026088 Bacteria 1117
343 Ga0207641_10621727 3300026088 Bacteria 1059
344 Ga0207648_10010388 3300026089 Bacteria 8826
345 Ga0207648_10180222 3300026089 Bacteria 1870
346 Ga0207648_10270806 3300026089 Bacteria 1517
347 Ga0207676_10328956 3300026095 Bacteria 1406
348 Ga0207676_10988183 3300026095 Bacteria 829
349 Ga0207674_10208622 3300026116 Bacteria 1903
350 Ga0207675_100234700 3300026118 Bacteria 1771
351 Ga0207675_102437747 3300026118 Bacteria 535
352 Ga0209973_1011588 3300027252 Bacteria 1060
353 Ga0209969_1001294 3300027360 Bacteria 3442
354 Ga0209967_1025959 3300027364 Bacteria 868
355 Ga0209984_1003704 3300027424 Bacteria 1763
356 Ga0210000_1026369 3300027462 Bacteria 901
357 Ga0209968_1026076 3300027526 Bacteria 965
358 Ga0209999_1007295 3300027543 Bacteria 1988
359 Ga0209982_1001664 3300027552 Bacteria 3057
360 Ga0209983_1000584 3300027665 Bacteria 7872
361 Ga0209974_10000815 3300027876 Bacteria 10692
362 Ga0209974_10037703 3300027876 Bacteria 1605
363 Ga0268266_12019055 3300028379 Bacteria 550
364 Ga0268265_10080583 3300028380 Bacteria 2568
365 Ga0268265_10306665 3300028380 Bacteria 1432
366 Ga0268264_10191216 3300028381 Bacteria 1866
367 Ga0316183_1048983 3300030742 Bacteria 1143
368 Ga0307408_100073637 3300031548 Bacteria 2532
369 Ga0307408_100114033 3300031548 Bacteria 2081
370 Ga0307408_100250893 3300031548 Bacteria 1459
371 Ga0307408_100450388 3300031548 Bacteria 1116
372 Ga0307408_100622905 3300031548 Bacteria 961
373 Ga0307408_100851347 3300031548 Bacteria 831
374 Ga0307408_100870325 3300031548 Bacteria 823
375 Ga0307408_101196351 3300031548 Bacteria 709
376 Ga0307408_101454013 3300031548 Bacteria 647
377 Ga0307405_10056250 3300031731 Bacteria 2466
378 Ga0307405_10287559 3300031731 Bacteria 1241
379 Ga0307405_10586726 3300031731 Bacteria 907
380 Ga0307405_10915269 3300031731 Bacteria 743
381 Ga0307405_11832863 3300031731 Bacteria 540
382 Ga0307413_10006235 3300031824 Bacteria 5415
383 Ga0307413_10162073 3300031824 Bacteria 1572
384 Ga0307413_10218818 3300031824 Bacteria 1389
385 Ga0307413_10480378 3300031824 Bacteria 993
386 Ga0307413_10480504 3300031824 Bacteria 993
387 Ga0307413_10532066 3300031824 Bacteria 950
388 Ga0307413_11242313 3300031824 Bacteria 649
389 Ga0307410_10041682 3300031852 Bacteria 3028
390 Ga0307410_10055302 3300031852 Bacteria 2694
391 Ga0307410_10851731 3300031852 Bacteria 778
392 Ga0307410_11367064 3300031852 Bacteria 621
393 Ga0307406_10000838 3300031901 Bacteria 17266
394 Ga0307406_11005784 3300031901 Bacteria 715
395 Ga0307407_10620350 3300031903 Bacteria 807
396 Ga0307412_10028574 3300031911 Bacteria 3490
397 Ga0307412_10326529 3300031911 Bacteria 1223
398 Ga0307412_11157103 3300031911 Bacteria 691
399 Ga0307409_100633578 3300031995 Bacteria 1061
400 Ga0307409_100862034 3300031995 Bacteria 917
401 Ga0307416_101752396 3300032002 Bacteria 725
402 Ga0307414_10001544 3300032004 Bacteria 11959
403 Ga0307414_10023667 3300032004 Bacteria 3900
404 Ga0307414_10033019 3300032004 Bacteria 3415
405 Ga0307414_10049413 3300032004 Bacteria 2908
406 Ga0307414_10109834 3300032004 Bacteria 2096
407 Ga0307414_10121773 3300032004 Bacteria 2007
408 Ga0307414_10124384 3300032004 Bacteria 1989
409 Ga0307414_10135860 3300032004 Bacteria 1917
410 Ga0307414_10183629 3300032004 Bacteria 1685
411 Ga0307414_10231277 3300032004 Bacteria 1524
412 Ga0307414_10244630 3300032004 Bacteria 1487
413 Ga0307414_10302621 3300032004 Bacteria 1353
414 Ga0307414_10443970 3300032004 Bacteria 1136
415 Ga0307414_10883857 3300032004 Bacteria 818
416 Ga0307411_10032321 3300032005 Bacteria 3231
417 Ga0307411_10053667 3300032005 Bacteria 2642
418 Ga0307411_10078395 3300032005 Bacteria 2265
419 Ga0307411_10104647 3300032005 Bacteria 2010
420 Ga0307411_10416301 3300032005 Bacteria 1115
421 Ga0307411_10465419 3300032005 Bacteria 1061
422 Ga0307411_10749412 3300032005 Bacteria 855
423 Ga0307415_100198063 3300032126 Bacteria 1591
424 Ga0307415_101022260 3300032126 Bacteria 769
425 Ga0373936_0206284 3300035113 Bacteria 869
426 Ga0395899_0000175 3300037312 Bacteria 95781
427 Ga0395899_0010682 3300037312 Bacteria 7037
428 Ga0395899_0020288 3300037312 Bacteria 5042
429 Ga0395899_0046819 3300037312 Bacteria 3220
430 Ga0395899_0106492 3300037312 Bacteria 2019
431 Ga0395899_0309338 3300037312 Bacteria 1067
432 Ga0395900_0000012 3300037418 Bacteria 401198
433 Ga0395900_0001866 3300037418 Bacteria 23992
434 Ga0395900_0060477 3300037418 Bacteria 3898
435 Ga0395900_0090150 3300037418 Bacteria 3151
436 Ga0395900_0095564 3300037418 Bacteria 3053
437 Ga0395898_0000034 3300037466 Bacteria 356745
438 Ga0395898_0005801 3300037466 Bacteria 13281
439 Ga0395898_0085697 3300037466 Bacteria 3036
440 Ga0395898_0091058 3300037466 Bacteria 2934
441 Ga0395898_0232327 3300037466 Bacteria 1759
442 Ga0395898_0965243 3300037466 Bacteria 789
443 Ga0395905_0001903 3300037471 Bacteria 24042
444 Ga0395905_0018529 3300037471 Bacteria 6607
445 Ga0395905_0066951 3300037471 Bacteria 3364
446 Ga0395905_0325484 3300037471 Bacteria 1427
447 Ga0395901_0015436 3300038443 Bacteria 7778
448 Ga0395901_0025292 3300038443 Bacteria 6094
449 Ga0395901_0030232 3300038443 Bacteria 5581
450 Ga0395901_0035285 3300038443 Bacteria 5166
451 Ga0395901_0057799 3300038443 Bacteria 4034
452 Ga0395901_0062194 3300038443 Bacteria 3885
453 Ga0395901_0384181 3300038443 Bacteria 1445
454 Ga0395901_0859096 3300038443 Bacteria 892
455 Ga0395901_0889251 3300038443 Bacteria 873
456 Ga0395901_1158621 3300038443 Bacteria 741
457 Ga0237816_00654 3300039145 Bacteria 2924
458 Ga0439436_0010415 3300041404 Bacteria 2836
459 Ga0439436_0062084 3300041404 Bacteria 1045
460 Ga0439447_007822 3300041407 Bacteria 3354
461 Ga0439465_0007729 3300041413 Bacteria 3411
462 Ga0451797_0106627 3300041453 Bacteria 830
463 Ga0451797_1394323 3300041453 Bacteria 1203
464 Ga0451837_0995902 3300041494 Bacteria 571
465 Ga0451837_1008743 3300041494 Bacteria 868
466 Ga0451837_1184456 3300041494 Bacteria 1718
467 Ga0451837_1827009 3300041494 Bacteria 2005
468 Ga0451843_0787379 3300041509 Bacteria 817
469 Ga0451843_1729097 3300041509 Bacteria 1031
470 Ga0451853_2956181 3300041512 Bacteria 1157
471 Ga0439433_0034637 3300041999 Bacteria 1163
472 Ga0439433_0061063 3300041999 Bacteria 899
473 Ga0439437_000407 3300042000 Bacteria 4160
474 Ga0439448_0077191 3300042005 Bacteria 1115
475 Ga0439432_012921 3300042006 Bacteria 2843
476 Ga0439432_044056 3300042006 Bacteria 1406
477 Ga0439432_192006 3300042006 Bacteria 593
478 Ga0439457_030795 3300042014 Bacteria 1190
479 Ga0439462_0071525 3300042015 Bacteria 942
480 Ga0466969_0011308 3300044656 Bacteria 4725
481 Ga0466975_0103111 3300044661 Bacteria 2029
482 Ga0466965_0000618 3300044683 Bacteria 12967
483 Ga0466966_0008750 3300044684 Bacteria 6701
484 Ga0466966_0617742 3300044684 Bacteria 653
485 Ga0466961_0003439 3300044693 Bacteria 9873
486 Ga0466961_0007714 3300044693 Bacteria 6851
487 Ga0466961_0016522 3300044693 Bacteria 4741
488 Ga0466963_0111863 3300044694 Bacteria 1875
489 Ga0466963_0827751 3300044694 Bacteria 653
490 Ga0453684_0000136 3300044712 Bacteria 323402
491 Ga0466971_0039815 3300044719 Bacteria 2110
492 Ga0466971_0048443 3300044719 Bacteria 1910
493 Ga0466970_0008881 3300044765 Bacteria 5067
494 Ga0466957_0006427 3300044842 Bacteria 6637
495 Ga0466957_0007212 3300044842 Bacteria 6283
496 Ga0466959_0000068 3300045049 Bacteria 73132
497 Ga0466959_0004901 3300045049 Bacteria 9062
498 Ga0466959_0014419 3300045049 Bacteria 5741
499 Ga0451576_0000025 3300045051 Bacteria 427980
500 Ga0466958_0020415 3300045836 Bacteria 3862
501 Ga0466958_0392664 3300045836 Bacteria 895
502 Ga0466967_0151829 3300045976 Bacteria 2166
503 Ga0466967_0158947 3300045976 Bacteria 2120
504 Ga0466967_0393216 3300045976 Bacteria 1348
505 Ga0495638_0000777 3300046460 Bacteria 33705
506 Ga0495638_0001254 3300046460 Bacteria 23874
507 Ga0495638_0103243 3300046460 Bacteria 1702
508 Ga0495650_0000585 3300046471 Bacteria 50650
509 Ga0495580_0221350 3300046472 Bacteria 1301
510 Ga0495662_0180376 3300046476 Bacteria 1041
511 Ga0495606_0001787 3300046507 Bacteria 27393
512 Ga0495663_0019883 3300046525 Bacteria 1925
513 Ga0495663_0045408 3300046525 Bacteria 1347
514 Ga0495665_0183146 3300046531 Bacteria 1088
515 Ga0495598_0010004 3300046537 Bacteria 2259
516 Ga0495621_0026389 3300046539 Bacteria 1959
517 Ga0495621_0058286 3300046539 Bacteria 1396
518 Ga0495621_0133998 3300046539 Bacteria 965
519 Ga0495656_0002244 3300046615 Bacteria 6390
520 Ga0495656_0003850 3300046615 Bacteria 5105
521 Ga0495668_0016123 3300046616 Bacteria 4347
522 Ga0495625_0048972 3300046660 Bacteria 3039
523 Ga0495625_0113616 3300046660 Bacteria 1849
524 Ga0495659_0017172 3300046664 Bacteria 2394
525 Ga0495657_0147701 3300046675 Bacteria 1461
526 Ga0495670_0066868 3300046691 Bacteria 1814
527 Ga0495670_0157942 3300046691 Bacteria 1191
528 Ga0495649_0212679 3300046694 Bacteria 1001
529 Ga0495636_0003450 3300047318 Bacteria 6134
530 Ga0495636_0008301 3300047318 Bacteria 4100
531 Ga0495636_0039930 3300047318 Bacteria 1944
532 Ga0495636_0180588 3300047318 Bacteria 957
533 Ga0496101_0184440 3300048904 Bacteria 1608
534 Ga0496102_0130233 3300048905 Bacteria 2354
535 Ga0496103_0244812 3300048906 Bacteria 1154
536 Ga0496104_0114648 3300048907 Bacteria 2585
537 Ga0496106_0093946 3300048909 Bacteria 2318
538 Ga0496107_0026716 3300048910 Bacteria 4095
539 Ga0496108_0124856 3300048911 Bacteria 2209
540 Ga0496108_0292930 3300048911 Bacteria 1417
541 Ga0496109_0173044 3300048912 Bacteria 2026
542 Ga0496109_0248805 3300048912 Bacteria 1674
543 Ga0496109_0287764 3300048912 Bacteria 1549
544 Ga0496109_0344459 3300048912 Bacteria 1407
545 Ga0496109_1520390 3300048912 Bacteria 604
546 Ga0496110_0490866 3300048913 Bacteria 1118
547 Ga0496111_0034807 3300048914 Bacteria 3597
548 Ga0496112_0053094 3300048915 Bacteria 3979
549 Ga0496112_0560021 3300048915 Bacteria 1077
550 Ga0496113_0047904 3300048916 Bacteria 3178
551 Ga0496113_0107861 3300048916 Bacteria 2164
552 Ga0496113_0264778 3300048916 Bacteria 1373
553 Ga0496114_0084162 3300048917 Bacteria 2693
554 Ga0496114_0243016 3300048917 Bacteria 1583
555 Ga0496114_0816454 3300048917 Bacteria 812
556 Ga0496115_0000025 3300048918 Bacteria 151658
557 Ga0496116_0067346 3300048919 Bacteria 2287
558 Ga0496121_0013431 3300048924 Bacteria 8797
559 Ga0496124_0068670 3300048927 Bacteria 2945
560 Ga0496126_0050642 3300048929 Bacteria 3783
561 Ga0496126_0378088 3300048929 Bacteria 1153
562 Ga0495678_077392 3300049459 Bacteria 1203
563 Ga0501300_002974 3300049523 Bacteria 2530
564 Ga0501315_057022 3300049531 Bacteria 625
565 Ga0501031_0051651 3300049568 Bacteria 2678
566 Ga0501031_0115683 3300049568 Bacteria 1752
567 Ga0501031_0367826 3300049568 Bacteria 930
568 Ga0501032_0020338 3300049569 Bacteria 4624
569 Ga0501032_0043565 3300049569 Bacteria 3038
570 Ga0501032_0055322 3300049569 Bacteria 2669
571 Ga0501033_0002653 3300049570 Bacteria 15039
572 Ga0501033_0003817 3300049570 Bacteria 12258
573 Ga0501033_0006298 3300049570 Bacteria 9302
574 Ga0501033_0010579 3300049570 Bacteria 7073
575 Ga0501033_0201162 3300049570 Bacteria 1423
576 Ga0501034_0000316 3300049571 Bacteria 85497
577 Ga0501034_0006586 3300049571 Bacteria 12463
578 Ga0501034_0034699 3300049571 Bacteria 5115
579 Ga0501034_0168938 3300049571 Bacteria 2155
580 Ga0501034_0612272 3300049571 Bacteria 994
581 Ga0501036_0124359 3300049572 Bacteria 2178
582 Ga0501037_0012036 3300049573 Bacteria 6371
583 Ga0501037_0033754 3300049573 Bacteria 3778
584 Ga0501037_0619400 3300049573 Bacteria 725
585 Ga0501037_0638977 3300049573 Bacteria 712
586 Ga0501038_0016339 3300049574 Bacteria 6728
587 Ga0501038_0017969 3300049574 Bacteria 6387
588 Ga0501038_0025770 3300049574 Bacteria 5239
589 Ga0501039_0301346 3300049575 Bacteria 1260
590 Ga0501043_0019326 3300049579 Bacteria 5348
591 Ga0501043_0047547 3300049579 Bacteria 3373
592 Ga0501043_0067412 3300049579 Bacteria 2810
593 Ga0501043_0438180 3300049579 Bacteria 983
594 Ga0501046_0033119 3300049580 Bacteria 4178
595 Ga0501046_0573545 3300049580 Bacteria 802
596 Ga0501046_1032974 3300049580 Bacteria 570
597 Ga0501047_0010880 3300049581 Bacteria 8602
598 Ga0501047_0015109 3300049581 Bacteria 7350
599 Ga0501047_0079026 3300049581 Bacteria 3163
600 Ga0501047_0203150 3300049581 Bacteria 1842
601 Ga0501048_0031705 3300049582 Bacteria 3822
602 Ga0501070_0008880 3300049586 Bacteria 8495
603 Ga0501070_0387426 3300049586 Bacteria 1132
604 Ga0501071_0235342 3300049587 Bacteria 1380
605 Ga0501073_0055773 3300049589 Bacteria 2764
606 Ga0501074_0190666 3300049590 Bacteria 1462
607 Ga0501077_0133414 3300049593 Bacteria 1575
608 Ga0501202_011902 3300049652 Bacteria 1635
609 Ga0501207_105852 3300049654 Bacteria 570
610 Ga0501216_005920 3300049660 Bacteria 1859
611 Ga0501217_044793 3300049661 Bacteria 1138
612 Ga0501223_058177 3300049663 Bacteria 753
613 Ga0501227_089745 3300049665 Bacteria 811
614 Ga0501250_017217 3300049680 Bacteria 905
615 Ga0501251_033642 3300049681 Bacteria 744
616 Ga0501225_0172189 3300049705 Bacteria 672
617 Ga0501245_028707 3300049708 Bacteria 909
618 Ga0501080_0004656 3300049742 Bacteria 12233
619 Ga0501241_086307 3300049758 Bacteria 659
620 Ga0501265_000627 3300049762 Bacteria 3817
621 Ga0501266_002927 3300049763 Bacteria 2131
622 Ga0501268_006804 3300049765 Bacteria 1690
623 Ga0501272_040209 3300049769 Bacteria 622
624 Ga0501275_000601 3300049772 Bacteria 3962
625 Ga0501275_064389 3300049772 Bacteria 565
626 Ga0501035_0016076 3300049822 Bacteria 6905
627 Ga0501035_0051346 3300049822 Bacteria 3692
628 Ga0501035_0150557 3300049822 Bacteria 2019
629 Ga0501035_0199183 3300049822 Bacteria 1718
630 Ga0501035_0675937 3300049822 Bacteria 835
631 Ga0501044_0010948 3300049823 Bacteria 9845
632 Ga0501044_0013956 3300049823 Bacteria 8680
633 Ga0501044_0043955 3300049823 Bacteria 4639
634 Ga0501044_0126540 3300049823 Bacteria 2552
635 Ga0501044_0714542 3300049823 Bacteria 886
636 Ga0501044_0862009 3300049823 Bacteria 782
637 nmdc:mga00v17_209482_c1 3300050491 Bacteria 1261
638 nmdc:mga00v17_57252_c1 3300050491 Bacteria 2385
639 Ga0466962_0001366 3300061719 Bacteria 11299

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100410383 Ga0070670_1004103831 119
2 3300005335 Ga0070666_11254084 Ga0070666_112540841 119
3 3300005439 Ga0070711_100381287 Ga0070711_1003812871 119
4 3300005539 Ga0068853_100230007 Ga0068853_1002300072 119
5 3300005548 Ga0070665_100785140 Ga0070665_1007851402 119
6 3300009174 Ga0105241_10021514 Ga0105241_100215143 119
7 3300009545 Ga0105237_10027613 Ga0105237_100276132 119
8 3300009553 Ga0105249_10017724 Ga0105249_100177245 119
9 3300010375 Ga0105239_10026463 Ga0105239_100264635 119
10 3300013105 Ga0157369_10000025 Ga0157369_10000025195 119
11 3300022467 Ga0224712_10306231 Ga0224712_103062311 119
12 3300025913 Ga0207695_10001580 Ga0207695_1000158024 119
13 3300025914 Ga0207671_10002240 Ga0207671_100022405 119
14 3300025924 Ga0207694_10012352 Ga0207694_100123522 119
15 3300025932 Ga0207690_11086392 Ga0207690_110863922 119
16 3300025949 Ga0207667_10349651 Ga0207667_103496512 119
17 3300025961 Ga0207712_10008296 Ga0207712_100082965 119
18 3300026041 Ga0207639_10390987 Ga0207639_103909872 119
19 3300028379 Ga0268266_12019055 Ga0268266_120190552 119
20 iso_pu_bacteria 2537561836 2538833047 119
21 iso_pu_bacteria 2643221562 2643830909 119
22 3300003763 Ga0055529_1006460 Ga0055529_10064601 120
23 3300005337 Ga0070682_100023162 Ga0070682_1000231622 120
24 3300005455 Ga0070663_100008950 Ga0070663_1000089503 120
25 3300005578 Ga0068854_100092621 Ga0068854_1000926212 120
26 3300009093 Ga0105240_10054282 Ga0105240_100542822 120
27 3300009148 Ga0105243_12480019 Ga0105243_124800192 120
28 3300013104 Ga0157370_10004895 Ga0157370_1000489513 120
29 3300049570 Ga0501033_0003817 Ga0501033_0003817_8685_9089 120
30 3300005614 Ga0068856_100000012 Ga0068856_10000001272 121
31 3300013105 Ga0157369_10039026 Ga0157369_100390262 121
32 3300020075 Ga0206349_1350869 Ga0206349_13508692 121
33 3300020080 Ga0206350_10084533 Ga0206350_100845332 121
34 3300020081 Ga0206354_10481788 Ga0206354_104817881 121
35 3300020610 Ga0154015_1261614 Ga0154015_12616142 121
36 3300022467 Ga0224712_10255302 Ga0224712_102553021 121
37 3300025913 Ga0207695_10245998 Ga0207695_102459983 121
38 3300025981 Ga0207640_10788486 Ga0207640_107884861 121
39 3300026067 Ga0207678_10009769 Ga0207678_100097697 121
40 3300026078 Ga0207702_10000438 Ga0207702_1000043813 121
41 3300031901 Ga0307406_10000838 Ga0307406_100008387 122
42 3300003316 rootH1_10005492 rootH1_100054922 123
43 3300005262 Ga0065165_1001244 Ga0065165_100124427 123
44 3300005337 Ga0070682_100003250 Ga0070682_1000032507 123
45 3300005366 Ga0070659_100150360 Ga0070659_1001503603 123
46 3300005437 Ga0070710_10007695 Ga0070710_100076955 123
47 3300005539 Ga0068853_100050055 Ga0068853_1000500554 123
48 3300005563 Ga0068855_100368953 Ga0068855_1003689532 123
49 3300009551 Ga0105238_10025547 Ga0105238_100255472 123
50 3300012510 Ga0157316_1000058 Ga0157316_10000582 123
51 3300013100 Ga0157373_10114864 Ga0157373_101148642 123
52 3300013102 Ga0157371_10007365 Ga0157371_100073657 123
53 3300013307 Ga0157372_10004340 Ga0157372_100043407 123
54 3300025924 Ga0207694_10041563 Ga0207694_100415634 123
55 3300025940 Ga0207691_10631423 Ga0207691_106314232 123
56 3300025949 Ga0207667_10015765 Ga0207667_100157657 123
57 3300026041 Ga0207639_10011760 Ga0207639_100117602 123
58 3300042000 Ga0439437_000407 Ga0439437_000407_2179_2556 123
59 3300042005 Ga0439448_0077191 Ga0439448_0077191_98_475 123
60 3300044712 Ga0453684_0000136 Ga0453684_0000136_106999_107376 123
61 3300045051 Ga0451576_0000025 Ga0451576_0000025_320515_320892 123
62 3300049571 Ga0501034_0006586 Ga0501034_0006586_1748_2125 123
63 3300049572 Ga0501036_0124359 Ga0501036_0124359_838_1215 123
64 3300049573 Ga0501037_0012036 Ga0501037_0012036_4546_4923 123
65 3300049593 Ga0501077_0133414 Ga0501077_0133414_484_861 123
66 3300049822 Ga0501035_0199183 Ga0501035_0199183_731_1108 123
67 3300049823 Ga0501044_0013956 Ga0501044_0013956_494_871 123
68 iso_pu_bacteria 2687453130 2687583379 123
69 3300002737 JGI25162J39368_1001962 JGI25162J39368_100196211 124
70 3300002737 JGI25162J39368_1002285 JGI25162J39368_10022853 124
71 3300002741 JGI25157J39369_1001483 JGI25157J39369_10014836 124
72 3300002772 JGI25164J39214_1000964 JGI25164J39214_10009642 124
73 3300003214 JGI25165J46597_1001786 JGI25165J46597_10017862 124
74 3300005364 Ga0070673_100137023 Ga0070673_1001370232 124
75 3300005435 Ga0070714_100056167 Ga0070714_1000561673 124
76 3300005436 Ga0070713_100002503 Ga0070713_1000025038 124
77 3300005578 Ga0068854_100203445 Ga0068854_1002034452 124
78 3300005841 Ga0068863_100894665 Ga0068863_1008946651 124
79 3300009551 Ga0105238_10178881 Ga0105238_101788813 124
80 3300009551 Ga0105238_10391525 Ga0105238_103915251 124
81 3300013104 Ga0157370_10005264 Ga0157370_100052648 124
82 3300014497 Ga0182008_10036844 Ga0182008_100368442 124
83 3300015262 Ga0182007_10005671 Ga0182007_100056716 124
84 3300025231 Ga0207427_100312 Ga0207427_10031237 124
85 3300025233 Ga0209437_100154 Ga0209437_10015436 124
86 3300025250 Ga0209026_1000405 Ga0209026_100040510 124
87 3300025261 Ga0209233_1000092 Ga0209233_1000092253 124
88 3300025297 Ga0209758_1097097 Ga0209758_10970972 124
89 3300025915 Ga0207693_11079434 Ga0207693_110794342 124
90 3300025924 Ga0207694_10500640 Ga0207694_105006402 124
91 3300025927 Ga0207687_11118190 Ga0207687_111181901 124
92 3300025928 Ga0207700_10000795 Ga0207700_100007953 124
93 3300025929 Ga0207664_10043143 Ga0207664_100431433 124
94 3300025931 Ga0207644_10674058 Ga0207644_106740582 124
95 3300026023 Ga0207677_10521302 Ga0207677_105213022 124
96 3300026067 Ga0207678_10166714 Ga0207678_101667142 124
97 3300026088 Ga0207641_10621727 Ga0207641_106217272 124
98 3300026116 Ga0207674_10208622 Ga0207674_102086223 124
99 3300041404 Ga0439436_0062084 Ga0439436_0062084_590_1027 124
100 3300041999 Ga0439433_0034637 Ga0439433_0034637_135_572 124
101 3300042006 Ga0439432_192006 Ga0439432_192006_68_505 124
102 3300048912 Ga0496109_0344459 Ga0496109_0344459_334_753 124
103 3300048915 Ga0496112_0560021 Ga0496112_0560021_214_633 124
104 3300048916 Ga0496113_0107861 Ga0496113_0107861_1034_1453 124
105 3300048927 Ga0496124_0068670 Ga0496124_0068670_2478_2897 124
106 iso_pu_bacteria 2643221559 2643818653 124
107 iso_pu_bacteria 2643221573 2643878304 124
108 iso_pu_bacteria 2643221586 2643940898 124
109 iso_pu_bacteria 2643221612 2644080056 124
110 iso_pu_bacteria 2643221720 2644659609 124
111 iso_pu_bacteria 2643221727 2644695652 124
112 iso_pu_bacteria 2643221728 2644700642 124
113 iso_pu_bacteria 8002869464 8002871743 124
114 3300005336 Ga0070680_100462949 Ga0070680_1004629491 125
115 3300005455 Ga0070663_100467095 Ga0070663_1004670952 125
116 3300005458 Ga0070681_10007152 Ga0070681_100071527 125
117 3300005530 Ga0070679_100023990 Ga0070679_1000239906 125
118 3300005546 Ga0070696_100004581 Ga0070696_1000045812 125
119 3300005563 Ga0068855_100101644 Ga0068855_1001016443 125
120 3300009545 Ga0105237_10000571 Ga0105237_100005712 125
121 3300025909 Ga0207705_10247456 Ga0207705_102474562 125
122 3300025914 Ga0207671_10002742 Ga0207671_1000274215 125
123 3300025917 Ga0207660_10156376 Ga0207660_101563762 125
124 3300025921 Ga0207652_10121641 Ga0207652_101216412 125
125 3300037471 Ga0395905_0018529 Ga0395905_0018529_3619_4005 125
126 3300038443 Ga0395901_1158621 Ga0395901_1158621_90_482 125
127 3300049568 Ga0501031_0115683 Ga0501031_0115683_278_664 125
128 3300049569 Ga0501032_0020338 Ga0501032_0020338_1698_2084 125
129 3300049570 Ga0501033_0201162 Ga0501033_0201162_722_1108 125
130 3300049571 Ga0501034_0168938 Ga0501034_0168938_970_1356 125
131 3300049579 Ga0501043_0047547 Ga0501043_0047547_2087_2473 125
132 3300049580 Ga0501046_0033119 Ga0501046_0033119_1409_1795 125
133 3300049822 Ga0501035_0675937 Ga0501035_0675937_82_468 125
134 iso_pu_bacteria 2571042365 2572255332 125
135 iso_pu_bacteria 2643221695 2644529864 125
136 iso_pu_bacteria 2919513703 2919516700 125
137 iso_pu_bacteria 2919675420 2919677166 125
138 iso_pu_bacteria 8003014200 8003016381 125
139 3300005355 Ga0070671_100300204 Ga0070671_1003002042 126
140 3300009177 Ga0105248_10226144 Ga0105248_102261442 126
141 3300009545 Ga0105237_11198154 Ga0105237_111981542 126
142 3300027252 Ga0209973_1011588 Ga0209973_10115883 126
143 3300027360 Ga0209969_1001294 Ga0209969_10012943 126
144 3300027364 Ga0209967_1025959 Ga0209967_10259593 126
145 3300027424 Ga0209984_1003704 Ga0209984_10037042 126
146 3300027462 Ga0210000_1026369 Ga0210000_10263693 126
147 3300027526 Ga0209968_1026076 Ga0209968_10260762 126
148 3300027543 Ga0209999_1007295 Ga0209999_10072953 126
149 3300027552 Ga0209982_1001664 Ga0209982_10016648 126
150 3300027665 Ga0209983_1000584 Ga0209983_100058410 126
151 3300027876 Ga0209974_10000815 Ga0209974_100008159 126
152 3300031548 Ga0307408_100870325 Ga0307408_1008703251 126
153 3300037312 Ga0395899_0309338 Ga0395899_0309338_269_655 126
154 3300037418 Ga0395900_0060477 Ga0395900_0060477_2279_2665 126
155 3300037466 Ga0395898_0965243 Ga0395898_0965243_99_485 126
156 3300037471 Ga0395905_0001903 Ga0395905_0001903_14346_14732 126
157 3300038443 Ga0395901_0015436 Ga0395901_0015436_1444_1830 126
158 3300038443 Ga0395901_0859096 Ga0395901_0859096_29_415 126
159 3300048911 Ga0496108_0124856 Ga0496108_0124856_166_552 126
160 3300048912 Ga0496109_0173044 Ga0496109_0173044_1121_1507 126
161 3300048915 Ga0496112_0053094 Ga0496112_0053094_3555_3941 126
162 3300048916 Ga0496113_0264778 Ga0496113_0264778_756_1142 126
163 3300049571 Ga0501034_0034699 Ga0501034_0034699_1163_1546 126
164 3300049580 Ga0501046_1032974 Ga0501046_1032974_128_511 126
165 3300049581 Ga0501047_0203150 Ga0501047_0203150_823_1206 126
166 iso_pu_bacteria 2894414249 2894416421 126
167 3300002705 JGI25156J39149_1004997 JGI25156J39149_10049972 127
168 3300002705 JGI25156J39149_1045019 JGI25156J39149_10450191 127
169 3300002737 JGI25162J39368_1002410 JGI25162J39368_10024108 127
170 3300002741 JGI25157J39369_1001104 JGI25157J39369_100110411 127
171 3300002741 JGI25157J39369_1002835 JGI25157J39369_10028352 127
172 3300002772 JGI25164J39214_1000035 JGI25164J39214_100003553 127
173 3300003214 JGI25165J46597_1000226 JGI25165J46597_100022642 127
174 3300003760 Ga0055527_1003185 Ga0055527_10031852 127
175 3300003761 Ga0055535_1000810 Ga0055535_10008109 127
176 3300003762 Ga0055542_1000522 Ga0055542_100052225 127
177 3300003763 Ga0055529_1000367 Ga0055529_100036730 127
178 3300005618 Ga0068864_100073009 Ga0068864_1000730092 127
179 3300005844 Ga0068862_100877032 Ga0068862_1008770322 127
180 3300012500 Ga0157314_1003366 Ga0157314_10033662 127
181 3300014326 Ga0157380_10847239 Ga0157380_108472392 127
182 3300025228 Ga0209672_100058 Ga0209672_100058179 127
183 3300025231 Ga0207427_100033 Ga0207427_100033101 127
184 3300025233 Ga0209437_100493 Ga0209437_1004932 127
185 3300025242 Ga0209258_100095 Ga0209258_10009543 127
186 3300025246 Ga0209646_1001694 Ga0209646_10016946 127
187 3300025250 Ga0209026_1000140 Ga0209026_10001404 127
188 3300025250 Ga0209026_1004720 Ga0209026_10047202 127
189 3300025254 Ga0209148_1000039 Ga0209148_1000039255 127
190 3300025256 Ga0209759_1000338 Ga0209759_10003383 127
191 3300025256 Ga0209759_1001070 Ga0209759_10010704 127
192 3300025261 Ga0209233_1000080 Ga0209233_1000080101 127
193 3300025272 Ga0209455_1000034 Ga0209455_1000034256 127
194 3300025939 Ga0207665_10645704 Ga0207665_106457042 127
195 3300026095 Ga0207676_10328956 Ga0207676_103289562 127
196 3300031548 Ga0307408_100114033 Ga0307408_1001140332 127
197 3300031548 Ga0307408_101196351 Ga0307408_1011963512 127
198 3300031731 Ga0307405_10056250 Ga0307405_100562503 127
199 3300031824 Ga0307413_10006235 Ga0307413_100062354 127
200 3300031824 Ga0307413_10480378 Ga0307413_104803782 127
201 3300031852 Ga0307410_10041682 Ga0307410_100416826 127
202 3300032004 Ga0307414_10124384 Ga0307414_101243842 127
203 3300032005 Ga0307411_10053667 Ga0307411_100536673 127
204 3300032005 Ga0307411_10465419 Ga0307411_104654191 127
205 3300032126 Ga0307415_100198063 Ga0307415_1001980632 127
206 3300041453 Ga0451797_0106627 Ga0451797_0106627_79_471 127
207 3300041509 Ga0451843_0787379 Ga0451843_0787379_337_729 127
208 3300041509 Ga0451843_1729097 Ga0451843_1729097_63_449 127
209 3300048904 Ga0496101_0184440 Ga0496101_0184440_473_889 127
210 3300048906 Ga0496103_0244812 Ga0496103_0244812_500_919 127
211 3300048910 Ga0496107_0026716 Ga0496107_0026716_2272_2691 127
212 3300048912 Ga0496109_0248805 Ga0496109_0248805_253_642 127
213 3300048913 Ga0496110_0490866 Ga0496110_0490866_527_946 127
214 3300048914 Ga0496111_0034807 Ga0496111_0034807_177_593 127
215 3300048917 Ga0496114_0243016 Ga0496114_0243016_172_591 127
216 3300049568 Ga0501031_0051651 Ga0501031_0051651_2280_2666 127
217 3300049570 Ga0501033_0002653 Ga0501033_0002653_5152_5538 127
218 3300049660 Ga0501216_005920 Ga0501216_005920_956_1348 127
219 3300049680 Ga0501250_017217 Ga0501250_017217_397_789 127
220 3300049708 Ga0501245_028707 Ga0501245_028707_40_432 127
221 3300049763 Ga0501266_002927 Ga0501266_002927_926_1318 127
222 3300049769 Ga0501272_040209 Ga0501272_040209_15_407 127
223 iso_pu_bacteria 2941489479 2941493381 127
224 iso_pu_bacteria 2995948881 2995952521 127
225 3300003761 Ga0055535_1000642 Ga0055535_100064218 128
226 3300003762 Ga0055542_1000442 Ga0055542_100044226 128
227 3300005289 Ga0065704_10465274 Ga0065704_104652742 128
228 3300005339 Ga0070660_100873260 Ga0070660_1008732602 128
229 3300005343 Ga0070687_100669774 Ga0070687_1006697742 128
230 3300005355 Ga0070671_100170561 Ga0070671_1001705612 128
231 3300005364 Ga0070673_100186066 Ga0070673_1001860663 128
232 3300005457 Ga0070662_100153509 Ga0070662_1001535093 128
233 3300005459 Ga0068867_100152093 Ga0068867_1001520932 128
234 3300005543 Ga0070672_100283428 Ga0070672_1002834282 128
235 3300005844 Ga0068862_100037406 Ga0068862_1000374062 128
236 3300012512 Ga0157327_1000467 Ga0157327_10004672 128
237 3300013100 Ga0157373_10099643 Ga0157373_100996433 128
238 3300025228 Ga0209672_102029 Ga0209672_1020294 128
239 3300025242 Ga0209258_100245 Ga0209258_10024525 128
240 3300025254 Ga0209148_1000087 Ga0209148_100008765 128
241 3300025272 Ga0209455_1017113 Ga0209455_10171133 128
242 3300025926 Ga0207659_10154460 Ga0207659_101544602 128
243 3300025931 Ga0207644_10115377 Ga0207644_101153773 128
244 3300025933 Ga0207706_10203588 Ga0207706_102035882 128
245 3300025940 Ga0207691_10273987 Ga0207691_102739872 128
246 3300025945 Ga0207679_10088910 Ga0207679_100889103 128
247 3300025960 Ga0207651_10262039 Ga0207651_102620392 128
248 3300025986 Ga0207658_10104913 Ga0207658_101049132 128
249 3300026088 Ga0207641_10558595 Ga0207641_105585952 128
250 3300026089 Ga0207648_10180222 Ga0207648_101802222 128
251 3300028380 Ga0268265_10080583 Ga0268265_100805832 128
252 3300031548 Ga0307408_101454013 Ga0307408_1014540131 128
253 3300031852 Ga0307410_10851731 Ga0307410_108517312 128
254 3300032005 Ga0307411_10416301 Ga0307411_104163013 128
255 3300032005 Ga0307411_10749412 Ga0307411_107494121 128
256 3300037312 Ga0395899_0000175 Ga0395899_0000175_13916_14308 128
257 3300037418 Ga0395900_0000012 Ga0395900_0000012_276032_276424 128
258 3300037466 Ga0395898_0000034 Ga0395898_0000034_269539_269931 128
259 3300038443 Ga0395901_0030232 Ga0395901_0030232_4765_5157 128
260 3300038443 Ga0395901_0057799 Ga0395901_0057799_3311_3703 128
261 3300039145 Ga0237816_00654 Ga0237816_00654_1829_2224 128
262 3300041413 Ga0439465_0007729 Ga0439465_0007729_386_775 128
263 3300041453 Ga0451797_1394323 Ga0451797_1394323_504_896 128
264 3300041494 Ga0451837_0995902 Ga0451837_0995902_172_561 128
265 3300041494 Ga0451837_1184456 Ga0451837_1184456_1174_1566 128
266 3300044656 Ga0466969_0011308 Ga0466969_0011308_449_841 128
267 3300044661 Ga0466975_0103111 Ga0466975_0103111_427_819 128
268 3300044683 Ga0466965_0000618 Ga0466965_0000618_2469_2861 128
269 3300044684 Ga0466966_0008750 Ga0466966_0008750_3712_4104 128
270 3300044684 Ga0466966_0617742 Ga0466966_0617742_50_442 128
271 3300044693 Ga0466961_0003439 Ga0466961_0003439_6095_6487 128
272 3300044693 Ga0466961_0007714 Ga0466961_0007714_4756_5148 128
273 3300044693 Ga0466961_0016522 Ga0466961_0016522_4251_4643 128
274 3300044694 Ga0466963_0111863 Ga0466963_0111863_1316_1708 128
275 3300044719 Ga0466971_0039815 Ga0466971_0039815_1093_1485 128
276 3300044719 Ga0466971_0048443 Ga0466971_0048443_1504_1896 128
277 3300044765 Ga0466970_0008881 Ga0466970_0008881_3657_4049 128
278 3300044842 Ga0466957_0006427 Ga0466957_0006427_6186_6578 128
279 3300044842 Ga0466957_0007212 Ga0466957_0007212_2754_3146 128
280 3300045049 Ga0466959_0000068 Ga0466959_0000068_44313_44705 128
281 3300045049 Ga0466959_0004901 Ga0466959_0004901_2136_2528 128
282 3300045049 Ga0466959_0014419 Ga0466959_0014419_3358_3750 128
283 3300045836 Ga0466958_0020415 Ga0466958_0020415_3149_3541 128
284 3300045836 Ga0466958_0392664 Ga0466958_0392664_485_877 128
285 3300045976 Ga0466967_0151829 Ga0466967_0151829_430_822 128
286 3300048905 Ga0496102_0130233 Ga0496102_0130233_1270_1701 128
287 3300048909 Ga0496106_0093946 Ga0496106_0093946_1081_1512 128
288 3300048912 Ga0496109_1520390 Ga0496109_1520390_156_569 128
289 3300048919 Ga0496116_0067346 Ga0496116_0067346_1062_1454 128
290 3300049570 Ga0501033_0006298 Ga0501033_0006298_1342_1737 128
291 3300049571 Ga0501034_0612272 Ga0501034_0612272_11_400 128
292 3300049574 Ga0501038_0016339 Ga0501038_0016339_4852_5247 128
293 3300049575 Ga0501039_0301346 Ga0501039_0301346_44_439 128
294 3300049579 Ga0501043_0067412 Ga0501043_0067412_642_1037 128
295 3300049822 Ga0501035_0150557 Ga0501035_0150557_1199_1594 128
296 3300049823 Ga0501044_0043955 Ga0501044_0043955_4200_4595 128
297 3300061719 Ga0466962_0001366 Ga0466962_0001366_10430_10822 128
298 3300003187 JGI25151J46595_10001223 JGI25151J46595_1000122315 129
299 3300003771 Ga0055526_1000145 Ga0055526_100014525 129
300 3300003773 Ga0055537_1000551 Ga0055537_10005512 129
301 3300003775 Ga0055524_1000211 Ga0055524_100021138 129
302 3300003781 Ga0055536_1010890 Ga0055536_10108902 129
303 3300003784 Ga0055534_1000107 Ga0055534_100010738 129
304 3300003790 Ga0055528_1000027 Ga0055528_100002791 129
305 3300005293 Ga0065715_10541578 Ga0065715_105415782 129
306 3300005331 Ga0070670_100166733 Ga0070670_1001667333 129
307 3300005331 Ga0070670_100365180 Ga0070670_1003651803 129
308 3300005339 Ga0070660_101282204 Ga0070660_1012822041 129
309 3300005347 Ga0070668_100043221 Ga0070668_1000432212 129
310 3300005347 Ga0070668_101516943 Ga0070668_1015169432 129
311 3300005353 Ga0070669_100029557 Ga0070669_1000295574 129
312 3300005366 Ga0070659_100088580 Ga0070659_1000885802 129
313 3300005436 Ga0070713_100857970 Ga0070713_1008579702 129
314 3300005458 Ga0070681_11640454 Ga0070681_116404541 129
315 3300006051 Ga0075364_10132214 Ga0075364_101322143 129
316 3300006051 Ga0075364_10195750 Ga0075364_101957502 129
317 3300009978 Ga0105148_101412 Ga0105148_1014122 129
318 3300009993 Ga0105028_121812 Ga0105028_1218122 129
319 3300012482 Ga0157318_1000417 Ga0157318_10004173 129
320 3300012490 Ga0157322_1044338 Ga0157322_10443381 129
321 3300012497 Ga0157319_1005395 Ga0157319_10053952 129
322 3300012508 Ga0157315_1014045 Ga0157315_10140452 129
323 3300014497 Ga0182008_10092856 Ga0182008_100928564 129
324 3300015689 Ga0183360_10001 Ga0183360_10001693 129
325 3300025245 Ga0207425_1006543 Ga0207425_10065432 129
326 3300025263 Ga0209565_1000005 Ga0209565_1000005421 129
327 3300025273 Ga0209673_1000011 Ga0209673_100001176 129
328 3300025291 Ga0209675_1000004 Ga0209675_1000004421 129
329 3300025291 Ga0209675_1017295 Ga0209675_10172953 129
330 3300025292 Ga0209676_1000540 Ga0209676_10005402 129
331 3300025294 Ga0209025_1000884 Ga0209025_100088418 129
332 3300025294 Ga0209025_1065705 Ga0209025_10657052 129
333 3300025295 Ga0209564_1000018 Ga0209564_100001876 129
334 3300025297 Ga0209758_1021433 Ga0209758_10214332 129
335 3300025299 Ga0209256_1000021 Ga0209256_100002124 129
336 3300025923 Ga0207681_10004298 Ga0207681_100042986 129
337 3300025925 Ga0207650_10268876 Ga0207650_102688762 129
338 3300025926 Ga0207659_10400028 Ga0207659_104000282 129
339 3300026118 Ga0207675_102437747 Ga0207675_1024377471 129
340 3300030742 Ga0316183_1048983 Ga0316183_10489833 129
341 3300031548 Ga0307408_100073637 Ga0307408_1000736372 129
342 3300031548 Ga0307408_100250893 Ga0307408_1002508933 129
343 3300031548 Ga0307408_100450388 Ga0307408_1004503882 129
344 3300031548 Ga0307408_100622905 Ga0307408_1006229052 129
345 3300031731 Ga0307405_10586726 Ga0307405_105867261 129
346 3300031731 Ga0307405_11832863 Ga0307405_118328631 129
347 3300031824 Ga0307413_10532066 Ga0307413_105320662 129
348 3300031824 Ga0307413_11242313 Ga0307413_112423131 129
349 3300031852 Ga0307410_10055302 Ga0307410_100553022 129
350 3300031852 Ga0307410_11367064 Ga0307410_113670641 129
351 3300031901 Ga0307406_11005784 Ga0307406_110057842 129
352 3300031903 Ga0307407_10620350 Ga0307407_106203502 129
353 3300031911 Ga0307412_10028574 Ga0307412_100285744 129
354 3300031911 Ga0307412_11157103 Ga0307412_111571032 129
355 3300031995 Ga0307409_100633578 Ga0307409_1006335782 129
356 3300032002 Ga0307416_101752396 Ga0307416_1017523962 129
357 3300032004 Ga0307414_10109834 Ga0307414_101098343 129
358 3300032004 Ga0307414_10121773 Ga0307414_101217733 129
359 3300032004 Ga0307414_10302621 Ga0307414_103026213 129
360 3300032004 Ga0307414_10443970 Ga0307414_104439701 129
361 3300032005 Ga0307411_10032321 Ga0307411_100323212 129
362 3300032005 Ga0307411_10104647 Ga0307411_101046473 129
363 3300032126 Ga0307415_101022260 Ga0307415_1010222602 129
364 3300037466 Ga0395898_0232327 Ga0395898_0232327_1255_1647 129
365 3300037471 Ga0395905_0325484 Ga0395905_0325484_718_1113 129
366 3300038443 Ga0395901_0384181 Ga0395901_0384181_691_1083 129
367 3300041404 Ga0439436_0010415 Ga0439436_0010415_202_594 129
368 3300041407 Ga0439447_007822 Ga0439447_007822_825_1226 129
369 3300041494 Ga0451837_1827009 Ga0451837_1827009_906_1298 129
370 3300042006 Ga0439432_012921 Ga0439432_012921_14_409 129
371 3300042006 Ga0439432_044056 Ga0439432_044056_706_1101 129
372 3300042014 Ga0439457_030795 Ga0439457_030795_661_1053 129
373 3300042015 Ga0439462_0071525 Ga0439462_0071525_515_910 129
374 3300046460 Ga0495638_0103243 Ga0495638_0103243_702_1103 129
375 3300046615 Ga0495656_0003850 Ga0495656_0003850_4509_4901 129
376 3300046616 Ga0495668_0016123 Ga0495668_0016123_3197_3598 129
377 3300046691 Ga0495670_0157942 Ga0495670_0157942_494_886 129
378 3300047318 Ga0495636_0039930 Ga0495636_0039930_346_738 129
379 3300048911 Ga0496108_0292930 Ga0496108_0292930_941_1339 129
380 3300048924 Ga0496121_0013431 Ga0496121_0013431_1956_2357 129
381 3300049531 Ga0501315_057022 Ga0501315_057022_59_454 129
382 3300049568 Ga0501031_0367826 Ga0501031_0367826_495_887 129
383 3300049569 Ga0501032_0043565 Ga0501032_0043565_244_636 129
384 3300049573 Ga0501037_0033754 Ga0501037_0033754_2477_2869 129
385 3300049574 Ga0501038_0017969 Ga0501038_0017969_95_487 129
386 3300049586 Ga0501070_0008880 Ga0501070_0008880_440_832 129
387 3300049587 Ga0501071_0235342 Ga0501071_0235342_174_566 129
388 3300049589 Ga0501073_0055773 Ga0501073_0055773_94_486 129
389 3300049590 Ga0501074_0190666 Ga0501074_0190666_52_453 129
390 3300049652 Ga0501202_011902 Ga0501202_011902_785_1180 129
391 3300049654 Ga0501207_105852 Ga0501207_105852_23_418 129
392 3300049663 Ga0501223_058177 Ga0501223_058177_205_600 129
393 3300049665 Ga0501227_089745 Ga0501227_089745_351_746 129
394 3300049681 Ga0501251_033642 Ga0501251_033642_327_722 129
395 3300049705 Ga0501225_0172189 Ga0501225_0172189_76_471 129
396 3300049742 Ga0501080_0004656 Ga0501080_0004656_1216_1608 129
397 3300049758 Ga0501241_086307 Ga0501241_086307_224_619 129
398 3300049765 Ga0501268_006804 Ga0501268_006804_329_724 129
399 3300049772 Ga0501275_064389 Ga0501275_064389_148_543 129
400 3300049822 Ga0501035_0016076 Ga0501035_0016076_5908_6300 129
401 3300049823 Ga0501044_0010948 Ga0501044_0010948_2561_2953 129
402 iso_pu_bacteria 2643221593 2643975748 129
403 iso_pu_bacteria 2739367700 2739731950 129
404 iso_pu_bacteria 2884411467 2884413318 129
405 iso_pu_bacteria 2928963466 2928964645 129
406 3300003187 JGI25151J46595_10056804 JGI25151J46595_100568042 130
407 3300003771 Ga0055526_1014252 Ga0055526_10142523 130
408 3300003775 Ga0055524_1012932 Ga0055524_10129323 130
409 3300003775 Ga0055524_1013700 Ga0055524_10137001 130
410 3300003775 Ga0055524_1014505 Ga0055524_10145052 130
411 3300003781 Ga0055536_1052790 Ga0055536_10527901 130
412 3300003781 Ga0055536_1087917 Ga0055536_10879171 130
413 3300003784 Ga0055534_1013160 Ga0055534_10131602 130
414 3300003791 Ga0055530_10000953 Ga0055530_100009539 130
415 3300003794 Ga0055531_10011192 Ga0055531_100111921 130
416 3300003794 Ga0055531_10037414 Ga0055531_100374141 130
417 3300003794 Ga0055531_10037460 Ga0055531_100374603 130
418 3300005327 Ga0070658_10595004 Ga0070658_105950041 130
419 3300005458 Ga0070681_10345721 Ga0070681_103457211 130
420 3300005459 Ga0068867_101430134 Ga0068867_1014301341 130
421 3300005530 Ga0070679_100199148 Ga0070679_1001991482 130
422 3300005543 Ga0070672_100040156 Ga0070672_1000401561 130
423 3300005563 Ga0068855_100960681 Ga0068855_1009606812 130
424 3300005564 Ga0070664_100449639 Ga0070664_1004496393 130
425 3300005719 Ga0068861_100253018 Ga0068861_1002530182 130
426 3300006051 Ga0075364_10082841 Ga0075364_100828413 130
427 3300006051 Ga0075364_10250989 Ga0075364_102509892 130
428 3300009093 Ga0105240_10031027 Ga0105240_100310278 130
429 3300009148 Ga0105243_12142846 Ga0105243_121428462 130
430 3300009174 Ga0105241_10128930 Ga0105241_101289302 130
431 3300013102 Ga0157371_10074908 Ga0157371_100749083 130
432 3300013102 Ga0157371_11317952 Ga0157371_113179522 130
433 3300013306 Ga0163162_12063065 Ga0163162_120630651 130
434 3300013307 Ga0157372_10017019 Ga0157372_100170197 130
435 3300013307 Ga0157372_10931684 Ga0157372_109316842 130
436 3300013308 Ga0157375_10610965 Ga0157375_106109652 130
437 3300025245 Ga0207425_1071871 Ga0207425_10718711 130
438 3300025273 Ga0209673_1018362 Ga0209673_10183623 130
439 3300025284 Ga0209130_1009349 Ga0209130_10093493 130
440 3300025291 Ga0209675_1011075 Ga0209675_10110752 130
441 3300025291 Ga0209675_1028531 Ga0209675_10285311 130
442 3300025292 Ga0209676_1011200 Ga0209676_10112002 130
443 3300025292 Ga0209676_1012303 Ga0209676_10123034 130
444 3300025292 Ga0209676_1013870 Ga0209676_10138702 130
445 3300025292 Ga0209676_1019284 Ga0209676_10192842 130
446 3300025292 Ga0209676_1085599 Ga0209676_10855991 130
447 3300025294 Ga0209025_1030854 Ga0209025_10308543 130
448 3300025295 Ga0209564_1018435 Ga0209564_10184353 130
449 3300025295 Ga0209564_1019857 Ga0209564_10198573 130
450 3300025298 Ga0209050_1001358 Ga0209050_100135819 130
451 3300025298 Ga0209050_1018102 Ga0209050_10181023 130
452 3300025299 Ga0209256_1003298 Ga0209256_10032982 130
453 3300025299 Ga0209256_1004157 Ga0209256_100415711 130
454 3300025299 Ga0209256_1007202 Ga0209256_10072021 130
455 3300025303 Ga0209051_1012905 Ga0209051_10129053 130
456 3300025304 Ga0209257_1000133 Ga0209257_100013353 130
457 3300025304 Ga0209257_1000789 Ga0209257_10007891 130
458 3300025304 Ga0209257_1013716 Ga0209257_10137162 130
459 3300025304 Ga0209257_1014558 Ga0209257_10145581 130
460 3300025304 Ga0209257_1023789 Ga0209257_10237891 130
461 3300025304 Ga0209257_1080118 Ga0209257_10801182 130
462 3300025913 Ga0207695_10028459 Ga0207695_100284593 130
463 3300025914 Ga0207671_11269905 Ga0207671_112699051 130
464 3300025917 Ga0207660_10496311 Ga0207660_104963112 130
465 3300025919 Ga0207657_10030861 Ga0207657_100308614 130
466 3300025921 Ga0207652_10441252 Ga0207652_104412522 130
467 3300025921 Ga0207652_10540100 Ga0207652_105401002 130
468 3300025927 Ga0207687_11673743 Ga0207687_116737431 130
469 3300025940 Ga0207691_10001528 Ga0207691_1000152822 130
470 3300025945 Ga0207679_10120196 Ga0207679_101201963 130
471 3300025949 Ga0207667_10424542 Ga0207667_104245423 130
472 3300026089 Ga0207648_10270806 Ga0207648_102708063 130
473 3300026095 Ga0207676_10988183 Ga0207676_109881831 130
474 3300026118 Ga0207675_100234700 Ga0207675_1002347003 130
475 3300027876 Ga0209974_10037703 Ga0209974_100377032 130
476 3300031731 Ga0307405_10287559 Ga0307405_102875592 130
477 3300031824 Ga0307413_10218818 Ga0307413_102188183 130
478 3300032004 Ga0307414_10001544 Ga0307414_100015448 130
479 3300032004 Ga0307414_10049413 Ga0307414_100494133 130
480 3300032004 Ga0307414_10135860 Ga0307414_101358602 130
481 3300032004 Ga0307414_10183629 Ga0307414_101836291 130
482 3300032005 Ga0307411_10078395 Ga0307411_100783953 130
483 3300037312 Ga0395899_0010682 Ga0395899_0010682_5686_6087 130
484 3300037312 Ga0395899_0020288 Ga0395899_0020288_4481_4876 130
485 3300037312 Ga0395899_0046819 Ga0395899_0046819_162_557 130
486 3300037312 Ga0395899_0106492 Ga0395899_0106492_992_1387 130
487 3300037418 Ga0395900_0001866 Ga0395900_0001866_11489_11884 130
488 3300037418 Ga0395900_0090150 Ga0395900_0090150_287_688 130
489 3300037418 Ga0395900_0095564 Ga0395900_0095564_797_1192 130
490 3300037466 Ga0395898_0005801 Ga0395898_0005801_5816_6211 130
491 3300037466 Ga0395898_0085697 Ga0395898_0085697_1321_1722 130
492 3300037466 Ga0395898_0091058 Ga0395898_0091058_1935_2330 130
493 3300037471 Ga0395905_0066951 Ga0395905_0066951_401_802 130
494 3300038443 Ga0395901_0025292 Ga0395901_0025292_1734_2129 130
495 3300038443 Ga0395901_0035285 Ga0395901_0035285_1321_1722 130
496 3300038443 Ga0395901_0062194 Ga0395901_0062194_825_1220 130
497 3300041494 Ga0451837_1008743 Ga0451837_1008743_207_605 130
498 3300041999 Ga0439433_0061063 Ga0439433_0061063_486_887 130
499 3300045976 Ga0466967_0158947 Ga0466967_0158947_878_1273 130
500 3300046525 Ga0495663_0019883 Ga0495663_0019883_1145_1543 130
501 3300046525 Ga0495663_0045408 Ga0495663_0045408_494_892 130
502 3300046537 Ga0495598_0010004 Ga0495598_0010004_57_455 130
503 3300046539 Ga0495621_0058286 Ga0495621_0058286_922_1320 130
504 3300046615 Ga0495656_0002244 Ga0495656_0002244_5426_5833 130
505 3300047318 Ga0495636_0008301 Ga0495636_0008301_2828_3235 130
506 3300048912 Ga0496109_0287764 Ga0496109_0287764_365_763 130
507 3300049569 Ga0501032_0055322 Ga0501032_0055322_929_1324 130
508 3300049570 Ga0501033_0010579 Ga0501033_0010579_5617_6012 130
509 3300049573 Ga0501037_0638977 Ga0501037_0638977_148_543 130
510 3300049574 Ga0501038_0025770 Ga0501038_0025770_4053_4448 130
511 3300049579 Ga0501043_0019326 Ga0501043_0019326_4326_4721 130
512 3300049581 Ga0501047_0015109 Ga0501047_0015109_1228_1623 130
513 3300049581 Ga0501047_0079026 Ga0501047_0079026_2201_2596 130
514 3300049822 Ga0501035_0051346 Ga0501035_0051346_2072_2467 130
515 3300049823 Ga0501044_0714542 Ga0501044_0714542_262_657 130
516 3300050491 nmdc:mga00v17_209482_c1 nmdc:mga00v17_209482_c1_82_477 130
517 3300050491 nmdc:mga00v17_57252_c1 nmdc:mga00v17_57252_c1_1859_2254 130
518 3300003316 rootH1_10005491 rootH1_100054913 131
519 3300014969 Ga0157376_10041204 Ga0157376_100412044 131
520 3300031548 Ga0307408_100851347 Ga0307408_1008513471 131
521 3300031824 Ga0307413_10162073 Ga0307413_101620733 131
522 3300031995 Ga0307409_100862034 Ga0307409_1008620342 131
523 3300032004 Ga0307414_10023667 Ga0307414_100236672 131
524 3300032004 Ga0307414_10033019 Ga0307414_100330193 131
525 3300032004 Ga0307414_10244630 Ga0307414_102446301 131
526 3300035113 Ga0373936_0206284 Ga0373936_0206284_281_694 131
527 3300046472 Ga0495580_0221350 Ga0495580_0221350_741_1154 131
528 3300046476 Ga0495662_0180376 Ga0495662_0180376_279_692 131
529 3300046531 Ga0495665_0183146 Ga0495665_0183146_514_927 131
530 3300046539 Ga0495621_0133998 Ga0495621_0133998_224_634 131
531 3300046664 Ga0495659_0017172 Ga0495659_0017172_1537_1947 131
532 3300046691 Ga0495670_0066868 Ga0495670_0066868_206_619 131
533 3300048917 Ga0496114_0816454 Ga0496114_0816454_159_572 131
534 3300049582 Ga0501048_0031705 Ga0501048_0031705_659_1060 131
535 3300049661 Ga0501217_044793 Ga0501217_044793_545_961 131
536 3300049823 Ga0501044_0862009 Ga0501044_0862009_275_682 131
537 3300003316 rootH1_10044861 rootH1_100448612 132
538 3300005293 Ga0065715_10007122 Ga0065715_100071226 132
539 3300005330 Ga0070690_100239057 Ga0070690_1002390571 132
540 3300005338 Ga0068868_101928564 Ga0068868_1019285641 132
541 3300005340 Ga0070689_100347788 Ga0070689_1003477883 132
542 3300005347 Ga0070668_100012671 Ga0070668_1000126715 132
543 3300005347 Ga0070668_100141071 Ga0070668_1001410711 132
544 3300005539 Ga0068853_100627577 Ga0068853_1006275772 132
545 3300005543 Ga0070672_100094988 Ga0070672_1000949883 132
546 3300005577 Ga0068857_100835603 Ga0068857_1008356031 132
547 3300005617 Ga0068859_100073797 Ga0068859_1000737973 132
548 3300006931 Ga0097620_100073795 Ga0097620_1000737952 132
549 3300013308 Ga0157375_10060484 Ga0157375_100604841 132
550 3300025933 Ga0207706_10155232 Ga0207706_101552321 132
551 3300025940 Ga0207691_10023348 Ga0207691_100233483 132
552 3300025942 Ga0207689_10080614 Ga0207689_100806141 132
553 3300025972 Ga0207668_10718966 Ga0207668_107189661 132
554 3300026041 Ga0207639_10056707 Ga0207639_100567073 132
555 3300026089 Ga0207648_10010388 Ga0207648_100103886 132
556 3300031731 Ga0307405_10915269 Ga0307405_109152691 132
557 3300031824 Ga0307413_10480504 Ga0307413_104805042 132
558 3300031911 Ga0307412_10326529 Ga0307412_103265291 132
559 3300032004 Ga0307414_10231277 Ga0307414_102312771 132
560 3300032004 Ga0307414_10883857 Ga0307414_108838571 132
561 3300038443 Ga0395901_0889251 Ga0395901_0889251_65_466 132
562 3300041512 Ga0451853_2956181 Ga0451853_2956181_236_658 132
563 3300046539 Ga0495621_0026389 Ga0495621_0026389_822_1235 132
564 3300046675 Ga0495657_0147701 Ga0495657_0147701_24_449 132
565 3300047318 Ga0495636_0003450 Ga0495636_0003450_3427_3840 132
566 3300047318 Ga0495636_0180588 Ga0495636_0180588_10_423 132
567 3300049571 Ga0501034_0000316 Ga0501034_0000316_9409_9828 132
568 3300049573 Ga0501037_0619400 Ga0501037_0619400_311_715 132
569 3300049579 Ga0501043_0438180 Ga0501043_0438180_551_955 132
570 3300049580 Ga0501046_0573545 Ga0501046_0573545_218_622 132
571 3300049581 Ga0501047_0010880 Ga0501047_0010880_7936_8340 132
572 3300049586 Ga0501070_0387426 Ga0501070_0387426_442_843 132
573 3300002737 JGI25162J39368_1001443 JGI25162J39368_10014431 133
574 3300002737 JGI25162J39368_1002323 JGI25162J39368_10023237 133
575 3300002737 JGI25162J39368_1015344 JGI25162J39368_10153441 133
576 3300002741 JGI25157J39369_1000345 JGI25157J39369_10003452 133
577 3300002741 JGI25157J39369_1001366 JGI25157J39369_10013667 133
578 3300002771 JGI25163J39215_1000517 JGI25163J39215_10005172 133
579 3300002772 JGI25164J39214_1000214 JGI25164J39214_100021411 133
580 3300003214 JGI25165J46597_1000260 JGI25165J46597_100026012 133
581 3300003751 Ga0055538_1002032 Ga0055538_10020323 133
582 3300003756 Ga0055533_1000336 Ga0055533_10003367 133
583 3300003761 Ga0055535_1000323 Ga0055535_100032312 133
584 3300003761 Ga0055535_1015573 Ga0055535_10155731 133
585 3300003762 Ga0055542_1001347 Ga0055542_10013471 133
586 3300003762 Ga0055542_1001348 Ga0055542_10013481 133
587 3300003763 Ga0055529_1000233 Ga0055529_100023312 133
588 3300003841 Ga0055541_1011864 Ga0055541_10118642 133
589 3300005340 Ga0070689_100056593 Ga0070689_1000565933 133
590 3300005344 Ga0070661_100016933 Ga0070661_1000169333 133
591 3300005365 Ga0070688_100071787 Ga0070688_1000717872 133
592 3300005466 Ga0070685_10011677 Ga0070685_100116773 133
593 3300005843 Ga0068860_100185877 Ga0068860_1001858771 133
594 3300009551 Ga0105238_10210401 Ga0105238_102104012 133
595 3300013306 Ga0163162_10032740 Ga0163162_100327405 133
596 3300014969 Ga0157376_10167451 Ga0157376_101674512 133
597 3300015262 Ga0182007_10052561 Ga0182007_100525612 133
598 3300025207 Ga0209760_100358 Ga0209760_10035811 133
599 3300025224 Ga0209784_100068 Ga0209784_100068100 133
600 3300025225 Ga0209566_101255 Ga0209566_1012557 133
601 3300025226 Ga0209674_100012 Ga0209674_100012615 133
602 3300025228 Ga0209672_100791 Ga0209672_1007913 133
603 3300025231 Ga0207427_100156 Ga0207427_10015671 133
604 3300025231 Ga0207427_112102 Ga0207427_1121022 133
605 3300025233 Ga0209437_100126 Ga0209437_10012627 133
606 3300025233 Ga0209437_100147 Ga0209437_10014771 133
607 3300025233 Ga0209437_115603 Ga0209437_1156031 133
608 3300025242 Ga0209258_100049 Ga0209258_10004937 133
609 3300025242 Ga0209258_105589 Ga0209258_1055892 133
610 3300025246 Ga0209646_1000810 Ga0209646_10008103 133
611 3300025250 Ga0209026_1000099 Ga0209026_1000099100 133
612 3300025250 Ga0209026_1004452 Ga0209026_10044525 133
613 3300025254 Ga0209148_1000002 Ga0209148_10000021459 133
614 3300025254 Ga0209148_1000010 Ga0209148_1000010983 133
615 3300025256 Ga0209759_1000316 Ga0209759_100031658 133
616 3300025261 Ga0209233_1000009 Ga0209233_1000009187 133
617 3300025261 Ga0209233_1016480 Ga0209233_10164803 133
618 3300025261 Ga0209233_1045019 Ga0209233_10450192 133
619 3300025272 Ga0209455_1000086 Ga0209455_1000086188 133
620 3300025924 Ga0207694_10067225 Ga0207694_100672252 133
621 3300025936 Ga0207670_10040564 Ga0207670_100405643 133
622 3300026067 Ga0207678_10026991 Ga0207678_100269913 133
623 3300028380 Ga0268265_10306665 Ga0268265_103066652 133
624 3300028381 Ga0268264_10191216 Ga0268264_101912163 133
625 3300046460 Ga0495638_0000777 Ga0495638_0000777_883_1290 133
626 3300046460 Ga0495638_0001254 Ga0495638_0001254_12370_12777 133
627 3300046471 Ga0495650_0000585 Ga0495650_0000585_34196_34603 133
628 3300046507 Ga0495606_0001787 Ga0495606_0001787_14854_15261 133
629 3300046660 Ga0495625_0048972 Ga0495625_0048972_2375_2782 133
630 3300046660 Ga0495625_0113616 Ga0495625_0113616_599_1006 133
631 3300046694 Ga0495649_0212679 Ga0495649_0212679_68_475 133
632 3300048907 Ga0496104_0114648 Ga0496104_0114648_1724_2131 133
633 3300048917 Ga0496114_0084162 Ga0496114_0084162_722_1129 133
634 3300048929 Ga0496126_0050642 Ga0496126_0050642_1907_2314 133
635 3300048929 Ga0496126_0378088 Ga0496126_0378088_348_755 133
636 3300049459 Ga0495678_077392 Ga0495678_077392_287_694 133
637 3300049523 Ga0501300_002974 Ga0501300_002974_1116_1523 133
638 3300049762 Ga0501265_000627 Ga0501265_000627_3004_3411 133
639 3300049772 Ga0501275_000601 Ga0501275_000601_2814_3221 133
640 3300049823 Ga0501044_0126540 Ga0501044_0126540_650_1063 133
641 3300001990 JGI24737J22298_10013411 JGI24737J22298_100134114 134
642 3300002067 JGI24735J21928_10025036 JGI24735J21928_100250363 134
643 3300003761 Ga0055535_1005001 Ga0055535_10050013 134
644 3300009545 Ga0105237_10292670 Ga0105237_102926703 134
645 3300009553 Ga0105249_11795905 Ga0105249_117959051 134
646 3300010375 Ga0105239_10239874 Ga0105239_102398743 134
647 3300010375 Ga0105239_10458409 Ga0105239_104584092 134
648 3300013105 Ga0157369_10163907 Ga0157369_101639073 134
649 3300013296 Ga0157374_11005297 Ga0157374_110052972 134
650 3300013308 Ga0157375_11404660 Ga0157375_114046602 134
651 3300015687 Ga0183368_1003 Ga0183368_1003861 134
652 3300025242 Ga0209258_100762 Ga0209258_1007625 134
653 3300025904 Ga0207647_10007462 Ga0207647_100074626 134
654 3300025914 Ga0207671_10148435 Ga0207671_101484353 134
655 3300025941 Ga0207711_10036599 Ga0207711_100365994 134
656 3300025942 Ga0207689_10201100 Ga0207689_102011003 134
657 3300025961 Ga0207712_11488316 Ga0207712_114883161 134
658 3300044694 Ga0466963_0827751 Ga0466963_0827751_90_494 134
659 3300045976 Ga0466967_0393216 Ga0466967_0393216_653_1057 134
660 3300048916 Ga0496113_0047904 Ga0496113_0047904_639_1043 134
661 3300048918 Ga0496115_0000025 Ga0496115_0000025_135785_136189 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

47

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8458 54 98
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.8305 31 126
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.8143 31 126
1vke-assembly1.cif.gz_A crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.7457 16 127
1p8c-assembly1.cif.gz_B crystal structure of tm1620 (apc4843) from thermotoga maritima 0.7402 16 126
ID Description Score Start End Superfamily
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8519 33 127 1.20.1290.10
1vkeB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8394 33 127 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8305 31 126 1.20.1290.10
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8143 31 126 1.20.1290.10
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8033 33 127 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7Z1R3G8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9974 55 122 GO:0051920
AF-A0A4Y7U3X9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9945 56 124 GO:0051920
AF-A0A3M1P315-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9914 52 124 GO:0051920
AF-A0A2N2NMT7-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9896 52 124 GO:0051920
AF-A0A520IVB4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.97 47 121 GO:0051920

Feature Viewer

pLDDT pTM Quality
80.94 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map