F473396

General Info

Members Datasets Scaffolds Average Seq Length
661 363 661 150

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11229740|Ga0105243_112297402
Length 171
Sequence MPGAQVTAYSAAAKNEHLGGNMVSFTLNGQRVSVDADANTPLLWVIRDHVGLTGTKYGCGAGLCGACTVHLNGKAVRACQTQMSEAAGKTVVTIEGLSKNSSHPLQKAWVKLEVPQCGYCQSGQIMKAAELLAQNKQPSREQIVQHMDGNICRCGTYHRIIAAVELAAKEA

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
222 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
358 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
359 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
360 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.6
Nodule 0
Rhizoplane 6.96
Rhizosphere 86.08
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10089683 3300002075 Bacteria 649
2 JGI25406J46586_10019721 3300003203 Bacteria 2739
3 JGI25153J46596_10046480 3300003215 Bacteria 1286
4 Ga0070676_10297780 3300005328 Bacteria 1092
5 Ga0070676_10575508 3300005328 Bacteria 809
6 Ga0070683_100595733 3300005329 Bacteria 1058
7 Ga0070683_101064341 3300005329 Bacteria 777
8 Ga0070690_100097605 3300005330 Bacteria 1944
9 Ga0070690_100547308 3300005330 Bacteria 872
10 Ga0070690_100619143 3300005330 Bacteria 824
11 Ga0070670_102154551 3300005331 Bacteria 514
12 Ga0070677_10214350 3300005333 Bacteria 937
13 Ga0068869_100074085 3300005334 Bacteria 2526
14 Ga0068869_100110048 3300005334 Bacteria 2095
15 Ga0070666_10450101 3300005335 Bacteria 930
16 Ga0070666_10874670 3300005335 Bacteria 664
17 Ga0070682_100981176 3300005337 Bacteria 700
18 Ga0068868_100497971 3300005338 Bacteria 1067
19 Ga0068868_100674307 3300005338 Bacteria 922
20 Ga0070660_100160134 3300005339 Bacteria 1813
21 Ga0070689_100023592 3300005340 Bacteria 4606
22 Ga0070689_100618441 3300005340 Bacteria 940
23 Ga0070689_100979023 3300005340 Bacteria 751
24 Ga0070687_100172413 3300005343 Bacteria 1289
25 Ga0070661_100047200 3300005344 Bacteria 3152
26 Ga0070692_10021173 3300005345 Bacteria 3161
27 Ga0070692_10143702 3300005345 Bacteria 1353
28 Ga0070668_100077039 3300005347 Bacteria 2606
29 Ga0070669_100026933 3300005353 Bacteria 4137
30 Ga0070669_100238826 3300005353 Bacteria 1443
31 Ga0070669_100345876 3300005353 Bacteria 1206
32 Ga0070669_100686572 3300005353 Bacteria 864
33 Ga0070675_100725841 3300005354 Bacteria 906
34 Ga0070671_100592454 3300005355 Bacteria 958
35 Ga0070671_100772364 3300005355 Bacteria 836
36 Ga0070671_100814177 3300005355 Bacteria 814
37 Ga0070674_100121072 3300005356 Bacteria 1937
38 Ga0070674_100301417 3300005356 Bacteria 1278
39 Ga0070673_100239335 3300005364 Bacteria 1577
40 Ga0070673_100376511 3300005364 Bacteria 1265
41 Ga0070688_100007930 3300005365 Bacteria 5743
42 Ga0070659_100158881 3300005366 Bacteria 1847
43 Ga0070659_100231523 3300005366 Bacteria 1527
44 Ga0070703_10219013 3300005406 Bacteria 757
45 Ga0070713_101218478 3300005436 Bacteria 729
46 Ga0070710_10074578 3300005437 Bacteria 1964
47 Ga0070701_10041962 3300005438 Bacteria 2333
48 Ga0070701_10140038 3300005438 Bacteria 1382
49 Ga0070711_100048438 3300005439 Bacteria 2906
50 Ga0070705_100325872 3300005440 Bacteria 1111
51 Ga0070705_100670385 3300005440 Bacteria 811
52 Ga0070700_100030843 3300005441 Bacteria 3207
53 Ga0070694_100003687 3300005444 Bacteria 9136
54 Ga0070694_100011986 3300005444 Bacteria 5381
55 Ga0070694_100515033 3300005444 Bacteria 954
56 Ga0070708_100035446 3300005445 Bacteria 4347
57 Ga0070678_100205201 3300005456 Bacteria 1629
58 Ga0070678_100427434 3300005456 Bacteria 1156
59 Ga0070662_100119227 3300005457 Bacteria 2020
60 Ga0068867_100240203 3300005459 Bacteria 1469
61 Ga0068867_100271209 3300005459 Bacteria 1387
62 Ga0070685_10852788 3300005466 Bacteria 675
63 Ga0070707_100132410 3300005468 Bacteria 2425
64 Ga0070684_100079560 3300005535 Bacteria 2898
65 Ga0070697_100069775 3300005536 Bacteria 2879
66 Ga0070672_100166225 3300005543 Bacteria 1833
67 Ga0070672_100228744 3300005543 Bacteria 1562
68 Ga0070672_100281624 3300005543 Bacteria 1406
69 Ga0070686_100016847 3300005544 Bacteria 4257
70 Ga0070686_100135417 3300005544 Bacteria 1708
71 Ga0070695_100024926 3300005545 Bacteria 3689
72 Ga0070695_101099167 3300005545 Bacteria 650
73 Ga0070696_100857490 3300005546 Bacteria 751
74 Ga0070696_101213883 3300005546 Bacteria 638
75 Ga0070693_100006517 3300005547 Bacteria 5661
76 Ga0070665_101024468 3300005548 Bacteria 838
77 Ga0070704_100006684 3300005549 Bacteria 6818
78 Ga0068855_100606402 3300005563 Bacteria 1180
79 Ga0068857_100619536 3300005577 Bacteria 1024
80 Ga0068854_100808536 3300005578 Bacteria 818
81 Ga0070702_100404488 3300005615 Bacteria 977
82 Ga0068852_100067879 3300005616 Bacteria 3119
83 Ga0068852_101206056 3300005616 Bacteria 778
84 Ga0068859_100126230 3300005617 Bacteria 2628
85 Ga0068859_101113117 3300005617 Bacteria 869
86 Ga0068864_100052031 3300005618 Bacteria 3529
87 Ga0068864_100142366 3300005618 Bacteria 2164
88 Ga0068864_100200050 3300005618 Bacteria 1835
89 Ga0068866_10269137 3300005718 Bacteria 1051
90 Ga0068866_10576982 3300005718 Bacteria 756
91 Ga0068861_100146736 3300005719 Bacteria 1931
92 Ga0068851_10299804 3300005834 Bacteria 924
93 Ga0068870_10064212 3300005840 Bacteria 1982
94 Ga0068863_100216665 3300005841 Bacteria 1844
95 Ga0068863_100871778 3300005841 Bacteria 900
96 Ga0068858_100185575 3300005842 Bacteria 1964
97 Ga0068858_100232871 3300005842 Bacteria 1746
98 Ga0068860_100998422 3300005843 Bacteria 855
99 Ga0068862_100320016 3300005844 Bacteria 1431
100 Ga0081455_10000759 3300005937 Bacteria 41962
101 Ga0081455_10004199 3300005937 Bacteria 16239
102 Ga0081455_10010372 3300005937 Bacteria 9466
103 Ga0081455_10063042 3300005937 Bacteria 3112
104 Ga0081455_10141522 3300005937 Bacteria 1868
105 Ga0081538_10000527 3300005981 Bacteria 42416
106 Ga0081538_10033045 3300005981 Bacteria 3452
107 Ga0081538_10048084 3300005981 Bacteria 2607
108 Ga0081540_1166045 3300005983 Bacteria 848
109 Ga0081539_10002942 3300005985 Bacteria 22406
110 Ga0081539_10087764 3300005985 Bacteria 1615
111 Ga0070717_10106475 3300006028 Bacteria 2388
112 Ga0070717_10485425 3300006028 Bacteria 1116
113 Ga0070717_10518270 3300006028 Bacteria 1078
114 Ga0075365_10039069 3300006038 Bacteria 3088
115 Ga0075365_10142034 3300006038 Bacteria 1667
116 Ga0075365_10343832 3300006038 Bacteria 1051
117 Ga0075365_10493475 3300006038 Bacteria 865
118 Ga0075368_10084706 3300006042 Bacteria 1292
119 Ga0075363_100026412 3300006048 Bacteria 2970
120 Ga0075363_100465669 3300006048 Bacteria 748
121 Ga0075364_10019489 3300006051 Bacteria 4259
122 Ga0075364_10690583 3300006051 Bacteria 697
123 Ga0070715_10852957 3300006163 Bacteria 557
124 Ga0070716_100131238 3300006173 Bacteria 1584
125 Ga0070712_100009604 3300006175 Bacteria 6099
126 Ga0070712_100107264 3300006175 Bacteria 2078
127 Ga0075362_10018592 3300006177 Bacteria 2878
128 Ga0075362_10132460 3300006177 Bacteria 1187
129 Ga0075367_10248972 3300006178 Bacteria 1114
130 Ga0075367_10271422 3300006178 Bacteria 1065
131 Ga0075367_10524505 3300006178 Bacteria 752
132 Ga0075369_10058702 3300006186 Bacteria 1675
133 Ga0075427_10109129 3300006194 Bacteria 520
134 Ga0075366_10503492 3300006195 Bacteria 749
135 Ga0097621_100040897 3300006237 Bacteria 3728
136 Ga0097621_100640210 3300006237 Bacteria 975
137 Ga0097621_101063444 3300006237 Bacteria 759
138 Ga0068871_100109638 3300006358 Bacteria 2321
139 Ga0068871_100456919 3300006358 Bacteria 1145
140 Ga0068871_100697771 3300006358 Bacteria 930
141 Ga0075428_100024058 3300006844 Bacteria 6742
142 Ga0075428_100125159 3300006844 Bacteria 2797
143 Ga0075428_100214072 3300006844 Bacteria 2082
144 Ga0075428_100216748 3300006844 Bacteria 2068
145 Ga0075428_100338704 3300006844 Bacteria 1615
146 Ga0075428_100512275 3300006844 Bacteria 1283
147 Ga0075430_100000293 3300006846 Bacteria 35315
148 Ga0075430_100001577 3300006846 Bacteria 18642
149 Ga0075430_100459574 3300006846 Bacteria 1050
150 Ga0075430_100464074 3300006846 Bacteria 1045
151 Ga0075431_100030912 3300006847 Bacteria 5515
152 Ga0075431_100032198 3300006847 Bacteria 5403
153 Ga0075431_100111833 3300006847 Bacteria 2818
154 Ga0075431_100225009 3300006847 Bacteria 1913
155 Ga0075434_100095598 3300006871 Bacteria 2976
156 Ga0075434_100136338 3300006871 Bacteria 2473
157 Ga0075434_100366761 3300006871 Bacteria 1461
158 Ga0075429_100281422 3300006880 Bacteria 1457
159 Ga0075429_100966682 3300006880 Bacteria 745
160 Ga0075429_100969516 3300006880 Bacteria 744
161 Ga0068865_100097342 3300006881 Bacteria 2147
162 Ga0068865_100340588 3300006881 Bacteria 1212
163 Ga0075436_100209768 3300006914 Bacteria 1380
164 Ga0097620_100126237 3300006931 Bacteria 2628
165 Ga0097620_101112925 3300006931 Bacteria 869
166 Ga0075435_100208583 3300007076 Bacteria 1657
167 Ga0075435_100859192 3300007076 Bacteria 791
168 Ga0099794_10013326 3300007265 Bacteria 3576
169 Ga0099794_10491223 3300007265 Bacteria 646
170 Ga0105240_11516977 3300009093 Bacteria 702
171 Ga0111539_10075711 3300009094 Bacteria 3964
172 Ga0111539_10099325 3300009094 Bacteria 3418
173 Ga0111539_10264076 3300009094 Bacteria 2004
174 Ga0111539_10277312 3300009094 Bacteria 1951
175 Ga0105245_10411220 3300009098 Bacteria 1354
176 Ga0105245_11409243 3300009098 Bacteria 747
177 Ga0105247_10127779 3300009101 Bacteria 1654
178 Ga0105247_10477672 3300009101 Bacteria 904
179 Ga0114129_10005790 3300009147 Bacteria 17503
180 Ga0114129_10165790 3300009147 Bacteria 3015
181 Ga0114129_10271606 3300009147 Bacteria 2268
182 Ga0114129_10585481 3300009147 Bacteria 1447
183 Ga0114129_10801205 3300009147 Bacteria 1202
184 Ga0114129_10944446 3300009147 Bacteria 1090
185 Ga0105243_10071374 3300009148 Bacteria 2807
186 Ga0105243_10159711 3300009148 Bacteria 1942
187 Ga0105243_11093442 3300009148 Bacteria 805
188 Ga0105243_11229740 3300009148 Bacteria 763
189 Ga0105241_10766728 3300009174 Bacteria 886
190 Ga0105242_10107759 3300009176 Bacteria 2370
191 Ga0105242_10825329 3300009176 Bacteria 920
192 Ga0105242_10860144 3300009176 Bacteria 903
193 Ga0105242_10926624 3300009176 Bacteria 873
194 Ga0105248_10446646 3300009177 Bacteria 1457
195 Ga0105238_10483143 3300009551 Bacteria 1238
196 Ga0105249_10189793 3300009553 Bacteria 2005
197 Ga0105249_10780319 3300009553 Bacteria 1019
198 Ga0105239_10104142 3300010375 Bacteria 3142
199 Ga0105246_10101927 3300011119 Bacteria 2092
200 Ga0105246_10939827 3300011119 Bacteria 778
201 Ga0105246_12408074 3300011119 Bacteria 516
202 Ga0157374_10349988 3300013296 Bacteria 1468
203 Ga0157378_12159801 3300013297 Bacteria 608
204 Ga0163162_10533824 3300013306 Bacteria 1302
205 Ga0163162_10779196 3300013306 Bacteria 1074
206 Ga0163162_11593033 3300013306 Bacteria 745
207 Ga0163162_11611157 3300013306 Bacteria 741
208 Ga0157372_10687703 3300013307 Bacteria 1191
209 Ga0157375_10100676 3300013308 Bacteria 2971
210 Ga0157375_10413424 3300013308 Bacteria 1515
211 Ga0163163_10034194 3300014325 Bacteria 4921
212 Ga0163163_10346324 3300014325 Bacteria 1541
213 Ga0163163_10598338 3300014325 Bacteria 1166
214 Ga0157380_10165714 3300014326 Bacteria 1925
215 Ga0157380_10761502 3300014326 Bacteria 981
216 Ga0157377_10390185 3300014745 Bacteria 945
217 Ga0157377_10517871 3300014745 Bacteria 837
218 Ga0157379_10125818 3300014968 Bacteria 2306
219 Ga0157376_10026276 3300014969 Bacteria 4598
220 Ga0157376_10180521 3300014969 Bacteria 1929
221 Ga0157376_10678570 3300014969 Bacteria 1033
222 Ga0163161_10034179 3300017792 Bacteria 3636
223 Ga0163161_10666999 3300017792 Bacteria 863
224 Ga0163161_11457772 3300017792 Bacteria 599
225 Ga0213872_10057372 3300021361 Bacteria 1763
226 Ga0213874_10334364 3300021377 Bacteria 577
227 Ga0213871_10059506 3300021441 Bacteria 1062
228 Ga0209758_1000370 3300025297 Bacteria 79289
229 Ga0209758_1021862 3300025297 Bacteria 2961
230 Ga0207426_1135232 3300025302 Bacteria 592
231 Ga0207656_10303219 3300025321 Bacteria 791
232 Ga0207653_10075029 3300025885 Bacteria 1162
233 Ga0207682_10106712 3300025893 Bacteria 1229
234 Ga0207692_10081064 3300025898 Bacteria 1736
235 Ga0207642_10170375 3300025899 Bacteria 1177
236 Ga0207642_10224938 3300025899 Bacteria 1051
237 Ga0207642_10405828 3300025899 Bacteria 816
238 Ga0207710_10108772 3300025900 Bacteria 1315
239 Ga0207688_10192639 3300025901 Bacteria 1220
240 Ga0207680_10263986 3300025903 Bacteria 1192
241 Ga0207680_10929128 3300025903 Bacteria 623
242 Ga0207647_10067976 3300025904 Bacteria 2158
243 Ga0207645_10030990 3300025907 Bacteria 3444
244 Ga0207645_10548686 3300025907 Bacteria 784
245 Ga0207643_10004252 3300025908 Bacteria 7711
246 Ga0207684_10063009 3300025910 Bacteria 3148
247 Ga0207654_10421065 3300025911 Bacteria 932
248 Ga0207707_10416342 3300025912 Bacteria 1153
249 Ga0207693_10015564 3300025915 Bacteria 6101
250 Ga0207693_10655752 3300025915 Bacteria 815
251 Ga0207663_10244854 3300025916 Bacteria 1317
252 Ga0207660_10026335 3300025917 Bacteria 3960
253 Ga0207660_10139252 3300025917 Bacteria 1854
254 Ga0207660_10348482 3300025917 Bacteria 1187
255 Ga0207660_10530646 3300025917 Bacteria 956
256 Ga0207660_11214690 3300025917 Bacteria 613
257 Ga0207662_10240217 3300025918 Bacteria 1186
258 Ga0207662_10301374 3300025918 Bacteria 1065
259 Ga0207662_10442133 3300025918 Bacteria 888
260 Ga0207649_10042503 3300025920 Bacteria 2773
261 Ga0207681_10016920 3300025923 Bacteria 4572
262 Ga0207681_10131231 3300025923 Bacteria 1853
263 Ga0207681_10205136 3300025923 Bacteria 1516
264 Ga0207681_10288767 3300025923 Bacteria 1294
265 Ga0207650_10004089 3300025925 Bacteria 9961
266 Ga0207650_11137188 3300025925 Bacteria 665
267 Ga0207659_10246314 3300025926 Bacteria 1448
268 Ga0207700_10015702 3300025928 Bacteria 5006
269 Ga0207700_10448018 3300025928 Bacteria 1137
270 Ga0207700_11362032 3300025928 Bacteria 631
271 Ga0207664_10469964 3300025929 Bacteria 1124
272 Ga0207664_10729006 3300025929 Bacteria 891
273 Ga0207644_10649286 3300025931 Bacteria 878
274 Ga0207644_10677431 3300025931 Bacteria 859
275 Ga0207644_10998987 3300025931 Bacteria 702
276 Ga0207690_10065767 3300025932 Bacteria 2480
277 Ga0207690_10113690 3300025932 Bacteria 1954
278 Ga0207706_10008418 3300025933 Bacteria 9518
279 Ga0207709_10012652 3300025935 Bacteria 4651
280 Ga0207709_10058670 3300025935 Bacteria 2393
281 Ga0207709_11189075 3300025935 Bacteria 628
282 Ga0207670_10005087 3300025936 Bacteria 7176
283 Ga0207670_10369305 3300025936 Bacteria 1140
284 Ga0207670_10962477 3300025936 Bacteria 717
285 Ga0207669_10150832 3300025937 Bacteria 1628
286 Ga0207669_11104561 3300025937 Bacteria 669
287 Ga0207704_11695228 3300025938 Bacteria 543
288 Ga0207691_10139600 3300025940 Bacteria 2136
289 Ga0207691_10234506 3300025940 Bacteria 1588
290 Ga0207691_10432903 3300025940 Bacteria 1120
291 Ga0207711_10696294 3300025941 Bacteria 948
292 Ga0207689_10167720 3300025942 Bacteria 1809
293 Ga0207661_10858151 3300025944 Bacteria 836
294 Ga0207661_11195013 3300025944 Bacteria 700
295 Ga0207679_11679444 3300025945 Bacteria 581
296 Ga0207651_10326479 3300025960 Bacteria 1284
297 Ga0207712_10050584 3300025961 Bacteria 2902
298 Ga0207712_11503265 3300025961 Bacteria 603
299 Ga0207668_10043771 3300025972 Bacteria 3041
300 Ga0207668_11146463 3300025972 Bacteria 698
301 Ga0207640_10154994 3300025981 Bacteria 1687
302 Ga0207658_10480841 3300025986 Bacteria 1104
303 Ga0207677_10229030 3300026023 Bacteria 1496
304 Ga0207677_10345603 3300026023 Bacteria 1245
305 Ga0207703_10155221 3300026035 Bacteria 1999
306 Ga0207678_10047151 3300026067 Bacteria 3727
307 Ga0207678_10798983 3300026067 Bacteria 833
308 Ga0207708_10020685 3300026075 Bacteria 4963
309 Ga0207702_10074357 3300026078 Bacteria 2933
310 Ga0207641_10246736 3300026088 Bacteria 1666
311 Ga0207641_10354494 3300026088 Bacteria 1399
312 Ga0207648_10012041 3300026089 Bacteria 8113
313 Ga0207648_10125539 3300026089 Bacteria 2257
314 Ga0207648_10545603 3300026089 Bacteria 1064
315 Ga0207676_10015096 3300026095 Bacteria 5570
316 Ga0207676_10251147 3300026095 Bacteria 1592
317 Ga0207676_10368089 3300026095 Bacteria 1334
318 Ga0207674_11226746 3300026116 Bacteria 719
319 Ga0207675_100202117 3300026118 Bacteria 1909
320 Ga0207675_100361829 3300026118 Bacteria 1423
321 Ga0207675_101681935 3300026118 Bacteria 655
322 Ga0207683_10143288 3300026121 Bacteria 2154
323 Ga0207683_10506832 3300026121 Bacteria 1115
324 Ga0207683_10530107 3300026121 Bacteria 1088
325 Ga0207683_10621976 3300026121 Bacteria 1000
326 Ga0207698_10317658 3300026142 Bacteria 1457
327 Ga0207698_10918862 3300026142 Bacteria 883
328 Ga0209588_1094306 3300027671 Bacteria 964
329 Ga0207428_10276158 3300027907 Bacteria 1248
330 Ga0268266_10575283 3300028379 Bacteria 1081
331 Ga0268265_10788184 3300028380 Bacteria 925
332 Ga0268264_10068542 3300028381 Bacteria 2998
333 Ga0268264_11012215 3300028381 Bacteria 838
334 Ga0268264_11982755 3300028381 Bacteria 591
335 Ga0265331_10298426 3300031250 Bacteria 722
336 Ga0307408_100092380 3300031548 Bacteria 2288
337 Ga0307408_100996584 3300031548 Bacteria 772
338 Ga0307516_10027228 3300031730 Bacteria 5797
339 Ga0307405_10899979 3300031731 Bacteria 748
340 Ga0307407_10041341 3300031903 Bacteria 2578
341 Ga0307412_11073290 3300031911 Bacteria 715
342 Ga0307409_102705708 3300031995 Bacteria 524
343 Ga0373950_0092010 3300034818 Bacteria 645
344 Ga0373926_0196061 3300035083 Bacteria 777
345 Ga0373928_0048318 3300035084 Bacteria 998
346 Ga0373929_0029125 3300035085 Bacteria 1170
347 Ga0373934_0358659 3300035086 Bacteria 607
348 Ga0373949_0178991 3300035090 Bacteria 627
349 Ga0373952_0009255 3300035092 Bacteria 1882
350 Ga0373952_0076640 3300035092 Bacteria 846
351 Ga0373923_0153370 3300035111 Bacteria 1047
352 Ga0373923_0333078 3300035111 Bacteria 722
353 Ga0373932_0309722 3300035112 Bacteria 591
354 Ga0373936_0031825 3300035113 Bacteria 2084
355 Ga0373939_0094841 3300035114 Bacteria 1014
356 Ga0373939_0228663 3300035114 Bacteria 715
357 Ga0373941_0008268 3300035115 Bacteria 2578
358 Ga0373945_0162314 3300035116 Bacteria 911
359 Ga0373954_0225950 3300035118 Bacteria 921
360 Ga0373943_0021213 3300035170 Bacteria 2998
361 Ga0373943_0231926 3300035170 Bacteria 1032
362 Ga0373946_0060480 3300035171 Bacteria 1610
363 Ga0373946_0098745 3300035171 Bacteria 1306
364 Ga0373955_0012761 3300035172 Bacteria 4048
365 Ga0373961_0037215 3300035241 Bacteria 1389
366 Ga0373962_0027944 3300035242 Bacteria 1528
367 Ga0373924_0060495 3300035410 Bacteria 1584
368 Ga0373931_0003755 3300035691 Bacteria 6867
369 Ga0373931_0023964 3300035691 Bacteria 3086
370 Ga0373931_0207963 3300035691 Bacteria 1172
371 Ga0373931_0276994 3300035691 Bacteria 1029
372 Ga0373935_0066766 3300035692 Bacteria 2312
373 Ga0373935_0295121 3300035692 Bacteria 1144
374 Ga0373935_0447204 3300035692 Bacteria 933
375 Ga0373933_0018331 3300035724 Bacteria 3935
376 Ga0373937_0132716 3300036401 Bacteria 2327
377 Ga0373937_1048204 3300036401 Bacteria 764
378 Ga0373925_0006466 3300037068 Bacteria 8618
379 Ga0373925_0413370 3300037068 Bacteria 1101
380 Ga0395905_1178099 3300037471 Bacteria 670
381 Ga0436364_0128244 3300037853 Bacteria 654
382 Ga0395901_0113223 3300038443 Bacteria 2849
383 Ga0395901_1621186 3300038443 Bacteria 600
384 Ga0436365_0033990 3300039437 Bacteria 1096
385 Ga0436365_1869046 3300039437 Bacteria 743
386 Ga0436360_0413036 3300039438 Bacteria 1075
387 Ga0436360_0896156 3300039438 Bacteria 1096
388 Ga0436361_0926373 3300039447 Bacteria 19457
389 Ga0436363_1633486 3300039450 Bacteria 755
390 Ga0436363_1657510 3300039450 Bacteria 612
391 Ga0451841_0788803 3300041498 Bacteria 586
392 Ga0451853_2634307 3300041512 Bacteria 962
393 Ga0439441_031703 3300042001 Bacteria 1027
394 Ga0439443_010084 3300042003 Bacteria 1365
395 Ga0439435_0002379 3300042436 Bacteria 3720
396 Ga0439460_0180197 3300042461 Bacteria 714
397 Ga0450893_0085525 3300042532 Bacteria 628
398 Ga0466968_0276667 3300044735 Bacteria 802
399 Ga0451576_0001011 3300045051 Bacteria 51991
400 Ga0451576_0241493 3300045051 Bacteria 1887
401 Ga0451576_0358305 3300045051 Bacteria 1527
402 Ga0495592_0268999 3300046454 Bacteria 1119
403 Ga0495603_0008846 3300046455 Bacteria 6085
404 Ga0495629_0333837 3300046459 Bacteria 1035
405 Ga0495629_0499191 3300046459 Bacteria 821
406 Ga0495638_0027928 3300046460 Bacteria 3648
407 Ga0495641_0028669 3300046461 Bacteria 2691
408 Ga0495641_0102638 3300046461 Bacteria 1276
409 Ga0495653_0313880 3300046463 Bacteria 1018
410 Ga0495580_0758573 3300046472 Bacteria 631
411 Ga0495582_0111548 3300046473 Bacteria 1536
412 Ga0495605_0155459 3300046474 Bacteria 1018
413 Ga0495662_0060797 3300046476 Bacteria 1824
414 Ga0495584_0010255 3300046491 Bacteria 4814
415 Ga0495584_0040689 3300046491 Bacteria 2347
416 Ga0495584_0127559 3300046491 Bacteria 1290
417 Ga0495584_0131112 3300046491 Bacteria 1272
418 Ga0495607_0069443 3300046501 Bacteria 1972
419 Ga0495608_0155805 3300046511 Bacteria 1454
420 Ga0495610_0225990 3300046512 Bacteria 753
421 Ga0495616_0345026 3300046513 Bacteria 621
422 Ga0495618_0303500 3300046514 Bacteria 992
423 Ga0495618_0387980 3300046514 Bacteria 856
424 Ga0495620_0195366 3300046515 Bacteria 779
425 Ga0495628_0767550 3300046516 Bacteria 676
426 Ga0495630_0112151 3300046517 Bacteria 2065
427 Ga0495630_0307592 3300046517 Bacteria 1211
428 Ga0495637_0033329 3300046520 Bacteria 2263
429 Ga0495644_0043518 3300046523 Bacteria 1689
430 Ga0495663_0009521 3300046525 Bacteria 2697
431 Ga0495663_0166721 3300046525 Bacteria 758
432 Ga0495666_0070184 3300046526 Bacteria 1666
433 Ga0495666_0237281 3300046526 Bacteria 833
434 Ga0495642_0242218 3300046528 Bacteria 788
435 Ga0495642_0266100 3300046528 Bacteria 750
436 Ga0495652_0594597 3300046529 Bacteria 755
437 Ga0495640_0089125 3300046533 Bacteria 2038
438 Ga0495587_0499825 3300046536 Bacteria 672
439 Ga0495598_0001377 3300046537 Bacteria 4788
440 Ga0495598_0040263 3300046537 Bacteria 1362
441 Ga0495609_0229053 3300046538 Bacteria 770
442 Ga0495621_0286306 3300046539 Bacteria 680
443 Ga0495645_0298700 3300046543 Bacteria 1053
444 Ga0495622_0014213 3300046557 Bacteria 3697
445 Ga0495633_0247919 3300046558 Bacteria 813
446 Ga0495656_0026187 3300046615 Bacteria 2319
447 Ga0495668_0329714 3300046616 Bacteria 837
448 Ga0495634_0546705 3300046642 Bacteria 675
449 Ga0495611_0240218 3300046648 Bacteria 841
450 Ga0495659_0029541 3300046664 Bacteria 1904
451 Ga0495659_0102636 3300046664 Bacteria 1109
452 Ga0495659_0179833 3300046664 Bacteria 861
453 Ga0495659_0246137 3300046664 Bacteria 744
454 Ga0495661_0068016 3300046665 Bacteria 2091
455 Ga0495588_0018784 3300046674 Bacteria 3376
456 Ga0495646_0070063 3300046680 Bacteria 2067
457 Ga0495647_0377641 3300046681 Bacteria 648
458 Ga0495658_0047906 3300046683 Bacteria 2408
459 Ga0495658_0093185 3300046683 Bacteria 1787
460 Ga0495669_0033254 3300046684 Bacteria 2269
461 Ga0495613_0118543 3300046689 Bacteria 1902
462 Ga0495613_0135075 3300046689 Bacteria 1765
463 Ga0495624_0031919 3300046690 Bacteria 3419
464 Ga0495670_0035330 3300046691 Bacteria 2491
465 Ga0495671_0042607 3300046692 Bacteria 2281
466 Ga0495671_0626816 3300046692 Bacteria 511
467 Ga0495649_0079569 3300046694 Bacteria 1753
468 Ga0495600_0261478 3300046809 Bacteria 1099
469 Ga0495581_0107934 3300047315 Bacteria 1618
470 Ga0495581_0362557 3300047315 Bacteria 846
471 Ga0495604_0054313 3300047317 Bacteria 3092
472 Ga0495604_0242813 3300047317 Bacteria 1231
473 Ga0495674_0198305 3300047319 Bacteria 1666
474 Ga0495674_0215273 3300047319 Bacteria 1590
475 Ga0495674_0445243 3300047319 Bacteria 1041
476 Ga0495676_0077096 3300047321 Bacteria 2542
477 Ga0495676_0138827 3300047321 Bacteria 1744
478 Ga0495680_0162340 3300047322 Bacteria 1622
479 Ga0495680_0253760 3300047322 Bacteria 1246
480 Ga0495680_0560824 3300047322 Bacteria 768
481 Ga0495683_0082792 3300047323 Bacteria 1563
482 Ga0495677_0336906 3300047445 Bacteria 595
483 Ga0495673_0249049 3300047469 Bacteria 649
484 Ga0495684_0453994 3300047471 Bacteria 890
485 Ga0495593_0179193 3300047673 Bacteria 1067
486 Ga0495602_0313810 3300048088 Bacteria 1143
487 Ga0495626_0147336 3300048091 Bacteria 995
488 Ga0496100_0085059 3300048903 Bacteria 2145
489 Ga0496100_0108408 3300048903 Bacteria 1926
490 Ga0496101_0005989 3300048904 Bacteria 7795
491 Ga0496102_0004367 3300048905 Bacteria 11948
492 Ga0496102_0522547 3300048905 Bacteria 1109
493 Ga0496102_0528153 3300048905 Bacteria 1102
494 Ga0496102_1599717 3300048905 Bacteria 570
495 Ga0496103_0038315 3300048906 Bacteria 2940
496 Ga0496103_0138543 3300048906 Bacteria 1555
497 Ga0496104_0001514 3300048907 Bacteria 20053
498 Ga0496104_0002405 3300048907 Bacteria 16114
499 Ga0496104_0010373 3300048907 Bacteria 8322
500 Ga0496104_0152132 3300048907 Bacteria 2220
501 Ga0496105_0001433 3300048908 Bacteria 16775
502 Ga0496105_0015510 3300048908 Bacteria 6074
503 Ga0496105_0043404 3300048908 Bacteria 3708
504 Ga0496106_0002564 3300048909 Bacteria 13516
505 Ga0496106_0090643 3300048909 Bacteria 2359
506 Ga0496106_0216906 3300048909 Bacteria 1525
507 Ga0496107_0037178 3300048910 Bacteria 3493
508 Ga0496107_0355690 3300048910 Bacteria 1090
509 Ga0496108_0001000 3300048911 Bacteria 22074
510 Ga0496108_0157204 3300048911 Bacteria 1963
511 Ga0496108_0406611 3300048911 Bacteria 1189
512 Ga0496109_0000796 3300048912 Bacteria 26244
513 Ga0496109_0048468 3300048912 Bacteria 3865
514 Ga0496109_0195787 3300048912 Bacteria 1899
515 Ga0496109_0290946 3300048912 Bacteria 1540
516 Ga0496110_0015804 3300048913 Bacteria 6292
517 Ga0496110_0049074 3300048913 Bacteria 3701
518 Ga0496110_0117127 3300048913 Bacteria 2399
519 Ga0496110_0537023 3300048913 Bacteria 1063
520 Ga0496111_0020981 3300048914 Bacteria 4554
521 Ga0496111_0073078 3300048914 Bacteria 2497
522 Ga0496111_0416203 3300048914 Bacteria 993
523 Ga0496112_0000476 3300048915 Bacteria 26879
524 Ga0496112_0168369 3300048915 Bacteria 2157
525 Ga0496112_0214512 3300048915 Bacteria 1881
526 Ga0496112_1055184 3300048915 Bacteria 731
527 Ga0496113_0000247 3300048916 Bacteria 25543
528 Ga0496114_0420670 3300048917 Bacteria 1183
529 Ga0496114_0768348 3300048917 Bacteria 841
530 Ga0496115_0055008 3300048918 Bacteria 3196
531 Ga0496115_0055800 3300048918 Bacteria 3174
532 Ga0496115_0224842 3300048918 Bacteria 1548
533 Ga0496115_0362683 3300048918 Bacteria 1180
534 Ga0501032_0351777 3300049569 Bacteria 949
535 Ga0501032_0784214 3300049569 Bacteria 602
536 Ga0501033_0137745 3300049570 Bacteria 1766
537 Ga0501034_0016043 3300049571 Bacteria 7687
538 Ga0501036_0044637 3300049572 Bacteria 3755
539 Ga0501036_0211976 3300049572 Bacteria 1627
540 Ga0501036_0328666 3300049572 Bacteria 1277
541 Ga0501037_0066756 3300049573 Bacteria 2620
542 Ga0501037_0496916 3300049573 Bacteria 828
543 Ga0501038_0185165 3300049574 Bacteria 1678
544 Ga0501039_0038492 3300049575 Bacteria 3693
545 Ga0501039_0040879 3300049575 Bacteria 3579
546 Ga0501040_0005009 3300049576 Bacteria 8566
547 Ga0501040_0012423 3300049576 Bacteria 5580
548 Ga0501040_0016503 3300049576 Bacteria 4890
549 Ga0501040_0088923 3300049576 Bacteria 2145
550 Ga0501041_0005100 3300049577 Bacteria 7661
551 Ga0501041_0006778 3300049577 Bacteria 6712
552 Ga0501041_0010247 3300049577 Bacteria 5523
553 Ga0501043_0021134 3300049579 Bacteria 5102
554 Ga0501043_0074910 3300049579 Bacteria 2659
555 Ga0501046_0050564 3300049580 Bacteria 3283
556 Ga0501046_0580895 3300049580 Bacteria 796
557 Ga0501046_0766500 3300049580 Bacteria 677
558 Ga0501048_0048310 3300049582 Bacteria 3036
559 Ga0501048_0179561 3300049582 Bacteria 1500
560 Ga0501068_0015908 3300049584 Bacteria 4332
561 Ga0501068_0037492 3300049584 Bacteria 2902
562 Ga0501068_0372509 3300049584 Bacteria 919
563 Ga0501070_0476470 3300049586 Bacteria 1004
564 Ga0501071_0033677 3300049587 Bacteria 3640
565 Ga0501071_0692836 3300049587 Bacteria 784
566 Ga0501072_0006855 3300049588 Bacteria 8647
567 Ga0501072_0023786 3300049588 Bacteria 4759
568 Ga0501073_0037597 3300049589 Bacteria 3435
569 Ga0501073_0439585 3300049589 Bacteria 902
570 Ga0501074_0031647 3300049590 Bacteria 3833
571 Ga0501074_0125825 3300049590 Bacteria 1833
572 Ga0501074_0930862 3300049590 Bacteria 611
573 Ga0501075_0003655 3300049591 Bacteria 10317
574 Ga0501075_0082723 3300049591 Bacteria 2431
575 Ga0501076_0000778 3300049592 Bacteria 20562
576 Ga0501076_0003675 3300049592 Bacteria 10785
577 Ga0501076_0613385 3300049592 Bacteria 898
578 Ga0501077_0044313 3300049593 Bacteria 2826
579 Ga0501077_0210342 3300049593 Bacteria 1236
580 Ga0501230_098241 3300049667 Bacteria 629
581 Ga0501079_0017301 3300049741 Bacteria 5505
582 Ga0501079_0021835 3300049741 Bacteria 4901
583 Ga0501079_0172570 3300049741 Bacteria 1686
584 Ga0501079_0738854 3300049741 Bacteria 775
585 Ga0501080_0016458 3300049742 Bacteria 6829
586 Ga0501080_0017334 3300049742 Bacteria 6658
587 Ga0501080_0030755 3300049742 Bacteria 5002
588 Ga0501081_0000811 3300049743 Bacteria 18451
589 Ga0501081_0004676 3300049743 Bacteria 8798
590 Ga0501035_0112949 3300049822 Bacteria 2380
591 Ga0501035_0159828 3300049822 Bacteria 1951
592 Ga0501044_0247039 3300049823 Bacteria 1727
593 Ga0501045_0009308 3300049824 Bacteria 6872
594 Ga0501045_0052146 3300049824 Bacteria 2986
595 nmdc:mga03683_36794_c2 3300050489 Bacteria 1002
596 nmdc:mga03n38_403923_c1 3300050490 Bacteria 752
597 nmdc:mga00v17_15271_c1 3300050491 Bacteria 4307
598 nmdc:mga00v17_461305_c1 3300050491 Bacteria 824
599 nmdc:mga0yw44_157579_c1 3300050492 Bacteria 1485
600 nmdc:mga0yw44_279395_c1 3300050492 Bacteria 1116
601 nmdc:mga0yw44_300524_c1 3300050492 Bacteria 1075
602 nmdc:mga0k408_29654_c1 3300050493 Bacteria 1193
603 nmdc:mga06z11_133389_c1 3300050494 Bacteria 1397
604 nmdc:mga06z11_272613_c1 3300050494 Bacteria 1001
605 nmdc:mga04h51_5555_c1 3300050495 Bacteria 3219
606 nmdc:mga07m45_136346_c1 3300050496 Bacteria 1421
607 nmdc:mga05p37_1522919_c1 3300050507 Bacteria 664
608 nmdc:mga05p37_162879_c1 3300050507 Bacteria 2723
609 nmdc:mga05p37_35564_c1 3300050507 Bacteria 6108
610 nmdc:mga05p37_413812_c1 3300050507 Bacteria 1571
611 nmdc:mga05p37_483507_c1 3300050507 Bacteria 1425
612 nmdc:mga05p37_597536_c1 3300050507 Bacteria 1246
613 nmdc:mga05p37_65954_c1 3300050507 Bacteria 4454
614 nmdc:mga09592_219051_c1 3300050508 Bacteria 1649
615 nmdc:mga09592_759720_c1 3300050508 Bacteria 822
616 nmdc:mga0qj67_119206_c1 3300050509 Bacteria 2134
617 nmdc:mga0qj67_14086_c1 3300050509 Bacteria 6039
618 nmdc:mga0qj67_233204_c1 3300050509 Bacteria 1493
619 nmdc:mga0qj67_37_c1 3300050509 Bacteria 92978
620 nmdc:mga0qj67_433206_c1 3300050509 Bacteria 1060
621 nmdc:mga06r32_100411_c1 3300050510 Bacteria 2839
622 nmdc:mga06r32_190951_c1 3300050510 Bacteria 2036
623 nmdc:mga06r32_19965_c1 3300050510 Bacteria 6160
624 nmdc:mga06r32_434933_c1 3300050510 Bacteria 1293
625 nmdc:mga06r32_827733_c1 3300050510 Bacteria 885
626 nmdc:mga08y16_146228_c1 3300050511 Bacteria 2457
627 nmdc:mga08y16_178249_c1 3300050511 Bacteria 2207
628 nmdc:mga08y16_445810_c1 3300050511 Bacteria 1320
629 nmdc:mga08y16_97419_c1 3300050511 Bacteria 3063
630 nmdc:mga0n895_116878_c1 3300050512 Bacteria 2686
631 nmdc:mga0n895_27822_c1 3300050512 Bacteria 5373
632 nmdc:mga0n895_434508_c1 3300050512 Bacteria 1326
633 nmdc:mga0rr50_1113976_c1 3300050513 Bacteria 671
634 nmdc:mga0rr50_150121_c1 3300050513 Bacteria 1882
635 nmdc:mga0rr50_209563_c1 3300050513 Bacteria 1605
636 nmdc:mga08x19_273952_c1 3300050514 Bacteria 1168
637 nmdc:mga0a205_400377_c1 3300050515 Bacteria 1236
638 nmdc:mga0sz30_17451_c1 3300050516 Bacteria 2863
639 Ga0495601_0040523 3300053077 Bacteria 2917
640 Ga0495601_0301119 3300053077 Bacteria 1044
641 Ga0495612_0039532 3300053078 Bacteria 1919
642 Ga0495612_0116298 3300053078 Bacteria 1148
643 Ga0495612_0134173 3300053078 Bacteria 1071
644 Ga0495655_0018253 3300053083 Bacteria 1539
645 Ga0495655_0040008 3300053083 Bacteria 1191
646 Ga0495595_0008961 3300053084 Bacteria 4126
647 Ga0495595_0203020 3300053084 Bacteria 987
648 Ga0495619_0007761 3300053085 Bacteria 6791
649 Ga0495619_0073057 3300053085 Bacteria 2298
650 Ga0495619_0136034 3300053085 Bacteria 1690
651 Ga0495619_0975068 3300053085 Bacteria 568
652 Ga0500578_0644809 3300053086 Bacteria 576
653 Ga0500621_247740 3300053126 Bacteria 600
654 Ga0500568_0291704 3300053139 Bacteria 592
655 Ga0500587_026984 3300053739 Bacteria 772
656 Ga0501084_0411967 3300054114 Bacteria 1142
657 Ga0501082_0002254 3300060353 Bacteria 16885
658 Ga0501082_0020235 3300060353 Bacteria 5735
659 Ga0501082_0711896 3300060353 Bacteria 879
660 Ga0501082_0893467 3300060353 Bacteria 777
661 Ga0530510_0000247 3300061734 Bacteria 33846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0580895 Ga0501046_0580895_364_780 138
2 3300025918 Ga0207662_10240217 Ga0207662_102402174 141
3 3300025893 Ga0207682_10106712 Ga0207682_101067122 142
4 3300035083 Ga0373926_0196061 Ga0373926_0196061_330_767 145
5 3300049571 Ga0501034_0016043 Ga0501034_0016043_178_618 145
6 3300046512 Ga0495610_0225990 Ga0495610_0225990_59_517 146
7 3300046515 Ga0495620_0195366 Ga0495620_0195366_249_707 146
8 3300046528 Ga0495642_0266100 Ga0495642_0266100_38_496 146
9 3300046684 Ga0495669_0033254 Ga0495669_0033254_795_1253 146
10 3300046692 Ga0495671_0626816 Ga0495671_0626816_28_486 146
11 3300047469 Ga0495673_0249049 Ga0495673_0249049_116_574 146
12 3300053126 Ga0500621_247740 Ga0500621_247740_39_497 146
13 3300053139 Ga0500568_0291704 Ga0500568_0291704_122_580 146
14 3300053739 Ga0500587_026984 Ga0500587_026984_66_524 146
15 3300005334 Ga0068869_100074085 Ga0068869_1000740853 148
16 3300005459 Ga0068867_100271209 Ga0068867_1002712091 148
17 3300009148 Ga0105243_10071374 Ga0105243_100713742 148
18 3300009551 Ga0105238_10483143 Ga0105238_104831431 148
19 3300013306 Ga0163162_10779196 Ga0163162_107791961 148
20 3300025931 Ga0207644_10998987 Ga0207644_109989872 148
21 3300025935 Ga0207709_10012652 Ga0207709_100126522 148
22 3300005330 Ga0070690_100547308 Ga0070690_1005473082 149
23 3300005356 Ga0070674_100301417 Ga0070674_1003014172 149
24 3300005718 Ga0068866_10269137 Ga0068866_102691372 149
25 3300006358 Ga0068871_100109638 Ga0068871_1001096382 149
26 3300009176 Ga0105242_10107759 Ga0105242_101077592 149
27 3300009176 Ga0105242_10926624 Ga0105242_109266242 149
28 3300009553 Ga0105249_10780319 Ga0105249_107803192 149
29 3300014969 Ga0157376_10026276 Ga0157376_100262762 149
30 3300017792 Ga0163161_10666999 Ga0163161_106669991 149
31 3300025899 Ga0207642_10170375 Ga0207642_101703752 149
32 3300025937 Ga0207669_10150832 Ga0207669_101508322 149
33 3300025961 Ga0207712_11503265 Ga0207712_115032651 149
34 3300026023 Ga0207677_10345603 Ga0207677_103456032 149
35 3300026089 Ga0207648_10545603 Ga0207648_105456032 149
36 3300035692 Ga0373935_0447204 Ga0373935_0447204_157_609 149
37 3300039438 Ga0436360_0896156 Ga0436360_0896156_445_912 149
38 3300039450 Ga0436363_1657510 Ga0436363_1657510_128_595 149
39 3300045051 Ga0451576_0001011 Ga0451576_0001011_33779_34237 149
40 3300046454 Ga0495592_0268999 Ga0495592_0268999_376_843 149
41 3300046463 Ga0495653_0313880 Ga0495653_0313880_182_649 149
42 3300046511 Ga0495608_0155805 Ga0495608_0155805_680_1147 149
43 3300046514 Ga0495618_0387980 Ga0495618_0387980_28_495 149
44 3300046529 Ga0495652_0594597 Ga0495652_0594597_289_744 149
45 3300046536 Ga0495587_0499825 Ga0495587_0499825_36_503 149
46 3300046809 Ga0495600_0261478 Ga0495600_0261478_136_603 149
47 3300047317 Ga0495604_0054313 Ga0495604_0054313_2219_2686 149
48 3300047471 Ga0495684_0453994 Ga0495684_0453994_219_686 149
49 3300048088 Ga0495602_0313810 Ga0495602_0313810_292_759 149
50 3300049584 Ga0501068_0015908 Ga0501068_0015908_3648_4097 149
51 3300049586 Ga0501070_0476470 Ga0501070_0476470_377_826 149
52 3300049589 Ga0501073_0037597 Ga0501073_0037597_597_1046 149
53 3300049590 Ga0501074_0031647 Ga0501074_0031647_1541_1990 149
54 3300049742 Ga0501080_0030755 Ga0501080_0030755_4138_4587 149
55 3300053077 Ga0495601_0040523 Ga0495601_0040523_722_1189 149
56 3300053078 Ga0495612_0039532 Ga0495612_0039532_104_571 149
57 3300053084 Ga0495595_0008961 Ga0495595_0008961_3503_3970 149
58 3300053085 Ga0495619_0136034 Ga0495619_0136034_971_1438 149
59 3300053085 Ga0495619_0975068 Ga0495619_0975068_38_490 149
60 3300054114 Ga0501084_0411967 Ga0501084_0411967_26_475 149
61 3300060353 Ga0501082_0711896 Ga0501082_0711896_210_659 149
62 3300002075 JGI24738J21930_10089683 JGI24738J21930_100896831 150
63 3300003203 JGI25406J46586_10019721 JGI25406J46586_100197212 150
64 3300003215 JGI25153J46596_10046480 JGI25153J46596_100464801 150
65 3300005328 Ga0070676_10297780 Ga0070676_102977801 150
66 3300005328 Ga0070676_10575508 Ga0070676_105755082 150
67 3300005329 Ga0070683_100595733 Ga0070683_1005957332 150
68 3300005329 Ga0070683_101064341 Ga0070683_1010643412 150
69 3300005330 Ga0070690_100097605 Ga0070690_1000976052 150
70 3300005330 Ga0070690_100619143 Ga0070690_1006191431 150
71 3300005331 Ga0070670_102154551 Ga0070670_1021545511 150
72 3300005333 Ga0070677_10214350 Ga0070677_102143502 150
73 3300005334 Ga0068869_100110048 Ga0068869_1001100482 150
74 3300005335 Ga0070666_10450101 Ga0070666_104501012 150
75 3300005335 Ga0070666_10874670 Ga0070666_108746701 150
76 3300005337 Ga0070682_100981176 Ga0070682_1009811761 150
77 3300005338 Ga0068868_100497971 Ga0068868_1004979711 150
78 3300005338 Ga0068868_100674307 Ga0068868_1006743072 150
79 3300005339 Ga0070660_100160134 Ga0070660_1001601342 150
80 3300005340 Ga0070689_100023592 Ga0070689_1000235922 150
81 3300005340 Ga0070689_100618441 Ga0070689_1006184412 150
82 3300005340 Ga0070689_100979023 Ga0070689_1009790231 150
83 3300005343 Ga0070687_100172413 Ga0070687_1001724132 150
84 3300005344 Ga0070661_100047200 Ga0070661_1000472002 150
85 3300005345 Ga0070692_10021173 Ga0070692_100211734 150
86 3300005345 Ga0070692_10143702 Ga0070692_101437021 150
87 3300005347 Ga0070668_100077039 Ga0070668_1000770392 150
88 3300005353 Ga0070669_100026933 Ga0070669_1000269332 150
89 3300005353 Ga0070669_100238826 Ga0070669_1002388262 150
90 3300005353 Ga0070669_100345876 Ga0070669_1003458762 150
91 3300005353 Ga0070669_100686572 Ga0070669_1006865721 150
92 3300005354 Ga0070675_100725841 Ga0070675_1007258411 150
93 3300005355 Ga0070671_100592454 Ga0070671_1005924542 150
94 3300005355 Ga0070671_100772364 Ga0070671_1007723642 150
95 3300005355 Ga0070671_100814177 Ga0070671_1008141772 150
96 3300005356 Ga0070674_100121072 Ga0070674_1001210722 150
97 3300005364 Ga0070673_100239335 Ga0070673_1002393352 150
98 3300005364 Ga0070673_100376511 Ga0070673_1003765112 150
99 3300005365 Ga0070688_100007930 Ga0070688_1000079304 150
100 3300005366 Ga0070659_100158881 Ga0070659_1001588812 150
101 3300005366 Ga0070659_100231523 Ga0070659_1002315232 150
102 3300005406 Ga0070703_10219013 Ga0070703_102190132 150
103 3300005436 Ga0070713_101218478 Ga0070713_1012184781 150
104 3300005437 Ga0070710_10074578 Ga0070710_100745783 150
105 3300005438 Ga0070701_10041962 Ga0070701_100419622 150
106 3300005438 Ga0070701_10140038 Ga0070701_101400382 150
107 3300005439 Ga0070711_100048438 Ga0070711_1000484382 150
108 3300005440 Ga0070705_100325872 Ga0070705_1003258722 150
109 3300005440 Ga0070705_100670385 Ga0070705_1006703852 150
110 3300005441 Ga0070700_100030843 Ga0070700_1000308432 150
111 3300005444 Ga0070694_100003687 Ga0070694_1000036876 150
112 3300005444 Ga0070694_100011986 Ga0070694_1000119862 150
113 3300005444 Ga0070694_100515033 Ga0070694_1005150332 150
114 3300005445 Ga0070708_100035446 Ga0070708_1000354462 150
115 3300005456 Ga0070678_100205201 Ga0070678_1002052011 150
116 3300005456 Ga0070678_100427434 Ga0070678_1004274341 150
117 3300005457 Ga0070662_100119227 Ga0070662_1001192272 150
118 3300005459 Ga0068867_100240203 Ga0068867_1002402032 150
119 3300005466 Ga0070685_10852788 Ga0070685_108527881 150
120 3300005468 Ga0070707_100132410 Ga0070707_1001324102 150
121 3300005535 Ga0070684_100079560 Ga0070684_1000795602 150
122 3300005536 Ga0070697_100069775 Ga0070697_1000697752 150
123 3300005543 Ga0070672_100166225 Ga0070672_1001662252 150
124 3300005543 Ga0070672_100228744 Ga0070672_1002287442 150
125 3300005543 Ga0070672_100281624 Ga0070672_1002816242 150
126 3300005544 Ga0070686_100016847 Ga0070686_1000168473 150
127 3300005544 Ga0070686_100135417 Ga0070686_1001354172 150
128 3300005545 Ga0070695_100024926 Ga0070695_1000249262 150
129 3300005545 Ga0070695_101099167 Ga0070695_1010991671 150
130 3300005546 Ga0070696_100857490 Ga0070696_1008574902 150
131 3300005546 Ga0070696_101213883 Ga0070696_1012138831 150
132 3300005547 Ga0070693_100006517 Ga0070693_1000065173 150
133 3300005548 Ga0070665_101024468 Ga0070665_1010244682 150
134 3300005549 Ga0070704_100006684 Ga0070704_1000066847 150
135 3300005563 Ga0068855_100606402 Ga0068855_1006064022 150
136 3300005577 Ga0068857_100619536 Ga0068857_1006195362 150
137 3300005578 Ga0068854_100808536 Ga0068854_1008085362 150
138 3300005615 Ga0070702_100404488 Ga0070702_1004044882 150
139 3300005616 Ga0068852_100067879 Ga0068852_1000678792 150
140 3300005616 Ga0068852_101206056 Ga0068852_1012060562 150
141 3300005617 Ga0068859_100126230 Ga0068859_1001262302 150
142 3300005617 Ga0068859_101113117 Ga0068859_1011131172 150
143 3300005618 Ga0068864_100052031 Ga0068864_1000520313 150
144 3300005618 Ga0068864_100142366 Ga0068864_1001423662 150
145 3300005618 Ga0068864_100200050 Ga0068864_1002000502 150
146 3300005718 Ga0068866_10576982 Ga0068866_105769821 150
147 3300005719 Ga0068861_100146736 Ga0068861_1001467362 150
148 3300005834 Ga0068851_10299804 Ga0068851_102998042 150
149 3300005840 Ga0068870_10064212 Ga0068870_100642122 150
150 3300005841 Ga0068863_100216665 Ga0068863_1002166652 150
151 3300005841 Ga0068863_100871778 Ga0068863_1008717782 150
152 3300005842 Ga0068858_100185575 Ga0068858_1001855752 150
153 3300005842 Ga0068858_100232871 Ga0068858_1002328712 150
154 3300005843 Ga0068860_100998422 Ga0068860_1009984222 150
155 3300005844 Ga0068862_100320016 Ga0068862_1003200162 150
156 3300005937 Ga0081455_10000759 Ga0081455_100007595 150
157 3300005937 Ga0081455_10004199 Ga0081455_100041996 150
158 3300005937 Ga0081455_10010372 Ga0081455_100103725 150
159 3300005937 Ga0081455_10063042 Ga0081455_100630422 150
160 3300005937 Ga0081455_10141522 Ga0081455_101415222 150
161 3300005981 Ga0081538_10000527 Ga0081538_1000052736 150
162 3300005981 Ga0081538_10033045 Ga0081538_100330452 150
163 3300005981 Ga0081538_10048084 Ga0081538_100480842 150
164 3300005983 Ga0081540_1166045 Ga0081540_11660452 150
165 3300005985 Ga0081539_10002942 Ga0081539_100029429 150
166 3300005985 Ga0081539_10087764 Ga0081539_100877641 150
167 3300006028 Ga0070717_10106475 Ga0070717_101064752 150
168 3300006028 Ga0070717_10485425 Ga0070717_104854252 150
169 3300006028 Ga0070717_10518270 Ga0070717_105182701 150
170 3300006038 Ga0075365_10039069 Ga0075365_100390694 150
171 3300006038 Ga0075365_10142034 Ga0075365_101420342 150
172 3300006038 Ga0075365_10343832 Ga0075365_103438322 150
173 3300006038 Ga0075365_10493475 Ga0075365_104934752 150
174 3300006042 Ga0075368_10084706 Ga0075368_100847061 150
175 3300006048 Ga0075363_100026412 Ga0075363_1000264124 150
176 3300006048 Ga0075363_100465669 Ga0075363_1004656692 150
177 3300006051 Ga0075364_10019489 Ga0075364_100194892 150
178 3300006051 Ga0075364_10690583 Ga0075364_106905832 150
179 3300006163 Ga0070715_10852957 Ga0070715_108529572 150
180 3300006173 Ga0070716_100131238 Ga0070716_1001312382 150
181 3300006175 Ga0070712_100009604 Ga0070712_1000096042 150
182 3300006175 Ga0070712_100107264 Ga0070712_1001072642 150
183 3300006177 Ga0075362_10018592 Ga0075362_100185924 150
184 3300006177 Ga0075362_10132460 Ga0075362_101324602 150
185 3300006178 Ga0075367_10248972 Ga0075367_102489721 150
186 3300006178 Ga0075367_10271422 Ga0075367_102714221 150
187 3300006178 Ga0075367_10524505 Ga0075367_105245051 150
188 3300006186 Ga0075369_10058702 Ga0075369_100587022 150
189 3300006194 Ga0075427_10109129 Ga0075427_101091291 150
190 3300006195 Ga0075366_10503492 Ga0075366_105034922 150
191 3300006237 Ga0097621_100040897 Ga0097621_1000408972 150
192 3300006237 Ga0097621_100640210 Ga0097621_1006402102 150
193 3300006237 Ga0097621_101063444 Ga0097621_1010634442 150
194 3300006358 Ga0068871_100456919 Ga0068871_1004569191 150
195 3300006358 Ga0068871_100697771 Ga0068871_1006977712 150
196 3300006844 Ga0075428_100024058 Ga0075428_1000240583 150
197 3300006844 Ga0075428_100125159 Ga0075428_1001251592 150
198 3300006844 Ga0075428_100214072 Ga0075428_1002140724 150
199 3300006844 Ga0075428_100216748 Ga0075428_1002167482 150
200 3300006844 Ga0075428_100338704 Ga0075428_1003387042 150
201 3300006844 Ga0075428_100512275 Ga0075428_1005122752 150
202 3300006846 Ga0075430_100000293 Ga0075430_1000002932 150
203 3300006846 Ga0075430_100001577 Ga0075430_1000015775 150
204 3300006846 Ga0075430_100459574 Ga0075430_1004595742 150
205 3300006846 Ga0075430_100464074 Ga0075430_1004640742 150
206 3300006847 Ga0075431_100030912 Ga0075431_1000309123 150
207 3300006847 Ga0075431_100032198 Ga0075431_1000321985 150
208 3300006847 Ga0075431_100111833 Ga0075431_1001118332 150
209 3300006847 Ga0075431_100225009 Ga0075431_1002250092 150
210 3300006871 Ga0075434_100095598 Ga0075434_1000955982 150
211 3300006871 Ga0075434_100136338 Ga0075434_1001363382 150
212 3300006871 Ga0075434_100366761 Ga0075434_1003667612 150
213 3300006880 Ga0075429_100281422 Ga0075429_1002814222 150
214 3300006880 Ga0075429_100966682 Ga0075429_1009666822 150
215 3300006880 Ga0075429_100969516 Ga0075429_1009695161 150
216 3300006881 Ga0068865_100097342 Ga0068865_1000973422 150
217 3300006881 Ga0068865_100340588 Ga0068865_1003405882 150
218 3300006914 Ga0075436_100209768 Ga0075436_1002097682 150
219 3300006931 Ga0097620_100126237 Ga0097620_1001262372 150
220 3300006931 Ga0097620_101112925 Ga0097620_1011129252 150
221 3300007076 Ga0075435_100208583 Ga0075435_1002085832 150
222 3300007076 Ga0075435_100859192 Ga0075435_1008591922 150
223 3300007265 Ga0099794_10013326 Ga0099794_100133263 150
224 3300007265 Ga0099794_10491223 Ga0099794_104912231 150
225 3300009093 Ga0105240_11516977 Ga0105240_115169772 150
226 3300009094 Ga0111539_10075711 Ga0111539_100757113 150
227 3300009094 Ga0111539_10099325 Ga0111539_100993252 150
228 3300009094 Ga0111539_10264076 Ga0111539_102640762 150
229 3300009094 Ga0111539_10277312 Ga0111539_102773122 150
230 3300009098 Ga0105245_10411220 Ga0105245_104112201 150
231 3300009098 Ga0105245_11409243 Ga0105245_114092431 150
232 3300009101 Ga0105247_10127779 Ga0105247_101277792 150
233 3300009101 Ga0105247_10477672 Ga0105247_104776721 150
234 3300009147 Ga0114129_10005790 Ga0114129_100057902 150
235 3300009147 Ga0114129_10165790 Ga0114129_101657903 150
236 3300009147 Ga0114129_10271606 Ga0114129_102716061 150
237 3300009147 Ga0114129_10585481 Ga0114129_105854812 150
238 3300009147 Ga0114129_10801205 Ga0114129_108012052 150
239 3300009147 Ga0114129_10944446 Ga0114129_109444461 150
240 3300009148 Ga0105243_10159711 Ga0105243_101597112 150
241 3300009148 Ga0105243_11093442 Ga0105243_110934422 150
242 3300009148 Ga0105243_11229740 Ga0105243_112297402 150
243 3300009174 Ga0105241_10766728 Ga0105241_107667282 150
244 3300009176 Ga0105242_10825329 Ga0105242_108253291 150
245 3300009176 Ga0105242_10860144 Ga0105242_108601442 150
246 3300009177 Ga0105248_10446646 Ga0105248_104466462 150
247 3300009553 Ga0105249_10189793 Ga0105249_101897932 150
248 3300010375 Ga0105239_10104142 Ga0105239_101041422 150
249 3300011119 Ga0105246_10101927 Ga0105246_101019272 150
250 3300011119 Ga0105246_10939827 Ga0105246_109398271 150
251 3300011119 Ga0105246_12408074 Ga0105246_124080741 150
252 3300013296 Ga0157374_10349988 Ga0157374_103499882 150
253 3300013297 Ga0157378_12159801 Ga0157378_121598011 150
254 3300013306 Ga0163162_10533824 Ga0163162_105338241 150
255 3300013306 Ga0163162_11593033 Ga0163162_115930331 150
256 3300013306 Ga0163162_11611157 Ga0163162_116111572 150
257 3300013307 Ga0157372_10687703 Ga0157372_106877032 150
258 3300013308 Ga0157375_10100676 Ga0157375_101006762 150
259 3300013308 Ga0157375_10413424 Ga0157375_104134242 150
260 3300014325 Ga0163163_10034194 Ga0163163_100341942 150
261 3300014325 Ga0163163_10346324 Ga0163163_103463242 150
262 3300014325 Ga0163163_10598338 Ga0163163_105983382 150
263 3300014326 Ga0157380_10165714 Ga0157380_101657142 150
264 3300014326 Ga0157380_10761502 Ga0157380_107615022 150
265 3300014745 Ga0157377_10390185 Ga0157377_103901851 150
266 3300014745 Ga0157377_10517871 Ga0157377_105178712 150
267 3300014968 Ga0157379_10125818 Ga0157379_101258182 150
268 3300014969 Ga0157376_10180521 Ga0157376_101805212 150
269 3300014969 Ga0157376_10678570 Ga0157376_106785702 150
270 3300017792 Ga0163161_10034179 Ga0163161_100341793 150
271 3300017792 Ga0163161_11457772 Ga0163161_114577722 150
272 3300021361 Ga0213872_10057372 Ga0213872_100573722 150
273 3300021377 Ga0213874_10334364 Ga0213874_103343642 150
274 3300021441 Ga0213871_10059506 Ga0213871_100595062 150
275 3300025297 Ga0209758_1000370 Ga0209758_100037059 150
276 3300025297 Ga0209758_1021862 Ga0209758_10218622 150
277 3300025302 Ga0207426_1135232 Ga0207426_11352321 150
278 3300025321 Ga0207656_10303219 Ga0207656_103032192 150
279 3300025885 Ga0207653_10075029 Ga0207653_100750292 150
280 3300025898 Ga0207692_10081064 Ga0207692_100810642 150
281 3300025899 Ga0207642_10224938 Ga0207642_102249382 150
282 3300025899 Ga0207642_10405828 Ga0207642_104058282 150
283 3300025900 Ga0207710_10108772 Ga0207710_101087721 150
284 3300025901 Ga0207688_10192639 Ga0207688_101926391 150
285 3300025903 Ga0207680_10263986 Ga0207680_102639862 150
286 3300025903 Ga0207680_10929128 Ga0207680_109291282 150
287 3300025904 Ga0207647_10067976 Ga0207647_100679762 150
288 3300025907 Ga0207645_10030990 Ga0207645_100309902 150
289 3300025907 Ga0207645_10548686 Ga0207645_105486862 150
290 3300025908 Ga0207643_10004252 Ga0207643_100042527 150
291 3300025910 Ga0207684_10063009 Ga0207684_100630092 150
292 3300025911 Ga0207654_10421065 Ga0207654_104210652 150
293 3300025912 Ga0207707_10416342 Ga0207707_104163422 150
294 3300025915 Ga0207693_10015564 Ga0207693_100155647 150
295 3300025915 Ga0207693_10655752 Ga0207693_106557521 150
296 3300025916 Ga0207663_10244854 Ga0207663_102448542 150
297 3300025917 Ga0207660_10026335 Ga0207660_100263351 150
298 3300025917 Ga0207660_10139252 Ga0207660_101392522 150
299 3300025917 Ga0207660_10348482 Ga0207660_103484822 150
300 3300025917 Ga0207660_10530646 Ga0207660_105306462 150
301 3300025917 Ga0207660_11214690 Ga0207660_112146901 150
302 3300025918 Ga0207662_10301374 Ga0207662_103013742 150
303 3300025918 Ga0207662_10442133 Ga0207662_104421332 150
304 3300025920 Ga0207649_10042503 Ga0207649_100425032 150
305 3300025923 Ga0207681_10016920 Ga0207681_100169202 150
306 3300025923 Ga0207681_10131231 Ga0207681_101312312 150
307 3300025923 Ga0207681_10205136 Ga0207681_102051362 150
308 3300025923 Ga0207681_10288767 Ga0207681_102887672 150
309 3300025925 Ga0207650_10004089 Ga0207650_100040895 150
310 3300025925 Ga0207650_11137188 Ga0207650_111371881 150
311 3300025926 Ga0207659_10246314 Ga0207659_102463142 150
312 3300025928 Ga0207700_10015702 Ga0207700_100157022 150
313 3300025928 Ga0207700_10448018 Ga0207700_104480182 150
314 3300025928 Ga0207700_11362032 Ga0207700_113620321 150
315 3300025929 Ga0207664_10469964 Ga0207664_104699641 150
316 3300025929 Ga0207664_10729006 Ga0207664_107290062 150
317 3300025931 Ga0207644_10649286 Ga0207644_106492861 150
318 3300025931 Ga0207644_10677431 Ga0207644_106774312 150
319 3300025932 Ga0207690_10065767 Ga0207690_100657672 150
320 3300025932 Ga0207690_10113690 Ga0207690_101136902 150
321 3300025933 Ga0207706_10008418 Ga0207706_100084186 150
322 3300025935 Ga0207709_10058670 Ga0207709_100586701 150
323 3300025935 Ga0207709_11189075 Ga0207709_111890751 150
324 3300025936 Ga0207670_10005087 Ga0207670_100050873 150
325 3300025936 Ga0207670_10369305 Ga0207670_103693051 150
326 3300025936 Ga0207670_10962477 Ga0207670_109624771 150
327 3300025937 Ga0207669_11104561 Ga0207669_111045611 150
328 3300025938 Ga0207704_11695228 Ga0207704_116952281 150
329 3300025940 Ga0207691_10139600 Ga0207691_101396002 150
330 3300025940 Ga0207691_10234506 Ga0207691_102345062 150
331 3300025940 Ga0207691_10432903 Ga0207691_104329032 150
332 3300025941 Ga0207711_10696294 Ga0207711_106962942 150
333 3300025942 Ga0207689_10167720 Ga0207689_101677202 150
334 3300025944 Ga0207661_10858151 Ga0207661_108581512 150
335 3300025944 Ga0207661_11195013 Ga0207661_111950132 150
336 3300025945 Ga0207679_11679444 Ga0207679_116794441 150
337 3300025960 Ga0207651_10326479 Ga0207651_103264792 150
338 3300025961 Ga0207712_10050584 Ga0207712_100505842 150
339 3300025972 Ga0207668_10043771 Ga0207668_100437711 150
340 3300025972 Ga0207668_11146463 Ga0207668_111464632 150
341 3300025981 Ga0207640_10154994 Ga0207640_101549942 150
342 3300025986 Ga0207658_10480841 Ga0207658_104808412 150
343 3300026023 Ga0207677_10229030 Ga0207677_102290302 150
344 3300026035 Ga0207703_10155221 Ga0207703_101552212 150
345 3300026067 Ga0207678_10047151 Ga0207678_100471512 150
346 3300026067 Ga0207678_10798983 Ga0207678_107989831 150
347 3300026075 Ga0207708_10020685 Ga0207708_100206853 150
348 3300026078 Ga0207702_10074357 Ga0207702_100743572 150
349 3300026088 Ga0207641_10246736 Ga0207641_102467361 150
350 3300026088 Ga0207641_10354494 Ga0207641_103544942 150
351 3300026089 Ga0207648_10012041 Ga0207648_100120412 150
352 3300026089 Ga0207648_10125539 Ga0207648_101255392 150
353 3300026095 Ga0207676_10015096 Ga0207676_100150965 150
354 3300026095 Ga0207676_10251147 Ga0207676_102511472 150
355 3300026095 Ga0207676_10368089 Ga0207676_103680891 150
356 3300026116 Ga0207674_11226746 Ga0207674_112267462 150
357 3300026118 Ga0207675_100202117 Ga0207675_1002021172 150
358 3300026118 Ga0207675_100361829 Ga0207675_1003618291 150
359 3300026118 Ga0207675_101681935 Ga0207675_1016819352 150
360 3300026121 Ga0207683_10143288 Ga0207683_101432882 150
361 3300026121 Ga0207683_10506832 Ga0207683_105068322 150
362 3300026121 Ga0207683_10530107 Ga0207683_105301072 150
363 3300026121 Ga0207683_10621976 Ga0207683_106219762 150
364 3300026142 Ga0207698_10317658 Ga0207698_103176582 150
365 3300026142 Ga0207698_10918862 Ga0207698_109188621 150
366 3300027671 Ga0209588_1094306 Ga0209588_10943062 150
367 3300027907 Ga0207428_10276158 Ga0207428_102761582 150
368 3300028379 Ga0268266_10575283 Ga0268266_105752831 150
369 3300028380 Ga0268265_10788184 Ga0268265_107881841 150
370 3300028381 Ga0268264_10068542 Ga0268264_100685421 150
371 3300028381 Ga0268264_11012215 Ga0268264_110122151 150
372 3300028381 Ga0268264_11982755 Ga0268264_119827552 150
373 3300031250 Ga0265331_10298426 Ga0265331_102984261 150
374 3300031548 Ga0307408_100092380 Ga0307408_1000923802 150
375 3300031548 Ga0307408_100996584 Ga0307408_1009965842 150
376 3300031730 Ga0307516_10027228 Ga0307516_100272288 150
377 3300031731 Ga0307405_10899979 Ga0307405_108999792 150
378 3300031903 Ga0307407_10041341 Ga0307407_100413412 150
379 3300031911 Ga0307412_11073290 Ga0307412_110732902 150
380 3300031995 Ga0307409_102705708 Ga0307409_1027057081 150
381 3300034818 Ga0373950_0092010 Ga0373950_0092010_136_588 150
382 3300035084 Ga0373928_0048318 Ga0373928_0048318_422_874 150
383 3300035085 Ga0373929_0029125 Ga0373929_0029125_171_629 150
384 3300035086 Ga0373934_0358659 Ga0373934_0358659_126_578 150
385 3300035090 Ga0373949_0178991 Ga0373949_0178991_10_462 150
386 3300035092 Ga0373952_0009255 Ga0373952_0009255_78_530 150
387 3300035092 Ga0373952_0076640 Ga0373952_0076640_361_813 150
388 3300035111 Ga0373923_0153370 Ga0373923_0153370_55_507 150
389 3300035111 Ga0373923_0333078 Ga0373923_0333078_216_668 150
390 3300035112 Ga0373932_0309722 Ga0373932_0309722_106_558 150
391 3300035113 Ga0373936_0031825 Ga0373936_0031825_1584_2036 150
392 3300035114 Ga0373939_0094841 Ga0373939_0094841_189_641 150
393 3300035114 Ga0373939_0228663 Ga0373939_0228663_73_525 150
394 3300035115 Ga0373941_0008268 Ga0373941_0008268_704_1156 150
395 3300035116 Ga0373945_0162314 Ga0373945_0162314_447_899 150
396 3300035118 Ga0373954_0225950 Ga0373954_0225950_278_730 150
397 3300035170 Ga0373943_0021213 Ga0373943_0021213_498_950 150
398 3300035170 Ga0373943_0231926 Ga0373943_0231926_213_665 150
399 3300035171 Ga0373946_0060480 Ga0373946_0060480_127_579 150
400 3300035171 Ga0373946_0098745 Ga0373946_0098745_229_681 150
401 3300035172 Ga0373955_0012761 Ga0373955_0012761_1191_1643 150
402 3300035241 Ga0373961_0037215 Ga0373961_0037215_531_983 150
403 3300035242 Ga0373962_0027944 Ga0373962_0027944_621_1073 150
404 3300035410 Ga0373924_0060495 Ga0373924_0060495_273_725 150
405 3300035691 Ga0373931_0003755 Ga0373931_0003755_5114_5566 150
406 3300035691 Ga0373931_0023964 Ga0373931_0023964_141_593 150
407 3300035691 Ga0373931_0207963 Ga0373931_0207963_45_497 150
408 3300035691 Ga0373931_0276994 Ga0373931_0276994_178_630 150
409 3300035692 Ga0373935_0066766 Ga0373935_0066766_1035_1487 150
410 3300035692 Ga0373935_0295121 Ga0373935_0295121_137_589 150
411 3300035724 Ga0373933_0018331 Ga0373933_0018331_788_1240 150
412 3300036401 Ga0373937_0132716 Ga0373937_0132716_912_1364 150
413 3300036401 Ga0373937_1048204 Ga0373937_1048204_16_468 150
414 3300037068 Ga0373925_0006466 Ga0373925_0006466_454_906 150
415 3300037068 Ga0373925_0413370 Ga0373925_0413370_501_953 150
416 3300037471 Ga0395905_1178099 Ga0395905_1178099_51_503 150
417 3300037853 Ga0436364_0128244 Ga0436364_0128244_168_620 150
418 3300038443 Ga0395901_0113223 Ga0395901_0113223_2271_2723 150
419 3300038443 Ga0395901_1621186 Ga0395901_1621186_36_488 150
420 3300039437 Ga0436365_0033990 Ga0436365_0033990_529_981 150
421 3300039437 Ga0436365_1869046 Ga0436365_1869046_213_665 150
422 3300039438 Ga0436360_0413036 Ga0436360_0413036_387_839 150
423 3300039447 Ga0436361_0926373 Ga0436361_0926373_16766_17218 150
424 3300039450 Ga0436363_1633486 Ga0436363_1633486_12_464 150
425 3300041498 Ga0451841_0788803 Ga0451841_0788803_13_465 150
426 3300041512 Ga0451853_2634307 Ga0451853_2634307_330_782 150
427 3300042001 Ga0439441_031703 Ga0439441_031703_112_564 150
428 3300042003 Ga0439443_010084 Ga0439443_010084_93_545 150
429 3300042436 Ga0439435_0002379 Ga0439435_0002379_1807_2259 150
430 3300042461 Ga0439460_0180197 Ga0439460_0180197_67_519 150
431 3300042532 Ga0450893_0085525 Ga0450893_0085525_99_551 150
432 3300044735 Ga0466968_0276667 Ga0466968_0276667_73_525 150
433 3300045051 Ga0451576_0241493 Ga0451576_0241493_923_1393 150
434 3300045051 Ga0451576_0358305 Ga0451576_0358305_11_463 150
435 3300046455 Ga0495603_0008846 Ga0495603_0008846_1108_1560 150
436 3300046459 Ga0495629_0333837 Ga0495629_0333837_529_981 150
437 3300046459 Ga0495629_0499191 Ga0495629_0499191_359_811 150
438 3300046460 Ga0495638_0027928 Ga0495638_0027928_2158_2610 150
439 3300046461 Ga0495641_0028669 Ga0495641_0028669_1208_1660 150
440 3300046461 Ga0495641_0102638 Ga0495641_0102638_250_702 150
441 3300046472 Ga0495580_0758573 Ga0495580_0758573_157_609 150
442 3300046473 Ga0495582_0111548 Ga0495582_0111548_195_647 150
443 3300046474 Ga0495605_0155459 Ga0495605_0155459_449_901 150
444 3300046476 Ga0495662_0060797 Ga0495662_0060797_165_617 150
445 3300046491 Ga0495584_0010255 Ga0495584_0010255_2364_2816 150
446 3300046491 Ga0495584_0040689 Ga0495584_0040689_776_1228 150
447 3300046491 Ga0495584_0127559 Ga0495584_0127559_615_1067 150
448 3300046491 Ga0495584_0131112 Ga0495584_0131112_147_599 150
449 3300046501 Ga0495607_0069443 Ga0495607_0069443_1044_1496 150
450 3300046513 Ga0495616_0345026 Ga0495616_0345026_46_498 150
451 3300046514 Ga0495618_0303500 Ga0495618_0303500_511_963 150
452 3300046516 Ga0495628_0767550 Ga0495628_0767550_213_665 150
453 3300046517 Ga0495630_0112151 Ga0495630_0112151_719_1171 150
454 3300046517 Ga0495630_0307592 Ga0495630_0307592_50_502 150
455 3300046520 Ga0495637_0033329 Ga0495637_0033329_987_1439 150
456 3300046523 Ga0495644_0043518 Ga0495644_0043518_468_920 150
457 3300046525 Ga0495663_0009521 Ga0495663_0009521_1847_2299 150
458 3300046525 Ga0495663_0166721 Ga0495663_0166721_44_499 150
459 3300046526 Ga0495666_0070184 Ga0495666_0070184_150_602 150
460 3300046526 Ga0495666_0237281 Ga0495666_0237281_95_547 150
461 3300046528 Ga0495642_0242218 Ga0495642_0242218_30_485 150
462 3300046533 Ga0495640_0089125 Ga0495640_0089125_1558_2010 150
463 3300046537 Ga0495598_0001377 Ga0495598_0001377_1472_1924 150
464 3300046537 Ga0495598_0040263 Ga0495598_0040263_185_637 150
465 3300046538 Ga0495609_0229053 Ga0495609_0229053_297_752 150
466 3300046539 Ga0495621_0286306 Ga0495621_0286306_84_539 150
467 3300046543 Ga0495645_0298700 Ga0495645_0298700_532_1020 150
468 3300046557 Ga0495622_0014213 Ga0495622_0014213_1177_1629 150
469 3300046558 Ga0495633_0247919 Ga0495633_0247919_198_650 150
470 3300046615 Ga0495656_0026187 Ga0495656_0026187_209_661 150
471 3300046616 Ga0495668_0329714 Ga0495668_0329714_296_748 150
472 3300046642 Ga0495634_0546705 Ga0495634_0546705_86_538 150
473 3300046648 Ga0495611_0240218 Ga0495611_0240218_218_670 150
474 3300046664 Ga0495659_0029541 Ga0495659_0029541_1399_1851 150
475 3300046664 Ga0495659_0102636 Ga0495659_0102636_334_789 150
476 3300046664 Ga0495659_0179833 Ga0495659_0179833_149_601 150
477 3300046664 Ga0495659_0246137 Ga0495659_0246137_263_715 150
478 3300046665 Ga0495661_0068016 Ga0495661_0068016_1508_1960 150
479 3300046674 Ga0495588_0018784 Ga0495588_0018784_1237_1689 150
480 3300046680 Ga0495646_0070063 Ga0495646_0070063_33_485 150
481 3300046681 Ga0495647_0377641 Ga0495647_0377641_172_624 150
482 3300046683 Ga0495658_0047906 Ga0495658_0047906_1852_2304 150
483 3300046683 Ga0495658_0093185 Ga0495658_0093185_527_979 150
484 3300046689 Ga0495613_0118543 Ga0495613_0118543_640_1092 150
485 3300046689 Ga0495613_0135075 Ga0495613_0135075_688_1140 150
486 3300046690 Ga0495624_0031919 Ga0495624_0031919_2949_3401 150
487 3300046691 Ga0495670_0035330 Ga0495670_0035330_1341_1793 150
488 3300046692 Ga0495671_0042607 Ga0495671_0042607_1288_1740 150
489 3300046694 Ga0495649_0079569 Ga0495649_0079569_368_820 150
490 3300047315 Ga0495581_0107934 Ga0495581_0107934_328_780 150
491 3300047315 Ga0495581_0362557 Ga0495581_0362557_65_517 150
492 3300047317 Ga0495604_0242813 Ga0495604_0242813_385_837 150
493 3300047319 Ga0495674_0198305 Ga0495674_0198305_186_638 150
494 3300047319 Ga0495674_0215273 Ga0495674_0215273_855_1307 150
495 3300047319 Ga0495674_0445243 Ga0495674_0445243_436_888 150
496 3300047321 Ga0495676_0077096 Ga0495676_0077096_1768_2220 150
497 3300047321 Ga0495676_0138827 Ga0495676_0138827_691_1143 150
498 3300047322 Ga0495680_0162340 Ga0495680_0162340_1005_1457 150
499 3300047322 Ga0495680_0253760 Ga0495680_0253760_167_619 150
500 3300047322 Ga0495680_0560824 Ga0495680_0560824_39_491 150
501 3300047323 Ga0495683_0082792 Ga0495683_0082792_1048_1500 150
502 3300047445 Ga0495677_0336906 Ga0495677_0336906_123_578 150
503 3300047673 Ga0495593_0179193 Ga0495593_0179193_289_741 150
504 3300048091 Ga0495626_0147336 Ga0495626_0147336_256_708 150
505 3300048903 Ga0496100_0085059 Ga0496100_0085059_537_989 150
506 3300048903 Ga0496100_0108408 Ga0496100_0108408_189_641 150
507 3300048904 Ga0496101_0005989 Ga0496101_0005989_1829_2281 150
508 3300048905 Ga0496102_0004367 Ga0496102_0004367_669_1121 150
509 3300048905 Ga0496102_0522547 Ga0496102_0522547_357_809 150
510 3300048905 Ga0496102_0528153 Ga0496102_0528153_537_989 150
511 3300048905 Ga0496102_1599717 Ga0496102_1599717_105_557 150
512 3300048906 Ga0496103_0038315 Ga0496103_0038315_1391_1843 150
513 3300048906 Ga0496103_0138543 Ga0496103_0138543_317_769 150
514 3300048907 Ga0496104_0001514 Ga0496104_0001514_17316_17768 150
515 3300048907 Ga0496104_0002405 Ga0496104_0002405_10212_10664 150
516 3300048907 Ga0496104_0010373 Ga0496104_0010373_1433_1885 150
517 3300048907 Ga0496104_0152132 Ga0496104_0152132_1232_1684 150
518 3300048908 Ga0496105_0001433 Ga0496105_0001433_14078_14530 150
519 3300048908 Ga0496105_0015510 Ga0496105_0015510_1242_1694 150
520 3300048908 Ga0496105_0043404 Ga0496105_0043404_2419_2871 150
521 3300048909 Ga0496106_0002564 Ga0496106_0002564_12337_12789 150
522 3300048909 Ga0496106_0090643 Ga0496106_0090643_416_868 150
523 3300048909 Ga0496106_0216906 Ga0496106_0216906_310_762 150
524 3300048910 Ga0496107_0037178 Ga0496107_0037178_2984_3436 150
525 3300048910 Ga0496107_0355690 Ga0496107_0355690_184_636 150
526 3300048911 Ga0496108_0001000 Ga0496108_0001000_9995_10447 150
527 3300048911 Ga0496108_0157204 Ga0496108_0157204_276_728 150
528 3300048911 Ga0496108_0406611 Ga0496108_0406611_372_824 150
529 3300048912 Ga0496109_0000796 Ga0496109_0000796_5347_5799 150
530 3300048912 Ga0496109_0048468 Ga0496109_0048468_537_989 150
531 3300048912 Ga0496109_0195787 Ga0496109_0195787_122_574 150
532 3300048912 Ga0496109_0290946 Ga0496109_0290946_453_905 150
533 3300048913 Ga0496110_0015804 Ga0496110_0015804_1021_1473 150
534 3300048913 Ga0496110_0049074 Ga0496110_0049074_2863_3315 150
535 3300048913 Ga0496110_0117127 Ga0496110_0117127_1311_1763 150
536 3300048913 Ga0496110_0537023 Ga0496110_0537023_208_660 150
537 3300048914 Ga0496111_0020981 Ga0496111_0020981_813_1265 150
538 3300048914 Ga0496111_0073078 Ga0496111_0073078_1715_2167 150
539 3300048914 Ga0496111_0416203 Ga0496111_0416203_365_817 150
540 3300048915 Ga0496112_0000476 Ga0496112_0000476_19517_19969 150
541 3300048915 Ga0496112_0168369 Ga0496112_0168369_817_1269 150
542 3300048915 Ga0496112_0214512 Ga0496112_0214512_331_783 150
543 3300048915 Ga0496112_1055184 Ga0496112_1055184_110_562 150
544 3300048916 Ga0496113_0000247 Ga0496113_0000247_501_953 150
545 3300048917 Ga0496114_0420670 Ga0496114_0420670_530_982 150
546 3300048917 Ga0496114_0768348 Ga0496114_0768348_327_779 150
547 3300048918 Ga0496115_0055008 Ga0496115_0055008_2208_2660 150
548 3300048918 Ga0496115_0055800 Ga0496115_0055800_1751_2203 150
549 3300048918 Ga0496115_0224842 Ga0496115_0224842_115_567 150
550 3300048918 Ga0496115_0362683 Ga0496115_0362683_674_1126 150
551 3300049569 Ga0501032_0351777 Ga0501032_0351777_382_834 150
552 3300049569 Ga0501032_0784214 Ga0501032_0784214_125_577 150
553 3300049570 Ga0501033_0137745 Ga0501033_0137745_835_1287 150
554 3300049572 Ga0501036_0044637 Ga0501036_0044637_1366_1818 150
555 3300049572 Ga0501036_0211976 Ga0501036_0211976_1081_1533 150
556 3300049572 Ga0501036_0328666 Ga0501036_0328666_321_773 150
557 3300049573 Ga0501037_0066756 Ga0501037_0066756_1469_1921 150
558 3300049573 Ga0501037_0496916 Ga0501037_0496916_226_678 150
559 3300049574 Ga0501038_0185165 Ga0501038_0185165_575_1027 150
560 3300049575 Ga0501039_0038492 Ga0501039_0038492_3160_3612 150
561 3300049575 Ga0501039_0040879 Ga0501039_0040879_1081_1533 150
562 3300049576 Ga0501040_0005009 Ga0501040_0005009_3642_4094 150
563 3300049576 Ga0501040_0012423 Ga0501040_0012423_3926_4378 150
564 3300049576 Ga0501040_0016503 Ga0501040_0016503_3392_3844 150
565 3300049576 Ga0501040_0088923 Ga0501040_0088923_1081_1533 150
566 3300049577 Ga0501041_0005100 Ga0501041_0005100_2061_2513 150
567 3300049577 Ga0501041_0006778 Ga0501041_0006778_5827_6279 150
568 3300049577 Ga0501041_0010247 Ga0501041_0010247_1532_1984 150
569 3300049579 Ga0501043_0021134 Ga0501043_0021134_1125_1577 150
570 3300049579 Ga0501043_0074910 Ga0501043_0074910_534_986 150
571 3300049580 Ga0501046_0050564 Ga0501046_0050564_2415_2867 150
572 3300049580 Ga0501046_0766500 Ga0501046_0766500_25_477 150
573 3300049582 Ga0501048_0048310 Ga0501048_0048310_2445_2897 150
574 3300049582 Ga0501048_0179561 Ga0501048_0179561_798_1250 150
575 3300049584 Ga0501068_0037492 Ga0501068_0037492_1816_2268 150
576 3300049584 Ga0501068_0372509 Ga0501068_0372509_107_559 150
577 3300049587 Ga0501071_0033677 Ga0501071_0033677_487_939 150
578 3300049587 Ga0501071_0692836 Ga0501071_0692836_69_521 150
579 3300049588 Ga0501072_0006855 Ga0501072_0006855_4272_4724 150
580 3300049588 Ga0501072_0023786 Ga0501072_0023786_2789_3241 150
581 3300049589 Ga0501073_0439585 Ga0501073_0439585_353_805 150
582 3300049590 Ga0501074_0125825 Ga0501074_0125825_453_905 150
583 3300049590 Ga0501074_0930862 Ga0501074_0930862_149_601 150
584 3300049591 Ga0501075_0003655 Ga0501075_0003655_2086_2538 150
585 3300049591 Ga0501075_0082723 Ga0501075_0082723_146_598 150
586 3300049592 Ga0501076_0000778 Ga0501076_0000778_19030_19482 150
587 3300049592 Ga0501076_0003675 Ga0501076_0003675_3509_3961 150
588 3300049592 Ga0501076_0613385 Ga0501076_0613385_257_709 150
589 3300049593 Ga0501077_0044313 Ga0501077_0044313_1117_1569 150
590 3300049593 Ga0501077_0210342 Ga0501077_0210342_218_670 150
591 3300049667 Ga0501230_098241 Ga0501230_098241_76_528 150
592 3300049741 Ga0501079_0017301 Ga0501079_0017301_4681_5133 150
593 3300049741 Ga0501079_0021835 Ga0501079_0021835_3170_3622 150
594 3300049741 Ga0501079_0172570 Ga0501079_0172570_931_1383 150
595 3300049741 Ga0501079_0738854 Ga0501079_0738854_307_759 150
596 3300049742 Ga0501080_0016458 Ga0501080_0016458_4016_4468 150
597 3300049742 Ga0501080_0017334 Ga0501080_0017334_1282_1734 150
598 3300049743 Ga0501081_0000811 Ga0501081_0000811_7497_7949 150
599 3300049743 Ga0501081_0004676 Ga0501081_0004676_3575_4027 150
600 3300049822 Ga0501035_0112949 Ga0501035_0112949_128_580 150
601 3300049822 Ga0501035_0159828 Ga0501035_0159828_725_1177 150
602 3300049823 Ga0501044_0247039 Ga0501044_0247039_1222_1674 150
603 3300049824 Ga0501045_0009308 Ga0501045_0009308_3937_4389 150
604 3300049824 Ga0501045_0052146 Ga0501045_0052146_2467_2919 150
605 3300050489 nmdc:mga03683_36794_c2 nmdc:mga03683_36794_c2_415_909 150
606 3300050490 nmdc:mga03n38_403923_c1 nmdc:mga03n38_403923_c1_52_504 150
607 3300050491 nmdc:mga00v17_15271_c1 nmdc:mga00v17_15271_c1_307_801 150
608 3300050491 nmdc:mga00v17_461305_c1 nmdc:mga00v17_461305_c1_197_649 150
609 3300050492 nmdc:mga0yw44_157579_c1 nmdc:mga0yw44_157579_c1_571_1023 150
610 3300050492 nmdc:mga0yw44_279395_c1 nmdc:mga0yw44_279395_c1_224_676 150
611 3300050492 nmdc:mga0yw44_300524_c1 nmdc:mga0yw44_300524_c1_399_851 150
612 3300050493 nmdc:mga0k408_29654_c1 nmdc:mga0k408_29654_c1_241_693 150
613 3300050494 nmdc:mga06z11_133389_c1 nmdc:mga06z11_133389_c1_286_738 150
614 3300050494 nmdc:mga06z11_272613_c1 nmdc:mga06z11_272613_c1_76_528 150
615 3300050495 nmdc:mga04h51_5555_c1 nmdc:mga04h51_5555_c1_2548_3000 150
616 3300050496 nmdc:mga07m45_136346_c1 nmdc:mga07m45_136346_c1_36_488 150
617 3300050507 nmdc:mga05p37_1522919_c1 nmdc:mga05p37_1522919_c1_115_609 150
618 3300050507 nmdc:mga05p37_162879_c1 nmdc:mga05p37_162879_c1_1065_1517 150
619 3300050507 nmdc:mga05p37_35564_c1 nmdc:mga05p37_35564_c1_1455_1907 150
620 3300050507 nmdc:mga05p37_413812_c1 nmdc:mga05p37_413812_c1_876_1328 150
621 3300050507 nmdc:mga05p37_483507_c1 nmdc:mga05p37_483507_c1_858_1310 150
622 3300050507 nmdc:mga05p37_597536_c1 nmdc:mga05p37_597536_c1_490_945 150
623 3300050507 nmdc:mga05p37_65954_c1 nmdc:mga05p37_65954_c1_1931_2383 150
624 3300050508 nmdc:mga09592_219051_c1 nmdc:mga09592_219051_c1_730_1182 150
625 3300050508 nmdc:mga09592_759720_c1 nmdc:mga09592_759720_c1_346_798 150
626 3300050509 nmdc:mga0qj67_119206_c1 nmdc:mga0qj67_119206_c1_1435_1929 150
627 3300050509 nmdc:mga0qj67_14086_c1 nmdc:mga0qj67_14086_c1_2104_2556 150
628 3300050509 nmdc:mga0qj67_233204_c1 nmdc:mga0qj67_233204_c1_1007_1459 150
629 3300050509 nmdc:mga0qj67_37_c1 nmdc:mga0qj67_37_c1_90346_90798 150
630 3300050509 nmdc:mga0qj67_433206_c1 nmdc:mga0qj67_433206_c1_455_907 150
631 3300050510 nmdc:mga06r32_100411_c1 nmdc:mga06r32_100411_c1_1093_1587 150
632 3300050510 nmdc:mga06r32_190951_c1 nmdc:mga06r32_190951_c1_294_746 150
633 3300050510 nmdc:mga06r32_19965_c1 nmdc:mga06r32_19965_c1_1149_1601 150
634 3300050510 nmdc:mga06r32_434933_c1 nmdc:mga06r32_434933_c1_739_1191 150
635 3300050510 nmdc:mga06r32_827733_c1 nmdc:mga06r32_827733_c1_197_649 150
636 3300050511 nmdc:mga08y16_146228_c1 nmdc:mga08y16_146228_c1_1078_1572 150
637 3300050511 nmdc:mga08y16_178249_c1 nmdc:mga08y16_178249_c1_1644_2096 150
638 3300050511 nmdc:mga08y16_445810_c1 nmdc:mga08y16_445810_c1_599_1051 150
639 3300050511 nmdc:mga08y16_97419_c1 nmdc:mga08y16_97419_c1_1017_1469 150
640 3300050512 nmdc:mga0n895_116878_c1 nmdc:mga0n895_116878_c1_2191_2643 150
641 3300050512 nmdc:mga0n895_27822_c1 nmdc:mga0n895_27822_c1_3927_4379 150
642 3300050512 nmdc:mga0n895_434508_c1 nmdc:mga0n895_434508_c1_641_1093 150
643 3300050513 nmdc:mga0rr50_1113976_c1 nmdc:mga0rr50_1113976_c1_155_607 150
644 3300050513 nmdc:mga0rr50_150121_c1 nmdc:mga0rr50_150121_c1_544_996 150
645 3300050513 nmdc:mga0rr50_209563_c1 nmdc:mga0rr50_209563_c1_453_905 150
646 3300050514 nmdc:mga08x19_273952_c1 nmdc:mga08x19_273952_c1_690_1142 150
647 3300050515 nmdc:mga0a205_400377_c1 nmdc:mga0a205_400377_c1_351_803 150
648 3300050516 nmdc:mga0sz30_17451_c1 nmdc:mga0sz30_17451_c1_1832_2284 150
649 3300053077 Ga0495601_0301119 Ga0495601_0301119_136_588 150
650 3300053078 Ga0495612_0116298 Ga0495612_0116298_279_731 150
651 3300053078 Ga0495612_0134173 Ga0495612_0134173_39_491 150
652 3300053083 Ga0495655_0018253 Ga0495655_0018253_518_970 150
653 3300053083 Ga0495655_0040008 Ga0495655_0040008_46_498 150
654 3300053084 Ga0495595_0203020 Ga0495595_0203020_10_462 150
655 3300053085 Ga0495619_0007761 Ga0495619_0007761_304_756 150
656 3300053085 Ga0495619_0073057 Ga0495619_0073057_558_1010 150
657 3300053086 Ga0500578_0644809 Ga0500578_0644809_45_497 150
658 3300060353 Ga0501082_0002254 Ga0501082_0002254_3888_4340 150
659 3300060353 Ga0501082_0020235 Ga0501082_0020235_2420_2872 150
660 3300060353 Ga0501082_0893467 Ga0501082_0893467_151_603 150
661 3300061734 Ga0530510_0000247 Ga0530510_0000247_6583_7035 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

93

165

0.94

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

29

108

0.87

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

25

92

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9287 2 148
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9215 2 148
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9212 2 147
3hrd-assembly1.cif.gz_H crystal structure of nicotinate dehydrogenase 0.9157 2 148
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.9151 1 147
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9521 82 148 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9419 83 148 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9407 83 148 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9315 82 148 1.10.150.120
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9284 82 148 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.9461 1 148 GO:0046872
GO:0047121
GO:0051537
AF-A0A3D8YFZ6-F1-model_v4 (2Fe-2S)-binding protein 0.944 3 149 GO:0016491
GO:0046872
GO:0051537
AF-A0A6J4XA38-F1-model_v4 Uncharacterized aldehyde oxidase, 2Fe-2S subunit 0.944 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A1I2BQ61-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9439 3 148 GO:0016491
GO:0046872
GO:0051537
AF-A0A095WSE8-F1-model_v4 (2Fe-2S)-binding protein 0.9437 1 150 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
90.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map