F473396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 363 | 661 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_11229740|Ga0105243_112297402 |
| Length | 171 |
| Sequence | MPGAQVTAYSAAAKNEHLGGNMVSFTLNGQRVSVDADANTPLLWVIRDHVGLTGTKYGCGAGLCGACTVHLNGKAVRACQTQMSEAAGKTVVTIEGLSKNSSHPLQKAWVKLEVPQCGYCQSGQIMKAAELLAQNKQPSREQIVQHMDGNICRCGTYHRIIAAVELAAKEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 222 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 223 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 224 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 225 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 339 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 340 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 358 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 359 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 361 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.6 |
| Nodule | 0 |
| Rhizoplane | 6.96 |
| Rhizosphere | 86.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10089683 | 3300002075 | Bacteria | 649 |
| 2 | JGI25406J46586_10019721 | 3300003203 | Bacteria | 2739 |
| 3 | JGI25153J46596_10046480 | 3300003215 | Bacteria | 1286 |
| 4 | Ga0070676_10297780 | 3300005328 | Bacteria | 1092 |
| 5 | Ga0070676_10575508 | 3300005328 | Bacteria | 809 |
| 6 | Ga0070683_100595733 | 3300005329 | Bacteria | 1058 |
| 7 | Ga0070683_101064341 | 3300005329 | Bacteria | 777 |
| 8 | Ga0070690_100097605 | 3300005330 | Bacteria | 1944 |
| 9 | Ga0070690_100547308 | 3300005330 | Bacteria | 872 |
| 10 | Ga0070690_100619143 | 3300005330 | Bacteria | 824 |
| 11 | Ga0070670_102154551 | 3300005331 | Bacteria | 514 |
| 12 | Ga0070677_10214350 | 3300005333 | Bacteria | 937 |
| 13 | Ga0068869_100074085 | 3300005334 | Bacteria | 2526 |
| 14 | Ga0068869_100110048 | 3300005334 | Bacteria | 2095 |
| 15 | Ga0070666_10450101 | 3300005335 | Bacteria | 930 |
| 16 | Ga0070666_10874670 | 3300005335 | Bacteria | 664 |
| 17 | Ga0070682_100981176 | 3300005337 | Bacteria | 700 |
| 18 | Ga0068868_100497971 | 3300005338 | Bacteria | 1067 |
| 19 | Ga0068868_100674307 | 3300005338 | Bacteria | 922 |
| 20 | Ga0070660_100160134 | 3300005339 | Bacteria | 1813 |
| 21 | Ga0070689_100023592 | 3300005340 | Bacteria | 4606 |
| 22 | Ga0070689_100618441 | 3300005340 | Bacteria | 940 |
| 23 | Ga0070689_100979023 | 3300005340 | Bacteria | 751 |
| 24 | Ga0070687_100172413 | 3300005343 | Bacteria | 1289 |
| 25 | Ga0070661_100047200 | 3300005344 | Bacteria | 3152 |
| 26 | Ga0070692_10021173 | 3300005345 | Bacteria | 3161 |
| 27 | Ga0070692_10143702 | 3300005345 | Bacteria | 1353 |
| 28 | Ga0070668_100077039 | 3300005347 | Bacteria | 2606 |
| 29 | Ga0070669_100026933 | 3300005353 | Bacteria | 4137 |
| 30 | Ga0070669_100238826 | 3300005353 | Bacteria | 1443 |
| 31 | Ga0070669_100345876 | 3300005353 | Bacteria | 1206 |
| 32 | Ga0070669_100686572 | 3300005353 | Bacteria | 864 |
| 33 | Ga0070675_100725841 | 3300005354 | Bacteria | 906 |
| 34 | Ga0070671_100592454 | 3300005355 | Bacteria | 958 |
| 35 | Ga0070671_100772364 | 3300005355 | Bacteria | 836 |
| 36 | Ga0070671_100814177 | 3300005355 | Bacteria | 814 |
| 37 | Ga0070674_100121072 | 3300005356 | Bacteria | 1937 |
| 38 | Ga0070674_100301417 | 3300005356 | Bacteria | 1278 |
| 39 | Ga0070673_100239335 | 3300005364 | Bacteria | 1577 |
| 40 | Ga0070673_100376511 | 3300005364 | Bacteria | 1265 |
| 41 | Ga0070688_100007930 | 3300005365 | Bacteria | 5743 |
| 42 | Ga0070659_100158881 | 3300005366 | Bacteria | 1847 |
| 43 | Ga0070659_100231523 | 3300005366 | Bacteria | 1527 |
| 44 | Ga0070703_10219013 | 3300005406 | Bacteria | 757 |
| 45 | Ga0070713_101218478 | 3300005436 | Bacteria | 729 |
| 46 | Ga0070710_10074578 | 3300005437 | Bacteria | 1964 |
| 47 | Ga0070701_10041962 | 3300005438 | Bacteria | 2333 |
| 48 | Ga0070701_10140038 | 3300005438 | Bacteria | 1382 |
| 49 | Ga0070711_100048438 | 3300005439 | Bacteria | 2906 |
| 50 | Ga0070705_100325872 | 3300005440 | Bacteria | 1111 |
| 51 | Ga0070705_100670385 | 3300005440 | Bacteria | 811 |
| 52 | Ga0070700_100030843 | 3300005441 | Bacteria | 3207 |
| 53 | Ga0070694_100003687 | 3300005444 | Bacteria | 9136 |
| 54 | Ga0070694_100011986 | 3300005444 | Bacteria | 5381 |
| 55 | Ga0070694_100515033 | 3300005444 | Bacteria | 954 |
| 56 | Ga0070708_100035446 | 3300005445 | Bacteria | 4347 |
| 57 | Ga0070678_100205201 | 3300005456 | Bacteria | 1629 |
| 58 | Ga0070678_100427434 | 3300005456 | Bacteria | 1156 |
| 59 | Ga0070662_100119227 | 3300005457 | Bacteria | 2020 |
| 60 | Ga0068867_100240203 | 3300005459 | Bacteria | 1469 |
| 61 | Ga0068867_100271209 | 3300005459 | Bacteria | 1387 |
| 62 | Ga0070685_10852788 | 3300005466 | Bacteria | 675 |
| 63 | Ga0070707_100132410 | 3300005468 | Bacteria | 2425 |
| 64 | Ga0070684_100079560 | 3300005535 | Bacteria | 2898 |
| 65 | Ga0070697_100069775 | 3300005536 | Bacteria | 2879 |
| 66 | Ga0070672_100166225 | 3300005543 | Bacteria | 1833 |
| 67 | Ga0070672_100228744 | 3300005543 | Bacteria | 1562 |
| 68 | Ga0070672_100281624 | 3300005543 | Bacteria | 1406 |
| 69 | Ga0070686_100016847 | 3300005544 | Bacteria | 4257 |
| 70 | Ga0070686_100135417 | 3300005544 | Bacteria | 1708 |
| 71 | Ga0070695_100024926 | 3300005545 | Bacteria | 3689 |
| 72 | Ga0070695_101099167 | 3300005545 | Bacteria | 650 |
| 73 | Ga0070696_100857490 | 3300005546 | Bacteria | 751 |
| 74 | Ga0070696_101213883 | 3300005546 | Bacteria | 638 |
| 75 | Ga0070693_100006517 | 3300005547 | Bacteria | 5661 |
| 76 | Ga0070665_101024468 | 3300005548 | Bacteria | 838 |
| 77 | Ga0070704_100006684 | 3300005549 | Bacteria | 6818 |
| 78 | Ga0068855_100606402 | 3300005563 | Bacteria | 1180 |
| 79 | Ga0068857_100619536 | 3300005577 | Bacteria | 1024 |
| 80 | Ga0068854_100808536 | 3300005578 | Bacteria | 818 |
| 81 | Ga0070702_100404488 | 3300005615 | Bacteria | 977 |
| 82 | Ga0068852_100067879 | 3300005616 | Bacteria | 3119 |
| 83 | Ga0068852_101206056 | 3300005616 | Bacteria | 778 |
| 84 | Ga0068859_100126230 | 3300005617 | Bacteria | 2628 |
| 85 | Ga0068859_101113117 | 3300005617 | Bacteria | 869 |
| 86 | Ga0068864_100052031 | 3300005618 | Bacteria | 3529 |
| 87 | Ga0068864_100142366 | 3300005618 | Bacteria | 2164 |
| 88 | Ga0068864_100200050 | 3300005618 | Bacteria | 1835 |
| 89 | Ga0068866_10269137 | 3300005718 | Bacteria | 1051 |
| 90 | Ga0068866_10576982 | 3300005718 | Bacteria | 756 |
| 91 | Ga0068861_100146736 | 3300005719 | Bacteria | 1931 |
| 92 | Ga0068851_10299804 | 3300005834 | Bacteria | 924 |
| 93 | Ga0068870_10064212 | 3300005840 | Bacteria | 1982 |
| 94 | Ga0068863_100216665 | 3300005841 | Bacteria | 1844 |
| 95 | Ga0068863_100871778 | 3300005841 | Bacteria | 900 |
| 96 | Ga0068858_100185575 | 3300005842 | Bacteria | 1964 |
| 97 | Ga0068858_100232871 | 3300005842 | Bacteria | 1746 |
| 98 | Ga0068860_100998422 | 3300005843 | Bacteria | 855 |
| 99 | Ga0068862_100320016 | 3300005844 | Bacteria | 1431 |
| 100 | Ga0081455_10000759 | 3300005937 | Bacteria | 41962 |
| 101 | Ga0081455_10004199 | 3300005937 | Bacteria | 16239 |
| 102 | Ga0081455_10010372 | 3300005937 | Bacteria | 9466 |
| 103 | Ga0081455_10063042 | 3300005937 | Bacteria | 3112 |
| 104 | Ga0081455_10141522 | 3300005937 | Bacteria | 1868 |
| 105 | Ga0081538_10000527 | 3300005981 | Bacteria | 42416 |
| 106 | Ga0081538_10033045 | 3300005981 | Bacteria | 3452 |
| 107 | Ga0081538_10048084 | 3300005981 | Bacteria | 2607 |
| 108 | Ga0081540_1166045 | 3300005983 | Bacteria | 848 |
| 109 | Ga0081539_10002942 | 3300005985 | Bacteria | 22406 |
| 110 | Ga0081539_10087764 | 3300005985 | Bacteria | 1615 |
| 111 | Ga0070717_10106475 | 3300006028 | Bacteria | 2388 |
| 112 | Ga0070717_10485425 | 3300006028 | Bacteria | 1116 |
| 113 | Ga0070717_10518270 | 3300006028 | Bacteria | 1078 |
| 114 | Ga0075365_10039069 | 3300006038 | Bacteria | 3088 |
| 115 | Ga0075365_10142034 | 3300006038 | Bacteria | 1667 |
| 116 | Ga0075365_10343832 | 3300006038 | Bacteria | 1051 |
| 117 | Ga0075365_10493475 | 3300006038 | Bacteria | 865 |
| 118 | Ga0075368_10084706 | 3300006042 | Bacteria | 1292 |
| 119 | Ga0075363_100026412 | 3300006048 | Bacteria | 2970 |
| 120 | Ga0075363_100465669 | 3300006048 | Bacteria | 748 |
| 121 | Ga0075364_10019489 | 3300006051 | Bacteria | 4259 |
| 122 | Ga0075364_10690583 | 3300006051 | Bacteria | 697 |
| 123 | Ga0070715_10852957 | 3300006163 | Bacteria | 557 |
| 124 | Ga0070716_100131238 | 3300006173 | Bacteria | 1584 |
| 125 | Ga0070712_100009604 | 3300006175 | Bacteria | 6099 |
| 126 | Ga0070712_100107264 | 3300006175 | Bacteria | 2078 |
| 127 | Ga0075362_10018592 | 3300006177 | Bacteria | 2878 |
| 128 | Ga0075362_10132460 | 3300006177 | Bacteria | 1187 |
| 129 | Ga0075367_10248972 | 3300006178 | Bacteria | 1114 |
| 130 | Ga0075367_10271422 | 3300006178 | Bacteria | 1065 |
| 131 | Ga0075367_10524505 | 3300006178 | Bacteria | 752 |
| 132 | Ga0075369_10058702 | 3300006186 | Bacteria | 1675 |
| 133 | Ga0075427_10109129 | 3300006194 | Bacteria | 520 |
| 134 | Ga0075366_10503492 | 3300006195 | Bacteria | 749 |
| 135 | Ga0097621_100040897 | 3300006237 | Bacteria | 3728 |
| 136 | Ga0097621_100640210 | 3300006237 | Bacteria | 975 |
| 137 | Ga0097621_101063444 | 3300006237 | Bacteria | 759 |
| 138 | Ga0068871_100109638 | 3300006358 | Bacteria | 2321 |
| 139 | Ga0068871_100456919 | 3300006358 | Bacteria | 1145 |
| 140 | Ga0068871_100697771 | 3300006358 | Bacteria | 930 |
| 141 | Ga0075428_100024058 | 3300006844 | Bacteria | 6742 |
| 142 | Ga0075428_100125159 | 3300006844 | Bacteria | 2797 |
| 143 | Ga0075428_100214072 | 3300006844 | Bacteria | 2082 |
| 144 | Ga0075428_100216748 | 3300006844 | Bacteria | 2068 |
| 145 | Ga0075428_100338704 | 3300006844 | Bacteria | 1615 |
| 146 | Ga0075428_100512275 | 3300006844 | Bacteria | 1283 |
| 147 | Ga0075430_100000293 | 3300006846 | Bacteria | 35315 |
| 148 | Ga0075430_100001577 | 3300006846 | Bacteria | 18642 |
| 149 | Ga0075430_100459574 | 3300006846 | Bacteria | 1050 |
| 150 | Ga0075430_100464074 | 3300006846 | Bacteria | 1045 |
| 151 | Ga0075431_100030912 | 3300006847 | Bacteria | 5515 |
| 152 | Ga0075431_100032198 | 3300006847 | Bacteria | 5403 |
| 153 | Ga0075431_100111833 | 3300006847 | Bacteria | 2818 |
| 154 | Ga0075431_100225009 | 3300006847 | Bacteria | 1913 |
| 155 | Ga0075434_100095598 | 3300006871 | Bacteria | 2976 |
| 156 | Ga0075434_100136338 | 3300006871 | Bacteria | 2473 |
| 157 | Ga0075434_100366761 | 3300006871 | Bacteria | 1461 |
| 158 | Ga0075429_100281422 | 3300006880 | Bacteria | 1457 |
| 159 | Ga0075429_100966682 | 3300006880 | Bacteria | 745 |
| 160 | Ga0075429_100969516 | 3300006880 | Bacteria | 744 |
| 161 | Ga0068865_100097342 | 3300006881 | Bacteria | 2147 |
| 162 | Ga0068865_100340588 | 3300006881 | Bacteria | 1212 |
| 163 | Ga0075436_100209768 | 3300006914 | Bacteria | 1380 |
| 164 | Ga0097620_100126237 | 3300006931 | Bacteria | 2628 |
| 165 | Ga0097620_101112925 | 3300006931 | Bacteria | 869 |
| 166 | Ga0075435_100208583 | 3300007076 | Bacteria | 1657 |
| 167 | Ga0075435_100859192 | 3300007076 | Bacteria | 791 |
| 168 | Ga0099794_10013326 | 3300007265 | Bacteria | 3576 |
| 169 | Ga0099794_10491223 | 3300007265 | Bacteria | 646 |
| 170 | Ga0105240_11516977 | 3300009093 | Bacteria | 702 |
| 171 | Ga0111539_10075711 | 3300009094 | Bacteria | 3964 |
| 172 | Ga0111539_10099325 | 3300009094 | Bacteria | 3418 |
| 173 | Ga0111539_10264076 | 3300009094 | Bacteria | 2004 |
| 174 | Ga0111539_10277312 | 3300009094 | Bacteria | 1951 |
| 175 | Ga0105245_10411220 | 3300009098 | Bacteria | 1354 |
| 176 | Ga0105245_11409243 | 3300009098 | Bacteria | 747 |
| 177 | Ga0105247_10127779 | 3300009101 | Bacteria | 1654 |
| 178 | Ga0105247_10477672 | 3300009101 | Bacteria | 904 |
| 179 | Ga0114129_10005790 | 3300009147 | Bacteria | 17503 |
| 180 | Ga0114129_10165790 | 3300009147 | Bacteria | 3015 |
| 181 | Ga0114129_10271606 | 3300009147 | Bacteria | 2268 |
| 182 | Ga0114129_10585481 | 3300009147 | Bacteria | 1447 |
| 183 | Ga0114129_10801205 | 3300009147 | Bacteria | 1202 |
| 184 | Ga0114129_10944446 | 3300009147 | Bacteria | 1090 |
| 185 | Ga0105243_10071374 | 3300009148 | Bacteria | 2807 |
| 186 | Ga0105243_10159711 | 3300009148 | Bacteria | 1942 |
| 187 | Ga0105243_11093442 | 3300009148 | Bacteria | 805 |
| 188 | Ga0105243_11229740 | 3300009148 | Bacteria | 763 |
| 189 | Ga0105241_10766728 | 3300009174 | Bacteria | 886 |
| 190 | Ga0105242_10107759 | 3300009176 | Bacteria | 2370 |
| 191 | Ga0105242_10825329 | 3300009176 | Bacteria | 920 |
| 192 | Ga0105242_10860144 | 3300009176 | Bacteria | 903 |
| 193 | Ga0105242_10926624 | 3300009176 | Bacteria | 873 |
| 194 | Ga0105248_10446646 | 3300009177 | Bacteria | 1457 |
| 195 | Ga0105238_10483143 | 3300009551 | Bacteria | 1238 |
| 196 | Ga0105249_10189793 | 3300009553 | Bacteria | 2005 |
| 197 | Ga0105249_10780319 | 3300009553 | Bacteria | 1019 |
| 198 | Ga0105239_10104142 | 3300010375 | Bacteria | 3142 |
| 199 | Ga0105246_10101927 | 3300011119 | Bacteria | 2092 |
| 200 | Ga0105246_10939827 | 3300011119 | Bacteria | 778 |
| 201 | Ga0105246_12408074 | 3300011119 | Bacteria | 516 |
| 202 | Ga0157374_10349988 | 3300013296 | Bacteria | 1468 |
| 203 | Ga0157378_12159801 | 3300013297 | Bacteria | 608 |
| 204 | Ga0163162_10533824 | 3300013306 | Bacteria | 1302 |
| 205 | Ga0163162_10779196 | 3300013306 | Bacteria | 1074 |
| 206 | Ga0163162_11593033 | 3300013306 | Bacteria | 745 |
| 207 | Ga0163162_11611157 | 3300013306 | Bacteria | 741 |
| 208 | Ga0157372_10687703 | 3300013307 | Bacteria | 1191 |
| 209 | Ga0157375_10100676 | 3300013308 | Bacteria | 2971 |
| 210 | Ga0157375_10413424 | 3300013308 | Bacteria | 1515 |
| 211 | Ga0163163_10034194 | 3300014325 | Bacteria | 4921 |
| 212 | Ga0163163_10346324 | 3300014325 | Bacteria | 1541 |
| 213 | Ga0163163_10598338 | 3300014325 | Bacteria | 1166 |
| 214 | Ga0157380_10165714 | 3300014326 | Bacteria | 1925 |
| 215 | Ga0157380_10761502 | 3300014326 | Bacteria | 981 |
| 216 | Ga0157377_10390185 | 3300014745 | Bacteria | 945 |
| 217 | Ga0157377_10517871 | 3300014745 | Bacteria | 837 |
| 218 | Ga0157379_10125818 | 3300014968 | Bacteria | 2306 |
| 219 | Ga0157376_10026276 | 3300014969 | Bacteria | 4598 |
| 220 | Ga0157376_10180521 | 3300014969 | Bacteria | 1929 |
| 221 | Ga0157376_10678570 | 3300014969 | Bacteria | 1033 |
| 222 | Ga0163161_10034179 | 3300017792 | Bacteria | 3636 |
| 223 | Ga0163161_10666999 | 3300017792 | Bacteria | 863 |
| 224 | Ga0163161_11457772 | 3300017792 | Bacteria | 599 |
| 225 | Ga0213872_10057372 | 3300021361 | Bacteria | 1763 |
| 226 | Ga0213874_10334364 | 3300021377 | Bacteria | 577 |
| 227 | Ga0213871_10059506 | 3300021441 | Bacteria | 1062 |
| 228 | Ga0209758_1000370 | 3300025297 | Bacteria | 79289 |
| 229 | Ga0209758_1021862 | 3300025297 | Bacteria | 2961 |
| 230 | Ga0207426_1135232 | 3300025302 | Bacteria | 592 |
| 231 | Ga0207656_10303219 | 3300025321 | Bacteria | 791 |
| 232 | Ga0207653_10075029 | 3300025885 | Bacteria | 1162 |
| 233 | Ga0207682_10106712 | 3300025893 | Bacteria | 1229 |
| 234 | Ga0207692_10081064 | 3300025898 | Bacteria | 1736 |
| 235 | Ga0207642_10170375 | 3300025899 | Bacteria | 1177 |
| 236 | Ga0207642_10224938 | 3300025899 | Bacteria | 1051 |
| 237 | Ga0207642_10405828 | 3300025899 | Bacteria | 816 |
| 238 | Ga0207710_10108772 | 3300025900 | Bacteria | 1315 |
| 239 | Ga0207688_10192639 | 3300025901 | Bacteria | 1220 |
| 240 | Ga0207680_10263986 | 3300025903 | Bacteria | 1192 |
| 241 | Ga0207680_10929128 | 3300025903 | Bacteria | 623 |
| 242 | Ga0207647_10067976 | 3300025904 | Bacteria | 2158 |
| 243 | Ga0207645_10030990 | 3300025907 | Bacteria | 3444 |
| 244 | Ga0207645_10548686 | 3300025907 | Bacteria | 784 |
| 245 | Ga0207643_10004252 | 3300025908 | Bacteria | 7711 |
| 246 | Ga0207684_10063009 | 3300025910 | Bacteria | 3148 |
| 247 | Ga0207654_10421065 | 3300025911 | Bacteria | 932 |
| 248 | Ga0207707_10416342 | 3300025912 | Bacteria | 1153 |
| 249 | Ga0207693_10015564 | 3300025915 | Bacteria | 6101 |
| 250 | Ga0207693_10655752 | 3300025915 | Bacteria | 815 |
| 251 | Ga0207663_10244854 | 3300025916 | Bacteria | 1317 |
| 252 | Ga0207660_10026335 | 3300025917 | Bacteria | 3960 |
| 253 | Ga0207660_10139252 | 3300025917 | Bacteria | 1854 |
| 254 | Ga0207660_10348482 | 3300025917 | Bacteria | 1187 |
| 255 | Ga0207660_10530646 | 3300025917 | Bacteria | 956 |
| 256 | Ga0207660_11214690 | 3300025917 | Bacteria | 613 |
| 257 | Ga0207662_10240217 | 3300025918 | Bacteria | 1186 |
| 258 | Ga0207662_10301374 | 3300025918 | Bacteria | 1065 |
| 259 | Ga0207662_10442133 | 3300025918 | Bacteria | 888 |
| 260 | Ga0207649_10042503 | 3300025920 | Bacteria | 2773 |
| 261 | Ga0207681_10016920 | 3300025923 | Bacteria | 4572 |
| 262 | Ga0207681_10131231 | 3300025923 | Bacteria | 1853 |
| 263 | Ga0207681_10205136 | 3300025923 | Bacteria | 1516 |
| 264 | Ga0207681_10288767 | 3300025923 | Bacteria | 1294 |
| 265 | Ga0207650_10004089 | 3300025925 | Bacteria | 9961 |
| 266 | Ga0207650_11137188 | 3300025925 | Bacteria | 665 |
| 267 | Ga0207659_10246314 | 3300025926 | Bacteria | 1448 |
| 268 | Ga0207700_10015702 | 3300025928 | Bacteria | 5006 |
| 269 | Ga0207700_10448018 | 3300025928 | Bacteria | 1137 |
| 270 | Ga0207700_11362032 | 3300025928 | Bacteria | 631 |
| 271 | Ga0207664_10469964 | 3300025929 | Bacteria | 1124 |
| 272 | Ga0207664_10729006 | 3300025929 | Bacteria | 891 |
| 273 | Ga0207644_10649286 | 3300025931 | Bacteria | 878 |
| 274 | Ga0207644_10677431 | 3300025931 | Bacteria | 859 |
| 275 | Ga0207644_10998987 | 3300025931 | Bacteria | 702 |
| 276 | Ga0207690_10065767 | 3300025932 | Bacteria | 2480 |
| 277 | Ga0207690_10113690 | 3300025932 | Bacteria | 1954 |
| 278 | Ga0207706_10008418 | 3300025933 | Bacteria | 9518 |
| 279 | Ga0207709_10012652 | 3300025935 | Bacteria | 4651 |
| 280 | Ga0207709_10058670 | 3300025935 | Bacteria | 2393 |
| 281 | Ga0207709_11189075 | 3300025935 | Bacteria | 628 |
| 282 | Ga0207670_10005087 | 3300025936 | Bacteria | 7176 |
| 283 | Ga0207670_10369305 | 3300025936 | Bacteria | 1140 |
| 284 | Ga0207670_10962477 | 3300025936 | Bacteria | 717 |
| 285 | Ga0207669_10150832 | 3300025937 | Bacteria | 1628 |
| 286 | Ga0207669_11104561 | 3300025937 | Bacteria | 669 |
| 287 | Ga0207704_11695228 | 3300025938 | Bacteria | 543 |
| 288 | Ga0207691_10139600 | 3300025940 | Bacteria | 2136 |
| 289 | Ga0207691_10234506 | 3300025940 | Bacteria | 1588 |
| 290 | Ga0207691_10432903 | 3300025940 | Bacteria | 1120 |
| 291 | Ga0207711_10696294 | 3300025941 | Bacteria | 948 |
| 292 | Ga0207689_10167720 | 3300025942 | Bacteria | 1809 |
| 293 | Ga0207661_10858151 | 3300025944 | Bacteria | 836 |
| 294 | Ga0207661_11195013 | 3300025944 | Bacteria | 700 |
| 295 | Ga0207679_11679444 | 3300025945 | Bacteria | 581 |
| 296 | Ga0207651_10326479 | 3300025960 | Bacteria | 1284 |
| 297 | Ga0207712_10050584 | 3300025961 | Bacteria | 2902 |
| 298 | Ga0207712_11503265 | 3300025961 | Bacteria | 603 |
| 299 | Ga0207668_10043771 | 3300025972 | Bacteria | 3041 |
| 300 | Ga0207668_11146463 | 3300025972 | Bacteria | 698 |
| 301 | Ga0207640_10154994 | 3300025981 | Bacteria | 1687 |
| 302 | Ga0207658_10480841 | 3300025986 | Bacteria | 1104 |
| 303 | Ga0207677_10229030 | 3300026023 | Bacteria | 1496 |
| 304 | Ga0207677_10345603 | 3300026023 | Bacteria | 1245 |
| 305 | Ga0207703_10155221 | 3300026035 | Bacteria | 1999 |
| 306 | Ga0207678_10047151 | 3300026067 | Bacteria | 3727 |
| 307 | Ga0207678_10798983 | 3300026067 | Bacteria | 833 |
| 308 | Ga0207708_10020685 | 3300026075 | Bacteria | 4963 |
| 309 | Ga0207702_10074357 | 3300026078 | Bacteria | 2933 |
| 310 | Ga0207641_10246736 | 3300026088 | Bacteria | 1666 |
| 311 | Ga0207641_10354494 | 3300026088 | Bacteria | 1399 |
| 312 | Ga0207648_10012041 | 3300026089 | Bacteria | 8113 |
| 313 | Ga0207648_10125539 | 3300026089 | Bacteria | 2257 |
| 314 | Ga0207648_10545603 | 3300026089 | Bacteria | 1064 |
| 315 | Ga0207676_10015096 | 3300026095 | Bacteria | 5570 |
| 316 | Ga0207676_10251147 | 3300026095 | Bacteria | 1592 |
| 317 | Ga0207676_10368089 | 3300026095 | Bacteria | 1334 |
| 318 | Ga0207674_11226746 | 3300026116 | Bacteria | 719 |
| 319 | Ga0207675_100202117 | 3300026118 | Bacteria | 1909 |
| 320 | Ga0207675_100361829 | 3300026118 | Bacteria | 1423 |
| 321 | Ga0207675_101681935 | 3300026118 | Bacteria | 655 |
| 322 | Ga0207683_10143288 | 3300026121 | Bacteria | 2154 |
| 323 | Ga0207683_10506832 | 3300026121 | Bacteria | 1115 |
| 324 | Ga0207683_10530107 | 3300026121 | Bacteria | 1088 |
| 325 | Ga0207683_10621976 | 3300026121 | Bacteria | 1000 |
| 326 | Ga0207698_10317658 | 3300026142 | Bacteria | 1457 |
| 327 | Ga0207698_10918862 | 3300026142 | Bacteria | 883 |
| 328 | Ga0209588_1094306 | 3300027671 | Bacteria | 964 |
| 329 | Ga0207428_10276158 | 3300027907 | Bacteria | 1248 |
| 330 | Ga0268266_10575283 | 3300028379 | Bacteria | 1081 |
| 331 | Ga0268265_10788184 | 3300028380 | Bacteria | 925 |
| 332 | Ga0268264_10068542 | 3300028381 | Bacteria | 2998 |
| 333 | Ga0268264_11012215 | 3300028381 | Bacteria | 838 |
| 334 | Ga0268264_11982755 | 3300028381 | Bacteria | 591 |
| 335 | Ga0265331_10298426 | 3300031250 | Bacteria | 722 |
| 336 | Ga0307408_100092380 | 3300031548 | Bacteria | 2288 |
| 337 | Ga0307408_100996584 | 3300031548 | Bacteria | 772 |
| 338 | Ga0307516_10027228 | 3300031730 | Bacteria | 5797 |
| 339 | Ga0307405_10899979 | 3300031731 | Bacteria | 748 |
| 340 | Ga0307407_10041341 | 3300031903 | Bacteria | 2578 |
| 341 | Ga0307412_11073290 | 3300031911 | Bacteria | 715 |
| 342 | Ga0307409_102705708 | 3300031995 | Bacteria | 524 |
| 343 | Ga0373950_0092010 | 3300034818 | Bacteria | 645 |
| 344 | Ga0373926_0196061 | 3300035083 | Bacteria | 777 |
| 345 | Ga0373928_0048318 | 3300035084 | Bacteria | 998 |
| 346 | Ga0373929_0029125 | 3300035085 | Bacteria | 1170 |
| 347 | Ga0373934_0358659 | 3300035086 | Bacteria | 607 |
| 348 | Ga0373949_0178991 | 3300035090 | Bacteria | 627 |
| 349 | Ga0373952_0009255 | 3300035092 | Bacteria | 1882 |
| 350 | Ga0373952_0076640 | 3300035092 | Bacteria | 846 |
| 351 | Ga0373923_0153370 | 3300035111 | Bacteria | 1047 |
| 352 | Ga0373923_0333078 | 3300035111 | Bacteria | 722 |
| 353 | Ga0373932_0309722 | 3300035112 | Bacteria | 591 |
| 354 | Ga0373936_0031825 | 3300035113 | Bacteria | 2084 |
| 355 | Ga0373939_0094841 | 3300035114 | Bacteria | 1014 |
| 356 | Ga0373939_0228663 | 3300035114 | Bacteria | 715 |
| 357 | Ga0373941_0008268 | 3300035115 | Bacteria | 2578 |
| 358 | Ga0373945_0162314 | 3300035116 | Bacteria | 911 |
| 359 | Ga0373954_0225950 | 3300035118 | Bacteria | 921 |
| 360 | Ga0373943_0021213 | 3300035170 | Bacteria | 2998 |
| 361 | Ga0373943_0231926 | 3300035170 | Bacteria | 1032 |
| 362 | Ga0373946_0060480 | 3300035171 | Bacteria | 1610 |
| 363 | Ga0373946_0098745 | 3300035171 | Bacteria | 1306 |
| 364 | Ga0373955_0012761 | 3300035172 | Bacteria | 4048 |
| 365 | Ga0373961_0037215 | 3300035241 | Bacteria | 1389 |
| 366 | Ga0373962_0027944 | 3300035242 | Bacteria | 1528 |
| 367 | Ga0373924_0060495 | 3300035410 | Bacteria | 1584 |
| 368 | Ga0373931_0003755 | 3300035691 | Bacteria | 6867 |
| 369 | Ga0373931_0023964 | 3300035691 | Bacteria | 3086 |
| 370 | Ga0373931_0207963 | 3300035691 | Bacteria | 1172 |
| 371 | Ga0373931_0276994 | 3300035691 | Bacteria | 1029 |
| 372 | Ga0373935_0066766 | 3300035692 | Bacteria | 2312 |
| 373 | Ga0373935_0295121 | 3300035692 | Bacteria | 1144 |
| 374 | Ga0373935_0447204 | 3300035692 | Bacteria | 933 |
| 375 | Ga0373933_0018331 | 3300035724 | Bacteria | 3935 |
| 376 | Ga0373937_0132716 | 3300036401 | Bacteria | 2327 |
| 377 | Ga0373937_1048204 | 3300036401 | Bacteria | 764 |
| 378 | Ga0373925_0006466 | 3300037068 | Bacteria | 8618 |
| 379 | Ga0373925_0413370 | 3300037068 | Bacteria | 1101 |
| 380 | Ga0395905_1178099 | 3300037471 | Bacteria | 670 |
| 381 | Ga0436364_0128244 | 3300037853 | Bacteria | 654 |
| 382 | Ga0395901_0113223 | 3300038443 | Bacteria | 2849 |
| 383 | Ga0395901_1621186 | 3300038443 | Bacteria | 600 |
| 384 | Ga0436365_0033990 | 3300039437 | Bacteria | 1096 |
| 385 | Ga0436365_1869046 | 3300039437 | Bacteria | 743 |
| 386 | Ga0436360_0413036 | 3300039438 | Bacteria | 1075 |
| 387 | Ga0436360_0896156 | 3300039438 | Bacteria | 1096 |
| 388 | Ga0436361_0926373 | 3300039447 | Bacteria | 19457 |
| 389 | Ga0436363_1633486 | 3300039450 | Bacteria | 755 |
| 390 | Ga0436363_1657510 | 3300039450 | Bacteria | 612 |
| 391 | Ga0451841_0788803 | 3300041498 | Bacteria | 586 |
| 392 | Ga0451853_2634307 | 3300041512 | Bacteria | 962 |
| 393 | Ga0439441_031703 | 3300042001 | Bacteria | 1027 |
| 394 | Ga0439443_010084 | 3300042003 | Bacteria | 1365 |
| 395 | Ga0439435_0002379 | 3300042436 | Bacteria | 3720 |
| 396 | Ga0439460_0180197 | 3300042461 | Bacteria | 714 |
| 397 | Ga0450893_0085525 | 3300042532 | Bacteria | 628 |
| 398 | Ga0466968_0276667 | 3300044735 | Bacteria | 802 |
| 399 | Ga0451576_0001011 | 3300045051 | Bacteria | 51991 |
| 400 | Ga0451576_0241493 | 3300045051 | Bacteria | 1887 |
| 401 | Ga0451576_0358305 | 3300045051 | Bacteria | 1527 |
| 402 | Ga0495592_0268999 | 3300046454 | Bacteria | 1119 |
| 403 | Ga0495603_0008846 | 3300046455 | Bacteria | 6085 |
| 404 | Ga0495629_0333837 | 3300046459 | Bacteria | 1035 |
| 405 | Ga0495629_0499191 | 3300046459 | Bacteria | 821 |
| 406 | Ga0495638_0027928 | 3300046460 | Bacteria | 3648 |
| 407 | Ga0495641_0028669 | 3300046461 | Bacteria | 2691 |
| 408 | Ga0495641_0102638 | 3300046461 | Bacteria | 1276 |
| 409 | Ga0495653_0313880 | 3300046463 | Bacteria | 1018 |
| 410 | Ga0495580_0758573 | 3300046472 | Bacteria | 631 |
| 411 | Ga0495582_0111548 | 3300046473 | Bacteria | 1536 |
| 412 | Ga0495605_0155459 | 3300046474 | Bacteria | 1018 |
| 413 | Ga0495662_0060797 | 3300046476 | Bacteria | 1824 |
| 414 | Ga0495584_0010255 | 3300046491 | Bacteria | 4814 |
| 415 | Ga0495584_0040689 | 3300046491 | Bacteria | 2347 |
| 416 | Ga0495584_0127559 | 3300046491 | Bacteria | 1290 |
| 417 | Ga0495584_0131112 | 3300046491 | Bacteria | 1272 |
| 418 | Ga0495607_0069443 | 3300046501 | Bacteria | 1972 |
| 419 | Ga0495608_0155805 | 3300046511 | Bacteria | 1454 |
| 420 | Ga0495610_0225990 | 3300046512 | Bacteria | 753 |
| 421 | Ga0495616_0345026 | 3300046513 | Bacteria | 621 |
| 422 | Ga0495618_0303500 | 3300046514 | Bacteria | 992 |
| 423 | Ga0495618_0387980 | 3300046514 | Bacteria | 856 |
| 424 | Ga0495620_0195366 | 3300046515 | Bacteria | 779 |
| 425 | Ga0495628_0767550 | 3300046516 | Bacteria | 676 |
| 426 | Ga0495630_0112151 | 3300046517 | Bacteria | 2065 |
| 427 | Ga0495630_0307592 | 3300046517 | Bacteria | 1211 |
| 428 | Ga0495637_0033329 | 3300046520 | Bacteria | 2263 |
| 429 | Ga0495644_0043518 | 3300046523 | Bacteria | 1689 |
| 430 | Ga0495663_0009521 | 3300046525 | Bacteria | 2697 |
| 431 | Ga0495663_0166721 | 3300046525 | Bacteria | 758 |
| 432 | Ga0495666_0070184 | 3300046526 | Bacteria | 1666 |
| 433 | Ga0495666_0237281 | 3300046526 | Bacteria | 833 |
| 434 | Ga0495642_0242218 | 3300046528 | Bacteria | 788 |
| 435 | Ga0495642_0266100 | 3300046528 | Bacteria | 750 |
| 436 | Ga0495652_0594597 | 3300046529 | Bacteria | 755 |
| 437 | Ga0495640_0089125 | 3300046533 | Bacteria | 2038 |
| 438 | Ga0495587_0499825 | 3300046536 | Bacteria | 672 |
| 439 | Ga0495598_0001377 | 3300046537 | Bacteria | 4788 |
| 440 | Ga0495598_0040263 | 3300046537 | Bacteria | 1362 |
| 441 | Ga0495609_0229053 | 3300046538 | Bacteria | 770 |
| 442 | Ga0495621_0286306 | 3300046539 | Bacteria | 680 |
| 443 | Ga0495645_0298700 | 3300046543 | Bacteria | 1053 |
| 444 | Ga0495622_0014213 | 3300046557 | Bacteria | 3697 |
| 445 | Ga0495633_0247919 | 3300046558 | Bacteria | 813 |
| 446 | Ga0495656_0026187 | 3300046615 | Bacteria | 2319 |
| 447 | Ga0495668_0329714 | 3300046616 | Bacteria | 837 |
| 448 | Ga0495634_0546705 | 3300046642 | Bacteria | 675 |
| 449 | Ga0495611_0240218 | 3300046648 | Bacteria | 841 |
| 450 | Ga0495659_0029541 | 3300046664 | Bacteria | 1904 |
| 451 | Ga0495659_0102636 | 3300046664 | Bacteria | 1109 |
| 452 | Ga0495659_0179833 | 3300046664 | Bacteria | 861 |
| 453 | Ga0495659_0246137 | 3300046664 | Bacteria | 744 |
| 454 | Ga0495661_0068016 | 3300046665 | Bacteria | 2091 |
| 455 | Ga0495588_0018784 | 3300046674 | Bacteria | 3376 |
| 456 | Ga0495646_0070063 | 3300046680 | Bacteria | 2067 |
| 457 | Ga0495647_0377641 | 3300046681 | Bacteria | 648 |
| 458 | Ga0495658_0047906 | 3300046683 | Bacteria | 2408 |
| 459 | Ga0495658_0093185 | 3300046683 | Bacteria | 1787 |
| 460 | Ga0495669_0033254 | 3300046684 | Bacteria | 2269 |
| 461 | Ga0495613_0118543 | 3300046689 | Bacteria | 1902 |
| 462 | Ga0495613_0135075 | 3300046689 | Bacteria | 1765 |
| 463 | Ga0495624_0031919 | 3300046690 | Bacteria | 3419 |
| 464 | Ga0495670_0035330 | 3300046691 | Bacteria | 2491 |
| 465 | Ga0495671_0042607 | 3300046692 | Bacteria | 2281 |
| 466 | Ga0495671_0626816 | 3300046692 | Bacteria | 511 |
| 467 | Ga0495649_0079569 | 3300046694 | Bacteria | 1753 |
| 468 | Ga0495600_0261478 | 3300046809 | Bacteria | 1099 |
| 469 | Ga0495581_0107934 | 3300047315 | Bacteria | 1618 |
| 470 | Ga0495581_0362557 | 3300047315 | Bacteria | 846 |
| 471 | Ga0495604_0054313 | 3300047317 | Bacteria | 3092 |
| 472 | Ga0495604_0242813 | 3300047317 | Bacteria | 1231 |
| 473 | Ga0495674_0198305 | 3300047319 | Bacteria | 1666 |
| 474 | Ga0495674_0215273 | 3300047319 | Bacteria | 1590 |
| 475 | Ga0495674_0445243 | 3300047319 | Bacteria | 1041 |
| 476 | Ga0495676_0077096 | 3300047321 | Bacteria | 2542 |
| 477 | Ga0495676_0138827 | 3300047321 | Bacteria | 1744 |
| 478 | Ga0495680_0162340 | 3300047322 | Bacteria | 1622 |
| 479 | Ga0495680_0253760 | 3300047322 | Bacteria | 1246 |
| 480 | Ga0495680_0560824 | 3300047322 | Bacteria | 768 |
| 481 | Ga0495683_0082792 | 3300047323 | Bacteria | 1563 |
| 482 | Ga0495677_0336906 | 3300047445 | Bacteria | 595 |
| 483 | Ga0495673_0249049 | 3300047469 | Bacteria | 649 |
| 484 | Ga0495684_0453994 | 3300047471 | Bacteria | 890 |
| 485 | Ga0495593_0179193 | 3300047673 | Bacteria | 1067 |
| 486 | Ga0495602_0313810 | 3300048088 | Bacteria | 1143 |
| 487 | Ga0495626_0147336 | 3300048091 | Bacteria | 995 |
| 488 | Ga0496100_0085059 | 3300048903 | Bacteria | 2145 |
| 489 | Ga0496100_0108408 | 3300048903 | Bacteria | 1926 |
| 490 | Ga0496101_0005989 | 3300048904 | Bacteria | 7795 |
| 491 | Ga0496102_0004367 | 3300048905 | Bacteria | 11948 |
| 492 | Ga0496102_0522547 | 3300048905 | Bacteria | 1109 |
| 493 | Ga0496102_0528153 | 3300048905 | Bacteria | 1102 |
| 494 | Ga0496102_1599717 | 3300048905 | Bacteria | 570 |
| 495 | Ga0496103_0038315 | 3300048906 | Bacteria | 2940 |
| 496 | Ga0496103_0138543 | 3300048906 | Bacteria | 1555 |
| 497 | Ga0496104_0001514 | 3300048907 | Bacteria | 20053 |
| 498 | Ga0496104_0002405 | 3300048907 | Bacteria | 16114 |
| 499 | Ga0496104_0010373 | 3300048907 | Bacteria | 8322 |
| 500 | Ga0496104_0152132 | 3300048907 | Bacteria | 2220 |
| 501 | Ga0496105_0001433 | 3300048908 | Bacteria | 16775 |
| 502 | Ga0496105_0015510 | 3300048908 | Bacteria | 6074 |
| 503 | Ga0496105_0043404 | 3300048908 | Bacteria | 3708 |
| 504 | Ga0496106_0002564 | 3300048909 | Bacteria | 13516 |
| 505 | Ga0496106_0090643 | 3300048909 | Bacteria | 2359 |
| 506 | Ga0496106_0216906 | 3300048909 | Bacteria | 1525 |
| 507 | Ga0496107_0037178 | 3300048910 | Bacteria | 3493 |
| 508 | Ga0496107_0355690 | 3300048910 | Bacteria | 1090 |
| 509 | Ga0496108_0001000 | 3300048911 | Bacteria | 22074 |
| 510 | Ga0496108_0157204 | 3300048911 | Bacteria | 1963 |
| 511 | Ga0496108_0406611 | 3300048911 | Bacteria | 1189 |
| 512 | Ga0496109_0000796 | 3300048912 | Bacteria | 26244 |
| 513 | Ga0496109_0048468 | 3300048912 | Bacteria | 3865 |
| 514 | Ga0496109_0195787 | 3300048912 | Bacteria | 1899 |
| 515 | Ga0496109_0290946 | 3300048912 | Bacteria | 1540 |
| 516 | Ga0496110_0015804 | 3300048913 | Bacteria | 6292 |
| 517 | Ga0496110_0049074 | 3300048913 | Bacteria | 3701 |
| 518 | Ga0496110_0117127 | 3300048913 | Bacteria | 2399 |
| 519 | Ga0496110_0537023 | 3300048913 | Bacteria | 1063 |
| 520 | Ga0496111_0020981 | 3300048914 | Bacteria | 4554 |
| 521 | Ga0496111_0073078 | 3300048914 | Bacteria | 2497 |
| 522 | Ga0496111_0416203 | 3300048914 | Bacteria | 993 |
| 523 | Ga0496112_0000476 | 3300048915 | Bacteria | 26879 |
| 524 | Ga0496112_0168369 | 3300048915 | Bacteria | 2157 |
| 525 | Ga0496112_0214512 | 3300048915 | Bacteria | 1881 |
| 526 | Ga0496112_1055184 | 3300048915 | Bacteria | 731 |
| 527 | Ga0496113_0000247 | 3300048916 | Bacteria | 25543 |
| 528 | Ga0496114_0420670 | 3300048917 | Bacteria | 1183 |
| 529 | Ga0496114_0768348 | 3300048917 | Bacteria | 841 |
| 530 | Ga0496115_0055008 | 3300048918 | Bacteria | 3196 |
| 531 | Ga0496115_0055800 | 3300048918 | Bacteria | 3174 |
| 532 | Ga0496115_0224842 | 3300048918 | Bacteria | 1548 |
| 533 | Ga0496115_0362683 | 3300048918 | Bacteria | 1180 |
| 534 | Ga0501032_0351777 | 3300049569 | Bacteria | 949 |
| 535 | Ga0501032_0784214 | 3300049569 | Bacteria | 602 |
| 536 | Ga0501033_0137745 | 3300049570 | Bacteria | 1766 |
| 537 | Ga0501034_0016043 | 3300049571 | Bacteria | 7687 |
| 538 | Ga0501036_0044637 | 3300049572 | Bacteria | 3755 |
| 539 | Ga0501036_0211976 | 3300049572 | Bacteria | 1627 |
| 540 | Ga0501036_0328666 | 3300049572 | Bacteria | 1277 |
| 541 | Ga0501037_0066756 | 3300049573 | Bacteria | 2620 |
| 542 | Ga0501037_0496916 | 3300049573 | Bacteria | 828 |
| 543 | Ga0501038_0185165 | 3300049574 | Bacteria | 1678 |
| 544 | Ga0501039_0038492 | 3300049575 | Bacteria | 3693 |
| 545 | Ga0501039_0040879 | 3300049575 | Bacteria | 3579 |
| 546 | Ga0501040_0005009 | 3300049576 | Bacteria | 8566 |
| 547 | Ga0501040_0012423 | 3300049576 | Bacteria | 5580 |
| 548 | Ga0501040_0016503 | 3300049576 | Bacteria | 4890 |
| 549 | Ga0501040_0088923 | 3300049576 | Bacteria | 2145 |
| 550 | Ga0501041_0005100 | 3300049577 | Bacteria | 7661 |
| 551 | Ga0501041_0006778 | 3300049577 | Bacteria | 6712 |
| 552 | Ga0501041_0010247 | 3300049577 | Bacteria | 5523 |
| 553 | Ga0501043_0021134 | 3300049579 | Bacteria | 5102 |
| 554 | Ga0501043_0074910 | 3300049579 | Bacteria | 2659 |
| 555 | Ga0501046_0050564 | 3300049580 | Bacteria | 3283 |
| 556 | Ga0501046_0580895 | 3300049580 | Bacteria | 796 |
| 557 | Ga0501046_0766500 | 3300049580 | Bacteria | 677 |
| 558 | Ga0501048_0048310 | 3300049582 | Bacteria | 3036 |
| 559 | Ga0501048_0179561 | 3300049582 | Bacteria | 1500 |
| 560 | Ga0501068_0015908 | 3300049584 | Bacteria | 4332 |
| 561 | Ga0501068_0037492 | 3300049584 | Bacteria | 2902 |
| 562 | Ga0501068_0372509 | 3300049584 | Bacteria | 919 |
| 563 | Ga0501070_0476470 | 3300049586 | Bacteria | 1004 |
| 564 | Ga0501071_0033677 | 3300049587 | Bacteria | 3640 |
| 565 | Ga0501071_0692836 | 3300049587 | Bacteria | 784 |
| 566 | Ga0501072_0006855 | 3300049588 | Bacteria | 8647 |
| 567 | Ga0501072_0023786 | 3300049588 | Bacteria | 4759 |
| 568 | Ga0501073_0037597 | 3300049589 | Bacteria | 3435 |
| 569 | Ga0501073_0439585 | 3300049589 | Bacteria | 902 |
| 570 | Ga0501074_0031647 | 3300049590 | Bacteria | 3833 |
| 571 | Ga0501074_0125825 | 3300049590 | Bacteria | 1833 |
| 572 | Ga0501074_0930862 | 3300049590 | Bacteria | 611 |
| 573 | Ga0501075_0003655 | 3300049591 | Bacteria | 10317 |
| 574 | Ga0501075_0082723 | 3300049591 | Bacteria | 2431 |
| 575 | Ga0501076_0000778 | 3300049592 | Bacteria | 20562 |
| 576 | Ga0501076_0003675 | 3300049592 | Bacteria | 10785 |
| 577 | Ga0501076_0613385 | 3300049592 | Bacteria | 898 |
| 578 | Ga0501077_0044313 | 3300049593 | Bacteria | 2826 |
| 579 | Ga0501077_0210342 | 3300049593 | Bacteria | 1236 |
| 580 | Ga0501230_098241 | 3300049667 | Bacteria | 629 |
| 581 | Ga0501079_0017301 | 3300049741 | Bacteria | 5505 |
| 582 | Ga0501079_0021835 | 3300049741 | Bacteria | 4901 |
| 583 | Ga0501079_0172570 | 3300049741 | Bacteria | 1686 |
| 584 | Ga0501079_0738854 | 3300049741 | Bacteria | 775 |
| 585 | Ga0501080_0016458 | 3300049742 | Bacteria | 6829 |
| 586 | Ga0501080_0017334 | 3300049742 | Bacteria | 6658 |
| 587 | Ga0501080_0030755 | 3300049742 | Bacteria | 5002 |
| 588 | Ga0501081_0000811 | 3300049743 | Bacteria | 18451 |
| 589 | Ga0501081_0004676 | 3300049743 | Bacteria | 8798 |
| 590 | Ga0501035_0112949 | 3300049822 | Bacteria | 2380 |
| 591 | Ga0501035_0159828 | 3300049822 | Bacteria | 1951 |
| 592 | Ga0501044_0247039 | 3300049823 | Bacteria | 1727 |
| 593 | Ga0501045_0009308 | 3300049824 | Bacteria | 6872 |
| 594 | Ga0501045_0052146 | 3300049824 | Bacteria | 2986 |
| 595 | nmdc:mga03683_36794_c2 | 3300050489 | Bacteria | 1002 |
| 596 | nmdc:mga03n38_403923_c1 | 3300050490 | Bacteria | 752 |
| 597 | nmdc:mga00v17_15271_c1 | 3300050491 | Bacteria | 4307 |
| 598 | nmdc:mga00v17_461305_c1 | 3300050491 | Bacteria | 824 |
| 599 | nmdc:mga0yw44_157579_c1 | 3300050492 | Bacteria | 1485 |
| 600 | nmdc:mga0yw44_279395_c1 | 3300050492 | Bacteria | 1116 |
| 601 | nmdc:mga0yw44_300524_c1 | 3300050492 | Bacteria | 1075 |
| 602 | nmdc:mga0k408_29654_c1 | 3300050493 | Bacteria | 1193 |
| 603 | nmdc:mga06z11_133389_c1 | 3300050494 | Bacteria | 1397 |
| 604 | nmdc:mga06z11_272613_c1 | 3300050494 | Bacteria | 1001 |
| 605 | nmdc:mga04h51_5555_c1 | 3300050495 | Bacteria | 3219 |
| 606 | nmdc:mga07m45_136346_c1 | 3300050496 | Bacteria | 1421 |
| 607 | nmdc:mga05p37_1522919_c1 | 3300050507 | Bacteria | 664 |
| 608 | nmdc:mga05p37_162879_c1 | 3300050507 | Bacteria | 2723 |
| 609 | nmdc:mga05p37_35564_c1 | 3300050507 | Bacteria | 6108 |
| 610 | nmdc:mga05p37_413812_c1 | 3300050507 | Bacteria | 1571 |
| 611 | nmdc:mga05p37_483507_c1 | 3300050507 | Bacteria | 1425 |
| 612 | nmdc:mga05p37_597536_c1 | 3300050507 | Bacteria | 1246 |
| 613 | nmdc:mga05p37_65954_c1 | 3300050507 | Bacteria | 4454 |
| 614 | nmdc:mga09592_219051_c1 | 3300050508 | Bacteria | 1649 |
| 615 | nmdc:mga09592_759720_c1 | 3300050508 | Bacteria | 822 |
| 616 | nmdc:mga0qj67_119206_c1 | 3300050509 | Bacteria | 2134 |
| 617 | nmdc:mga0qj67_14086_c1 | 3300050509 | Bacteria | 6039 |
| 618 | nmdc:mga0qj67_233204_c1 | 3300050509 | Bacteria | 1493 |
| 619 | nmdc:mga0qj67_37_c1 | 3300050509 | Bacteria | 92978 |
| 620 | nmdc:mga0qj67_433206_c1 | 3300050509 | Bacteria | 1060 |
| 621 | nmdc:mga06r32_100411_c1 | 3300050510 | Bacteria | 2839 |
| 622 | nmdc:mga06r32_190951_c1 | 3300050510 | Bacteria | 2036 |
| 623 | nmdc:mga06r32_19965_c1 | 3300050510 | Bacteria | 6160 |
| 624 | nmdc:mga06r32_434933_c1 | 3300050510 | Bacteria | 1293 |
| 625 | nmdc:mga06r32_827733_c1 | 3300050510 | Bacteria | 885 |
| 626 | nmdc:mga08y16_146228_c1 | 3300050511 | Bacteria | 2457 |
| 627 | nmdc:mga08y16_178249_c1 | 3300050511 | Bacteria | 2207 |
| 628 | nmdc:mga08y16_445810_c1 | 3300050511 | Bacteria | 1320 |
| 629 | nmdc:mga08y16_97419_c1 | 3300050511 | Bacteria | 3063 |
| 630 | nmdc:mga0n895_116878_c1 | 3300050512 | Bacteria | 2686 |
| 631 | nmdc:mga0n895_27822_c1 | 3300050512 | Bacteria | 5373 |
| 632 | nmdc:mga0n895_434508_c1 | 3300050512 | Bacteria | 1326 |
| 633 | nmdc:mga0rr50_1113976_c1 | 3300050513 | Bacteria | 671 |
| 634 | nmdc:mga0rr50_150121_c1 | 3300050513 | Bacteria | 1882 |
| 635 | nmdc:mga0rr50_209563_c1 | 3300050513 | Bacteria | 1605 |
| 636 | nmdc:mga08x19_273952_c1 | 3300050514 | Bacteria | 1168 |
| 637 | nmdc:mga0a205_400377_c1 | 3300050515 | Bacteria | 1236 |
| 638 | nmdc:mga0sz30_17451_c1 | 3300050516 | Bacteria | 2863 |
| 639 | Ga0495601_0040523 | 3300053077 | Bacteria | 2917 |
| 640 | Ga0495601_0301119 | 3300053077 | Bacteria | 1044 |
| 641 | Ga0495612_0039532 | 3300053078 | Bacteria | 1919 |
| 642 | Ga0495612_0116298 | 3300053078 | Bacteria | 1148 |
| 643 | Ga0495612_0134173 | 3300053078 | Bacteria | 1071 |
| 644 | Ga0495655_0018253 | 3300053083 | Bacteria | 1539 |
| 645 | Ga0495655_0040008 | 3300053083 | Bacteria | 1191 |
| 646 | Ga0495595_0008961 | 3300053084 | Bacteria | 4126 |
| 647 | Ga0495595_0203020 | 3300053084 | Bacteria | 987 |
| 648 | Ga0495619_0007761 | 3300053085 | Bacteria | 6791 |
| 649 | Ga0495619_0073057 | 3300053085 | Bacteria | 2298 |
| 650 | Ga0495619_0136034 | 3300053085 | Bacteria | 1690 |
| 651 | Ga0495619_0975068 | 3300053085 | Bacteria | 568 |
| 652 | Ga0500578_0644809 | 3300053086 | Bacteria | 576 |
| 653 | Ga0500621_247740 | 3300053126 | Bacteria | 600 |
| 654 | Ga0500568_0291704 | 3300053139 | Bacteria | 592 |
| 655 | Ga0500587_026984 | 3300053739 | Bacteria | 772 |
| 656 | Ga0501084_0411967 | 3300054114 | Bacteria | 1142 |
| 657 | Ga0501082_0002254 | 3300060353 | Bacteria | 16885 |
| 658 | Ga0501082_0020235 | 3300060353 | Bacteria | 5735 |
| 659 | Ga0501082_0711896 | 3300060353 | Bacteria | 879 |
| 660 | Ga0501082_0893467 | 3300060353 | Bacteria | 777 |
| 661 | Ga0530510_0000247 | 3300061734 | Bacteria | 33846 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0580895 | Ga0501046_0580895_364_780 | 138 |
| 2 | 3300025918 | Ga0207662_10240217 | Ga0207662_102402174 | 141 |
| 3 | 3300025893 | Ga0207682_10106712 | Ga0207682_101067122 | 142 |
| 4 | 3300035083 | Ga0373926_0196061 | Ga0373926_0196061_330_767 | 145 |
| 5 | 3300049571 | Ga0501034_0016043 | Ga0501034_0016043_178_618 | 145 |
| 6 | 3300046512 | Ga0495610_0225990 | Ga0495610_0225990_59_517 | 146 |
| 7 | 3300046515 | Ga0495620_0195366 | Ga0495620_0195366_249_707 | 146 |
| 8 | 3300046528 | Ga0495642_0266100 | Ga0495642_0266100_38_496 | 146 |
| 9 | 3300046684 | Ga0495669_0033254 | Ga0495669_0033254_795_1253 | 146 |
| 10 | 3300046692 | Ga0495671_0626816 | Ga0495671_0626816_28_486 | 146 |
| 11 | 3300047469 | Ga0495673_0249049 | Ga0495673_0249049_116_574 | 146 |
| 12 | 3300053126 | Ga0500621_247740 | Ga0500621_247740_39_497 | 146 |
| 13 | 3300053139 | Ga0500568_0291704 | Ga0500568_0291704_122_580 | 146 |
| 14 | 3300053739 | Ga0500587_026984 | Ga0500587_026984_66_524 | 146 |
| 15 | 3300005334 | Ga0068869_100074085 | Ga0068869_1000740853 | 148 |
| 16 | 3300005459 | Ga0068867_100271209 | Ga0068867_1002712091 | 148 |
| 17 | 3300009148 | Ga0105243_10071374 | Ga0105243_100713742 | 148 |
| 18 | 3300009551 | Ga0105238_10483143 | Ga0105238_104831431 | 148 |
| 19 | 3300013306 | Ga0163162_10779196 | Ga0163162_107791961 | 148 |
| 20 | 3300025931 | Ga0207644_10998987 | Ga0207644_109989872 | 148 |
| 21 | 3300025935 | Ga0207709_10012652 | Ga0207709_100126522 | 148 |
| 22 | 3300005330 | Ga0070690_100547308 | Ga0070690_1005473082 | 149 |
| 23 | 3300005356 | Ga0070674_100301417 | Ga0070674_1003014172 | 149 |
| 24 | 3300005718 | Ga0068866_10269137 | Ga0068866_102691372 | 149 |
| 25 | 3300006358 | Ga0068871_100109638 | Ga0068871_1001096382 | 149 |
| 26 | 3300009176 | Ga0105242_10107759 | Ga0105242_101077592 | 149 |
| 27 | 3300009176 | Ga0105242_10926624 | Ga0105242_109266242 | 149 |
| 28 | 3300009553 | Ga0105249_10780319 | Ga0105249_107803192 | 149 |
| 29 | 3300014969 | Ga0157376_10026276 | Ga0157376_100262762 | 149 |
| 30 | 3300017792 | Ga0163161_10666999 | Ga0163161_106669991 | 149 |
| 31 | 3300025899 | Ga0207642_10170375 | Ga0207642_101703752 | 149 |
| 32 | 3300025937 | Ga0207669_10150832 | Ga0207669_101508322 | 149 |
| 33 | 3300025961 | Ga0207712_11503265 | Ga0207712_115032651 | 149 |
| 34 | 3300026023 | Ga0207677_10345603 | Ga0207677_103456032 | 149 |
| 35 | 3300026089 | Ga0207648_10545603 | Ga0207648_105456032 | 149 |
| 36 | 3300035692 | Ga0373935_0447204 | Ga0373935_0447204_157_609 | 149 |
| 37 | 3300039438 | Ga0436360_0896156 | Ga0436360_0896156_445_912 | 149 |
| 38 | 3300039450 | Ga0436363_1657510 | Ga0436363_1657510_128_595 | 149 |
| 39 | 3300045051 | Ga0451576_0001011 | Ga0451576_0001011_33779_34237 | 149 |
| 40 | 3300046454 | Ga0495592_0268999 | Ga0495592_0268999_376_843 | 149 |
| 41 | 3300046463 | Ga0495653_0313880 | Ga0495653_0313880_182_649 | 149 |
| 42 | 3300046511 | Ga0495608_0155805 | Ga0495608_0155805_680_1147 | 149 |
| 43 | 3300046514 | Ga0495618_0387980 | Ga0495618_0387980_28_495 | 149 |
| 44 | 3300046529 | Ga0495652_0594597 | Ga0495652_0594597_289_744 | 149 |
| 45 | 3300046536 | Ga0495587_0499825 | Ga0495587_0499825_36_503 | 149 |
| 46 | 3300046809 | Ga0495600_0261478 | Ga0495600_0261478_136_603 | 149 |
| 47 | 3300047317 | Ga0495604_0054313 | Ga0495604_0054313_2219_2686 | 149 |
| 48 | 3300047471 | Ga0495684_0453994 | Ga0495684_0453994_219_686 | 149 |
| 49 | 3300048088 | Ga0495602_0313810 | Ga0495602_0313810_292_759 | 149 |
| 50 | 3300049584 | Ga0501068_0015908 | Ga0501068_0015908_3648_4097 | 149 |
| 51 | 3300049586 | Ga0501070_0476470 | Ga0501070_0476470_377_826 | 149 |
| 52 | 3300049589 | Ga0501073_0037597 | Ga0501073_0037597_597_1046 | 149 |
| 53 | 3300049590 | Ga0501074_0031647 | Ga0501074_0031647_1541_1990 | 149 |
| 54 | 3300049742 | Ga0501080_0030755 | Ga0501080_0030755_4138_4587 | 149 |
| 55 | 3300053077 | Ga0495601_0040523 | Ga0495601_0040523_722_1189 | 149 |
| 56 | 3300053078 | Ga0495612_0039532 | Ga0495612_0039532_104_571 | 149 |
| 57 | 3300053084 | Ga0495595_0008961 | Ga0495595_0008961_3503_3970 | 149 |
| 58 | 3300053085 | Ga0495619_0136034 | Ga0495619_0136034_971_1438 | 149 |
| 59 | 3300053085 | Ga0495619_0975068 | Ga0495619_0975068_38_490 | 149 |
| 60 | 3300054114 | Ga0501084_0411967 | Ga0501084_0411967_26_475 | 149 |
| 61 | 3300060353 | Ga0501082_0711896 | Ga0501082_0711896_210_659 | 149 |
| 62 | 3300002075 | JGI24738J21930_10089683 | JGI24738J21930_100896831 | 150 |
| 63 | 3300003203 | JGI25406J46586_10019721 | JGI25406J46586_100197212 | 150 |
| 64 | 3300003215 | JGI25153J46596_10046480 | JGI25153J46596_100464801 | 150 |
| 65 | 3300005328 | Ga0070676_10297780 | Ga0070676_102977801 | 150 |
| 66 | 3300005328 | Ga0070676_10575508 | Ga0070676_105755082 | 150 |
| 67 | 3300005329 | Ga0070683_100595733 | Ga0070683_1005957332 | 150 |
| 68 | 3300005329 | Ga0070683_101064341 | Ga0070683_1010643412 | 150 |
| 69 | 3300005330 | Ga0070690_100097605 | Ga0070690_1000976052 | 150 |
| 70 | 3300005330 | Ga0070690_100619143 | Ga0070690_1006191431 | 150 |
| 71 | 3300005331 | Ga0070670_102154551 | Ga0070670_1021545511 | 150 |
| 72 | 3300005333 | Ga0070677_10214350 | Ga0070677_102143502 | 150 |
| 73 | 3300005334 | Ga0068869_100110048 | Ga0068869_1001100482 | 150 |
| 74 | 3300005335 | Ga0070666_10450101 | Ga0070666_104501012 | 150 |
| 75 | 3300005335 | Ga0070666_10874670 | Ga0070666_108746701 | 150 |
| 76 | 3300005337 | Ga0070682_100981176 | Ga0070682_1009811761 | 150 |
| 77 | 3300005338 | Ga0068868_100497971 | Ga0068868_1004979711 | 150 |
| 78 | 3300005338 | Ga0068868_100674307 | Ga0068868_1006743072 | 150 |
| 79 | 3300005339 | Ga0070660_100160134 | Ga0070660_1001601342 | 150 |
| 80 | 3300005340 | Ga0070689_100023592 | Ga0070689_1000235922 | 150 |
| 81 | 3300005340 | Ga0070689_100618441 | Ga0070689_1006184412 | 150 |
| 82 | 3300005340 | Ga0070689_100979023 | Ga0070689_1009790231 | 150 |
| 83 | 3300005343 | Ga0070687_100172413 | Ga0070687_1001724132 | 150 |
| 84 | 3300005344 | Ga0070661_100047200 | Ga0070661_1000472002 | 150 |
| 85 | 3300005345 | Ga0070692_10021173 | Ga0070692_100211734 | 150 |
| 86 | 3300005345 | Ga0070692_10143702 | Ga0070692_101437021 | 150 |
| 87 | 3300005347 | Ga0070668_100077039 | Ga0070668_1000770392 | 150 |
| 88 | 3300005353 | Ga0070669_100026933 | Ga0070669_1000269332 | 150 |
| 89 | 3300005353 | Ga0070669_100238826 | Ga0070669_1002388262 | 150 |
| 90 | 3300005353 | Ga0070669_100345876 | Ga0070669_1003458762 | 150 |
| 91 | 3300005353 | Ga0070669_100686572 | Ga0070669_1006865721 | 150 |
| 92 | 3300005354 | Ga0070675_100725841 | Ga0070675_1007258411 | 150 |
| 93 | 3300005355 | Ga0070671_100592454 | Ga0070671_1005924542 | 150 |
| 94 | 3300005355 | Ga0070671_100772364 | Ga0070671_1007723642 | 150 |
| 95 | 3300005355 | Ga0070671_100814177 | Ga0070671_1008141772 | 150 |
| 96 | 3300005356 | Ga0070674_100121072 | Ga0070674_1001210722 | 150 |
| 97 | 3300005364 | Ga0070673_100239335 | Ga0070673_1002393352 | 150 |
| 98 | 3300005364 | Ga0070673_100376511 | Ga0070673_1003765112 | 150 |
| 99 | 3300005365 | Ga0070688_100007930 | Ga0070688_1000079304 | 150 |
| 100 | 3300005366 | Ga0070659_100158881 | Ga0070659_1001588812 | 150 |
| 101 | 3300005366 | Ga0070659_100231523 | Ga0070659_1002315232 | 150 |
| 102 | 3300005406 | Ga0070703_10219013 | Ga0070703_102190132 | 150 |
| 103 | 3300005436 | Ga0070713_101218478 | Ga0070713_1012184781 | 150 |
| 104 | 3300005437 | Ga0070710_10074578 | Ga0070710_100745783 | 150 |
| 105 | 3300005438 | Ga0070701_10041962 | Ga0070701_100419622 | 150 |
| 106 | 3300005438 | Ga0070701_10140038 | Ga0070701_101400382 | 150 |
| 107 | 3300005439 | Ga0070711_100048438 | Ga0070711_1000484382 | 150 |
| 108 | 3300005440 | Ga0070705_100325872 | Ga0070705_1003258722 | 150 |
| 109 | 3300005440 | Ga0070705_100670385 | Ga0070705_1006703852 | 150 |
| 110 | 3300005441 | Ga0070700_100030843 | Ga0070700_1000308432 | 150 |
| 111 | 3300005444 | Ga0070694_100003687 | Ga0070694_1000036876 | 150 |
| 112 | 3300005444 | Ga0070694_100011986 | Ga0070694_1000119862 | 150 |
| 113 | 3300005444 | Ga0070694_100515033 | Ga0070694_1005150332 | 150 |
| 114 | 3300005445 | Ga0070708_100035446 | Ga0070708_1000354462 | 150 |
| 115 | 3300005456 | Ga0070678_100205201 | Ga0070678_1002052011 | 150 |
| 116 | 3300005456 | Ga0070678_100427434 | Ga0070678_1004274341 | 150 |
| 117 | 3300005457 | Ga0070662_100119227 | Ga0070662_1001192272 | 150 |
| 118 | 3300005459 | Ga0068867_100240203 | Ga0068867_1002402032 | 150 |
| 119 | 3300005466 | Ga0070685_10852788 | Ga0070685_108527881 | 150 |
| 120 | 3300005468 | Ga0070707_100132410 | Ga0070707_1001324102 | 150 |
| 121 | 3300005535 | Ga0070684_100079560 | Ga0070684_1000795602 | 150 |
| 122 | 3300005536 | Ga0070697_100069775 | Ga0070697_1000697752 | 150 |
| 123 | 3300005543 | Ga0070672_100166225 | Ga0070672_1001662252 | 150 |
| 124 | 3300005543 | Ga0070672_100228744 | Ga0070672_1002287442 | 150 |
| 125 | 3300005543 | Ga0070672_100281624 | Ga0070672_1002816242 | 150 |
| 126 | 3300005544 | Ga0070686_100016847 | Ga0070686_1000168473 | 150 |
| 127 | 3300005544 | Ga0070686_100135417 | Ga0070686_1001354172 | 150 |
| 128 | 3300005545 | Ga0070695_100024926 | Ga0070695_1000249262 | 150 |
| 129 | 3300005545 | Ga0070695_101099167 | Ga0070695_1010991671 | 150 |
| 130 | 3300005546 | Ga0070696_100857490 | Ga0070696_1008574902 | 150 |
| 131 | 3300005546 | Ga0070696_101213883 | Ga0070696_1012138831 | 150 |
| 132 | 3300005547 | Ga0070693_100006517 | Ga0070693_1000065173 | 150 |
| 133 | 3300005548 | Ga0070665_101024468 | Ga0070665_1010244682 | 150 |
| 134 | 3300005549 | Ga0070704_100006684 | Ga0070704_1000066847 | 150 |
| 135 | 3300005563 | Ga0068855_100606402 | Ga0068855_1006064022 | 150 |
| 136 | 3300005577 | Ga0068857_100619536 | Ga0068857_1006195362 | 150 |
| 137 | 3300005578 | Ga0068854_100808536 | Ga0068854_1008085362 | 150 |
| 138 | 3300005615 | Ga0070702_100404488 | Ga0070702_1004044882 | 150 |
| 139 | 3300005616 | Ga0068852_100067879 | Ga0068852_1000678792 | 150 |
| 140 | 3300005616 | Ga0068852_101206056 | Ga0068852_1012060562 | 150 |
| 141 | 3300005617 | Ga0068859_100126230 | Ga0068859_1001262302 | 150 |
| 142 | 3300005617 | Ga0068859_101113117 | Ga0068859_1011131172 | 150 |
| 143 | 3300005618 | Ga0068864_100052031 | Ga0068864_1000520313 | 150 |
| 144 | 3300005618 | Ga0068864_100142366 | Ga0068864_1001423662 | 150 |
| 145 | 3300005618 | Ga0068864_100200050 | Ga0068864_1002000502 | 150 |
| 146 | 3300005718 | Ga0068866_10576982 | Ga0068866_105769821 | 150 |
| 147 | 3300005719 | Ga0068861_100146736 | Ga0068861_1001467362 | 150 |
| 148 | 3300005834 | Ga0068851_10299804 | Ga0068851_102998042 | 150 |
| 149 | 3300005840 | Ga0068870_10064212 | Ga0068870_100642122 | 150 |
| 150 | 3300005841 | Ga0068863_100216665 | Ga0068863_1002166652 | 150 |
| 151 | 3300005841 | Ga0068863_100871778 | Ga0068863_1008717782 | 150 |
| 152 | 3300005842 | Ga0068858_100185575 | Ga0068858_1001855752 | 150 |
| 153 | 3300005842 | Ga0068858_100232871 | Ga0068858_1002328712 | 150 |
| 154 | 3300005843 | Ga0068860_100998422 | Ga0068860_1009984222 | 150 |
| 155 | 3300005844 | Ga0068862_100320016 | Ga0068862_1003200162 | 150 |
| 156 | 3300005937 | Ga0081455_10000759 | Ga0081455_100007595 | 150 |
| 157 | 3300005937 | Ga0081455_10004199 | Ga0081455_100041996 | 150 |
| 158 | 3300005937 | Ga0081455_10010372 | Ga0081455_100103725 | 150 |
| 159 | 3300005937 | Ga0081455_10063042 | Ga0081455_100630422 | 150 |
| 160 | 3300005937 | Ga0081455_10141522 | Ga0081455_101415222 | 150 |
| 161 | 3300005981 | Ga0081538_10000527 | Ga0081538_1000052736 | 150 |
| 162 | 3300005981 | Ga0081538_10033045 | Ga0081538_100330452 | 150 |
| 163 | 3300005981 | Ga0081538_10048084 | Ga0081538_100480842 | 150 |
| 164 | 3300005983 | Ga0081540_1166045 | Ga0081540_11660452 | 150 |
| 165 | 3300005985 | Ga0081539_10002942 | Ga0081539_100029429 | 150 |
| 166 | 3300005985 | Ga0081539_10087764 | Ga0081539_100877641 | 150 |
| 167 | 3300006028 | Ga0070717_10106475 | Ga0070717_101064752 | 150 |
| 168 | 3300006028 | Ga0070717_10485425 | Ga0070717_104854252 | 150 |
| 169 | 3300006028 | Ga0070717_10518270 | Ga0070717_105182701 | 150 |
| 170 | 3300006038 | Ga0075365_10039069 | Ga0075365_100390694 | 150 |
| 171 | 3300006038 | Ga0075365_10142034 | Ga0075365_101420342 | 150 |
| 172 | 3300006038 | Ga0075365_10343832 | Ga0075365_103438322 | 150 |
| 173 | 3300006038 | Ga0075365_10493475 | Ga0075365_104934752 | 150 |
| 174 | 3300006042 | Ga0075368_10084706 | Ga0075368_100847061 | 150 |
| 175 | 3300006048 | Ga0075363_100026412 | Ga0075363_1000264124 | 150 |
| 176 | 3300006048 | Ga0075363_100465669 | Ga0075363_1004656692 | 150 |
| 177 | 3300006051 | Ga0075364_10019489 | Ga0075364_100194892 | 150 |
| 178 | 3300006051 | Ga0075364_10690583 | Ga0075364_106905832 | 150 |
| 179 | 3300006163 | Ga0070715_10852957 | Ga0070715_108529572 | 150 |
| 180 | 3300006173 | Ga0070716_100131238 | Ga0070716_1001312382 | 150 |
| 181 | 3300006175 | Ga0070712_100009604 | Ga0070712_1000096042 | 150 |
| 182 | 3300006175 | Ga0070712_100107264 | Ga0070712_1001072642 | 150 |
| 183 | 3300006177 | Ga0075362_10018592 | Ga0075362_100185924 | 150 |
| 184 | 3300006177 | Ga0075362_10132460 | Ga0075362_101324602 | 150 |
| 185 | 3300006178 | Ga0075367_10248972 | Ga0075367_102489721 | 150 |
| 186 | 3300006178 | Ga0075367_10271422 | Ga0075367_102714221 | 150 |
| 187 | 3300006178 | Ga0075367_10524505 | Ga0075367_105245051 | 150 |
| 188 | 3300006186 | Ga0075369_10058702 | Ga0075369_100587022 | 150 |
| 189 | 3300006194 | Ga0075427_10109129 | Ga0075427_101091291 | 150 |
| 190 | 3300006195 | Ga0075366_10503492 | Ga0075366_105034922 | 150 |
| 191 | 3300006237 | Ga0097621_100040897 | Ga0097621_1000408972 | 150 |
| 192 | 3300006237 | Ga0097621_100640210 | Ga0097621_1006402102 | 150 |
| 193 | 3300006237 | Ga0097621_101063444 | Ga0097621_1010634442 | 150 |
| 194 | 3300006358 | Ga0068871_100456919 | Ga0068871_1004569191 | 150 |
| 195 | 3300006358 | Ga0068871_100697771 | Ga0068871_1006977712 | 150 |
| 196 | 3300006844 | Ga0075428_100024058 | Ga0075428_1000240583 | 150 |
| 197 | 3300006844 | Ga0075428_100125159 | Ga0075428_1001251592 | 150 |
| 198 | 3300006844 | Ga0075428_100214072 | Ga0075428_1002140724 | 150 |
| 199 | 3300006844 | Ga0075428_100216748 | Ga0075428_1002167482 | 150 |
| 200 | 3300006844 | Ga0075428_100338704 | Ga0075428_1003387042 | 150 |
| 201 | 3300006844 | Ga0075428_100512275 | Ga0075428_1005122752 | 150 |
| 202 | 3300006846 | Ga0075430_100000293 | Ga0075430_1000002932 | 150 |
| 203 | 3300006846 | Ga0075430_100001577 | Ga0075430_1000015775 | 150 |
| 204 | 3300006846 | Ga0075430_100459574 | Ga0075430_1004595742 | 150 |
| 205 | 3300006846 | Ga0075430_100464074 | Ga0075430_1004640742 | 150 |
| 206 | 3300006847 | Ga0075431_100030912 | Ga0075431_1000309123 | 150 |
| 207 | 3300006847 | Ga0075431_100032198 | Ga0075431_1000321985 | 150 |
| 208 | 3300006847 | Ga0075431_100111833 | Ga0075431_1001118332 | 150 |
| 209 | 3300006847 | Ga0075431_100225009 | Ga0075431_1002250092 | 150 |
| 210 | 3300006871 | Ga0075434_100095598 | Ga0075434_1000955982 | 150 |
| 211 | 3300006871 | Ga0075434_100136338 | Ga0075434_1001363382 | 150 |
| 212 | 3300006871 | Ga0075434_100366761 | Ga0075434_1003667612 | 150 |
| 213 | 3300006880 | Ga0075429_100281422 | Ga0075429_1002814222 | 150 |
| 214 | 3300006880 | Ga0075429_100966682 | Ga0075429_1009666822 | 150 |
| 215 | 3300006880 | Ga0075429_100969516 | Ga0075429_1009695161 | 150 |
| 216 | 3300006881 | Ga0068865_100097342 | Ga0068865_1000973422 | 150 |
| 217 | 3300006881 | Ga0068865_100340588 | Ga0068865_1003405882 | 150 |
| 218 | 3300006914 | Ga0075436_100209768 | Ga0075436_1002097682 | 150 |
| 219 | 3300006931 | Ga0097620_100126237 | Ga0097620_1001262372 | 150 |
| 220 | 3300006931 | Ga0097620_101112925 | Ga0097620_1011129252 | 150 |
| 221 | 3300007076 | Ga0075435_100208583 | Ga0075435_1002085832 | 150 |
| 222 | 3300007076 | Ga0075435_100859192 | Ga0075435_1008591922 | 150 |
| 223 | 3300007265 | Ga0099794_10013326 | Ga0099794_100133263 | 150 |
| 224 | 3300007265 | Ga0099794_10491223 | Ga0099794_104912231 | 150 |
| 225 | 3300009093 | Ga0105240_11516977 | Ga0105240_115169772 | 150 |
| 226 | 3300009094 | Ga0111539_10075711 | Ga0111539_100757113 | 150 |
| 227 | 3300009094 | Ga0111539_10099325 | Ga0111539_100993252 | 150 |
| 228 | 3300009094 | Ga0111539_10264076 | Ga0111539_102640762 | 150 |
| 229 | 3300009094 | Ga0111539_10277312 | Ga0111539_102773122 | 150 |
| 230 | 3300009098 | Ga0105245_10411220 | Ga0105245_104112201 | 150 |
| 231 | 3300009098 | Ga0105245_11409243 | Ga0105245_114092431 | 150 |
| 232 | 3300009101 | Ga0105247_10127779 | Ga0105247_101277792 | 150 |
| 233 | 3300009101 | Ga0105247_10477672 | Ga0105247_104776721 | 150 |
| 234 | 3300009147 | Ga0114129_10005790 | Ga0114129_100057902 | 150 |
| 235 | 3300009147 | Ga0114129_10165790 | Ga0114129_101657903 | 150 |
| 236 | 3300009147 | Ga0114129_10271606 | Ga0114129_102716061 | 150 |
| 237 | 3300009147 | Ga0114129_10585481 | Ga0114129_105854812 | 150 |
| 238 | 3300009147 | Ga0114129_10801205 | Ga0114129_108012052 | 150 |
| 239 | 3300009147 | Ga0114129_10944446 | Ga0114129_109444461 | 150 |
| 240 | 3300009148 | Ga0105243_10159711 | Ga0105243_101597112 | 150 |
| 241 | 3300009148 | Ga0105243_11093442 | Ga0105243_110934422 | 150 |
| 242 | 3300009148 | Ga0105243_11229740 | Ga0105243_112297402 | 150 |
| 243 | 3300009174 | Ga0105241_10766728 | Ga0105241_107667282 | 150 |
| 244 | 3300009176 | Ga0105242_10825329 | Ga0105242_108253291 | 150 |
| 245 | 3300009176 | Ga0105242_10860144 | Ga0105242_108601442 | 150 |
| 246 | 3300009177 | Ga0105248_10446646 | Ga0105248_104466462 | 150 |
| 247 | 3300009553 | Ga0105249_10189793 | Ga0105249_101897932 | 150 |
| 248 | 3300010375 | Ga0105239_10104142 | Ga0105239_101041422 | 150 |
| 249 | 3300011119 | Ga0105246_10101927 | Ga0105246_101019272 | 150 |
| 250 | 3300011119 | Ga0105246_10939827 | Ga0105246_109398271 | 150 |
| 251 | 3300011119 | Ga0105246_12408074 | Ga0105246_124080741 | 150 |
| 252 | 3300013296 | Ga0157374_10349988 | Ga0157374_103499882 | 150 |
| 253 | 3300013297 | Ga0157378_12159801 | Ga0157378_121598011 | 150 |
| 254 | 3300013306 | Ga0163162_10533824 | Ga0163162_105338241 | 150 |
| 255 | 3300013306 | Ga0163162_11593033 | Ga0163162_115930331 | 150 |
| 256 | 3300013306 | Ga0163162_11611157 | Ga0163162_116111572 | 150 |
| 257 | 3300013307 | Ga0157372_10687703 | Ga0157372_106877032 | 150 |
| 258 | 3300013308 | Ga0157375_10100676 | Ga0157375_101006762 | 150 |
| 259 | 3300013308 | Ga0157375_10413424 | Ga0157375_104134242 | 150 |
| 260 | 3300014325 | Ga0163163_10034194 | Ga0163163_100341942 | 150 |
| 261 | 3300014325 | Ga0163163_10346324 | Ga0163163_103463242 | 150 |
| 262 | 3300014325 | Ga0163163_10598338 | Ga0163163_105983382 | 150 |
| 263 | 3300014326 | Ga0157380_10165714 | Ga0157380_101657142 | 150 |
| 264 | 3300014326 | Ga0157380_10761502 | Ga0157380_107615022 | 150 |
| 265 | 3300014745 | Ga0157377_10390185 | Ga0157377_103901851 | 150 |
| 266 | 3300014745 | Ga0157377_10517871 | Ga0157377_105178712 | 150 |
| 267 | 3300014968 | Ga0157379_10125818 | Ga0157379_101258182 | 150 |
| 268 | 3300014969 | Ga0157376_10180521 | Ga0157376_101805212 | 150 |
| 269 | 3300014969 | Ga0157376_10678570 | Ga0157376_106785702 | 150 |
| 270 | 3300017792 | Ga0163161_10034179 | Ga0163161_100341793 | 150 |
| 271 | 3300017792 | Ga0163161_11457772 | Ga0163161_114577722 | 150 |
| 272 | 3300021361 | Ga0213872_10057372 | Ga0213872_100573722 | 150 |
| 273 | 3300021377 | Ga0213874_10334364 | Ga0213874_103343642 | 150 |
| 274 | 3300021441 | Ga0213871_10059506 | Ga0213871_100595062 | 150 |
| 275 | 3300025297 | Ga0209758_1000370 | Ga0209758_100037059 | 150 |
| 276 | 3300025297 | Ga0209758_1021862 | Ga0209758_10218622 | 150 |
| 277 | 3300025302 | Ga0207426_1135232 | Ga0207426_11352321 | 150 |
| 278 | 3300025321 | Ga0207656_10303219 | Ga0207656_103032192 | 150 |
| 279 | 3300025885 | Ga0207653_10075029 | Ga0207653_100750292 | 150 |
| 280 | 3300025898 | Ga0207692_10081064 | Ga0207692_100810642 | 150 |
| 281 | 3300025899 | Ga0207642_10224938 | Ga0207642_102249382 | 150 |
| 282 | 3300025899 | Ga0207642_10405828 | Ga0207642_104058282 | 150 |
| 283 | 3300025900 | Ga0207710_10108772 | Ga0207710_101087721 | 150 |
| 284 | 3300025901 | Ga0207688_10192639 | Ga0207688_101926391 | 150 |
| 285 | 3300025903 | Ga0207680_10263986 | Ga0207680_102639862 | 150 |
| 286 | 3300025903 | Ga0207680_10929128 | Ga0207680_109291282 | 150 |
| 287 | 3300025904 | Ga0207647_10067976 | Ga0207647_100679762 | 150 |
| 288 | 3300025907 | Ga0207645_10030990 | Ga0207645_100309902 | 150 |
| 289 | 3300025907 | Ga0207645_10548686 | Ga0207645_105486862 | 150 |
| 290 | 3300025908 | Ga0207643_10004252 | Ga0207643_100042527 | 150 |
| 291 | 3300025910 | Ga0207684_10063009 | Ga0207684_100630092 | 150 |
| 292 | 3300025911 | Ga0207654_10421065 | Ga0207654_104210652 | 150 |
| 293 | 3300025912 | Ga0207707_10416342 | Ga0207707_104163422 | 150 |
| 294 | 3300025915 | Ga0207693_10015564 | Ga0207693_100155647 | 150 |
| 295 | 3300025915 | Ga0207693_10655752 | Ga0207693_106557521 | 150 |
| 296 | 3300025916 | Ga0207663_10244854 | Ga0207663_102448542 | 150 |
| 297 | 3300025917 | Ga0207660_10026335 | Ga0207660_100263351 | 150 |
| 298 | 3300025917 | Ga0207660_10139252 | Ga0207660_101392522 | 150 |
| 299 | 3300025917 | Ga0207660_10348482 | Ga0207660_103484822 | 150 |
| 300 | 3300025917 | Ga0207660_10530646 | Ga0207660_105306462 | 150 |
| 301 | 3300025917 | Ga0207660_11214690 | Ga0207660_112146901 | 150 |
| 302 | 3300025918 | Ga0207662_10301374 | Ga0207662_103013742 | 150 |
| 303 | 3300025918 | Ga0207662_10442133 | Ga0207662_104421332 | 150 |
| 304 | 3300025920 | Ga0207649_10042503 | Ga0207649_100425032 | 150 |
| 305 | 3300025923 | Ga0207681_10016920 | Ga0207681_100169202 | 150 |
| 306 | 3300025923 | Ga0207681_10131231 | Ga0207681_101312312 | 150 |
| 307 | 3300025923 | Ga0207681_10205136 | Ga0207681_102051362 | 150 |
| 308 | 3300025923 | Ga0207681_10288767 | Ga0207681_102887672 | 150 |
| 309 | 3300025925 | Ga0207650_10004089 | Ga0207650_100040895 | 150 |
| 310 | 3300025925 | Ga0207650_11137188 | Ga0207650_111371881 | 150 |
| 311 | 3300025926 | Ga0207659_10246314 | Ga0207659_102463142 | 150 |
| 312 | 3300025928 | Ga0207700_10015702 | Ga0207700_100157022 | 150 |
| 313 | 3300025928 | Ga0207700_10448018 | Ga0207700_104480182 | 150 |
| 314 | 3300025928 | Ga0207700_11362032 | Ga0207700_113620321 | 150 |
| 315 | 3300025929 | Ga0207664_10469964 | Ga0207664_104699641 | 150 |
| 316 | 3300025929 | Ga0207664_10729006 | Ga0207664_107290062 | 150 |
| 317 | 3300025931 | Ga0207644_10649286 | Ga0207644_106492861 | 150 |
| 318 | 3300025931 | Ga0207644_10677431 | Ga0207644_106774312 | 150 |
| 319 | 3300025932 | Ga0207690_10065767 | Ga0207690_100657672 | 150 |
| 320 | 3300025932 | Ga0207690_10113690 | Ga0207690_101136902 | 150 |
| 321 | 3300025933 | Ga0207706_10008418 | Ga0207706_100084186 | 150 |
| 322 | 3300025935 | Ga0207709_10058670 | Ga0207709_100586701 | 150 |
| 323 | 3300025935 | Ga0207709_11189075 | Ga0207709_111890751 | 150 |
| 324 | 3300025936 | Ga0207670_10005087 | Ga0207670_100050873 | 150 |
| 325 | 3300025936 | Ga0207670_10369305 | Ga0207670_103693051 | 150 |
| 326 | 3300025936 | Ga0207670_10962477 | Ga0207670_109624771 | 150 |
| 327 | 3300025937 | Ga0207669_11104561 | Ga0207669_111045611 | 150 |
| 328 | 3300025938 | Ga0207704_11695228 | Ga0207704_116952281 | 150 |
| 329 | 3300025940 | Ga0207691_10139600 | Ga0207691_101396002 | 150 |
| 330 | 3300025940 | Ga0207691_10234506 | Ga0207691_102345062 | 150 |
| 331 | 3300025940 | Ga0207691_10432903 | Ga0207691_104329032 | 150 |
| 332 | 3300025941 | Ga0207711_10696294 | Ga0207711_106962942 | 150 |
| 333 | 3300025942 | Ga0207689_10167720 | Ga0207689_101677202 | 150 |
| 334 | 3300025944 | Ga0207661_10858151 | Ga0207661_108581512 | 150 |
| 335 | 3300025944 | Ga0207661_11195013 | Ga0207661_111950132 | 150 |
| 336 | 3300025945 | Ga0207679_11679444 | Ga0207679_116794441 | 150 |
| 337 | 3300025960 | Ga0207651_10326479 | Ga0207651_103264792 | 150 |
| 338 | 3300025961 | Ga0207712_10050584 | Ga0207712_100505842 | 150 |
| 339 | 3300025972 | Ga0207668_10043771 | Ga0207668_100437711 | 150 |
| 340 | 3300025972 | Ga0207668_11146463 | Ga0207668_111464632 | 150 |
| 341 | 3300025981 | Ga0207640_10154994 | Ga0207640_101549942 | 150 |
| 342 | 3300025986 | Ga0207658_10480841 | Ga0207658_104808412 | 150 |
| 343 | 3300026023 | Ga0207677_10229030 | Ga0207677_102290302 | 150 |
| 344 | 3300026035 | Ga0207703_10155221 | Ga0207703_101552212 | 150 |
| 345 | 3300026067 | Ga0207678_10047151 | Ga0207678_100471512 | 150 |
| 346 | 3300026067 | Ga0207678_10798983 | Ga0207678_107989831 | 150 |
| 347 | 3300026075 | Ga0207708_10020685 | Ga0207708_100206853 | 150 |
| 348 | 3300026078 | Ga0207702_10074357 | Ga0207702_100743572 | 150 |
| 349 | 3300026088 | Ga0207641_10246736 | Ga0207641_102467361 | 150 |
| 350 | 3300026088 | Ga0207641_10354494 | Ga0207641_103544942 | 150 |
| 351 | 3300026089 | Ga0207648_10012041 | Ga0207648_100120412 | 150 |
| 352 | 3300026089 | Ga0207648_10125539 | Ga0207648_101255392 | 150 |
| 353 | 3300026095 | Ga0207676_10015096 | Ga0207676_100150965 | 150 |
| 354 | 3300026095 | Ga0207676_10251147 | Ga0207676_102511472 | 150 |
| 355 | 3300026095 | Ga0207676_10368089 | Ga0207676_103680891 | 150 |
| 356 | 3300026116 | Ga0207674_11226746 | Ga0207674_112267462 | 150 |
| 357 | 3300026118 | Ga0207675_100202117 | Ga0207675_1002021172 | 150 |
| 358 | 3300026118 | Ga0207675_100361829 | Ga0207675_1003618291 | 150 |
| 359 | 3300026118 | Ga0207675_101681935 | Ga0207675_1016819352 | 150 |
| 360 | 3300026121 | Ga0207683_10143288 | Ga0207683_101432882 | 150 |
| 361 | 3300026121 | Ga0207683_10506832 | Ga0207683_105068322 | 150 |
| 362 | 3300026121 | Ga0207683_10530107 | Ga0207683_105301072 | 150 |
| 363 | 3300026121 | Ga0207683_10621976 | Ga0207683_106219762 | 150 |
| 364 | 3300026142 | Ga0207698_10317658 | Ga0207698_103176582 | 150 |
| 365 | 3300026142 | Ga0207698_10918862 | Ga0207698_109188621 | 150 |
| 366 | 3300027671 | Ga0209588_1094306 | Ga0209588_10943062 | 150 |
| 367 | 3300027907 | Ga0207428_10276158 | Ga0207428_102761582 | 150 |
| 368 | 3300028379 | Ga0268266_10575283 | Ga0268266_105752831 | 150 |
| 369 | 3300028380 | Ga0268265_10788184 | Ga0268265_107881841 | 150 |
| 370 | 3300028381 | Ga0268264_10068542 | Ga0268264_100685421 | 150 |
| 371 | 3300028381 | Ga0268264_11012215 | Ga0268264_110122151 | 150 |
| 372 | 3300028381 | Ga0268264_11982755 | Ga0268264_119827552 | 150 |
| 373 | 3300031250 | Ga0265331_10298426 | Ga0265331_102984261 | 150 |
| 374 | 3300031548 | Ga0307408_100092380 | Ga0307408_1000923802 | 150 |
| 375 | 3300031548 | Ga0307408_100996584 | Ga0307408_1009965842 | 150 |
| 376 | 3300031730 | Ga0307516_10027228 | Ga0307516_100272288 | 150 |
| 377 | 3300031731 | Ga0307405_10899979 | Ga0307405_108999792 | 150 |
| 378 | 3300031903 | Ga0307407_10041341 | Ga0307407_100413412 | 150 |
| 379 | 3300031911 | Ga0307412_11073290 | Ga0307412_110732902 | 150 |
| 380 | 3300031995 | Ga0307409_102705708 | Ga0307409_1027057081 | 150 |
| 381 | 3300034818 | Ga0373950_0092010 | Ga0373950_0092010_136_588 | 150 |
| 382 | 3300035084 | Ga0373928_0048318 | Ga0373928_0048318_422_874 | 150 |
| 383 | 3300035085 | Ga0373929_0029125 | Ga0373929_0029125_171_629 | 150 |
| 384 | 3300035086 | Ga0373934_0358659 | Ga0373934_0358659_126_578 | 150 |
| 385 | 3300035090 | Ga0373949_0178991 | Ga0373949_0178991_10_462 | 150 |
| 386 | 3300035092 | Ga0373952_0009255 | Ga0373952_0009255_78_530 | 150 |
| 387 | 3300035092 | Ga0373952_0076640 | Ga0373952_0076640_361_813 | 150 |
| 388 | 3300035111 | Ga0373923_0153370 | Ga0373923_0153370_55_507 | 150 |
| 389 | 3300035111 | Ga0373923_0333078 | Ga0373923_0333078_216_668 | 150 |
| 390 | 3300035112 | Ga0373932_0309722 | Ga0373932_0309722_106_558 | 150 |
| 391 | 3300035113 | Ga0373936_0031825 | Ga0373936_0031825_1584_2036 | 150 |
| 392 | 3300035114 | Ga0373939_0094841 | Ga0373939_0094841_189_641 | 150 |
| 393 | 3300035114 | Ga0373939_0228663 | Ga0373939_0228663_73_525 | 150 |
| 394 | 3300035115 | Ga0373941_0008268 | Ga0373941_0008268_704_1156 | 150 |
| 395 | 3300035116 | Ga0373945_0162314 | Ga0373945_0162314_447_899 | 150 |
| 396 | 3300035118 | Ga0373954_0225950 | Ga0373954_0225950_278_730 | 150 |
| 397 | 3300035170 | Ga0373943_0021213 | Ga0373943_0021213_498_950 | 150 |
| 398 | 3300035170 | Ga0373943_0231926 | Ga0373943_0231926_213_665 | 150 |
| 399 | 3300035171 | Ga0373946_0060480 | Ga0373946_0060480_127_579 | 150 |
| 400 | 3300035171 | Ga0373946_0098745 | Ga0373946_0098745_229_681 | 150 |
| 401 | 3300035172 | Ga0373955_0012761 | Ga0373955_0012761_1191_1643 | 150 |
| 402 | 3300035241 | Ga0373961_0037215 | Ga0373961_0037215_531_983 | 150 |
| 403 | 3300035242 | Ga0373962_0027944 | Ga0373962_0027944_621_1073 | 150 |
| 404 | 3300035410 | Ga0373924_0060495 | Ga0373924_0060495_273_725 | 150 |
| 405 | 3300035691 | Ga0373931_0003755 | Ga0373931_0003755_5114_5566 | 150 |
| 406 | 3300035691 | Ga0373931_0023964 | Ga0373931_0023964_141_593 | 150 |
| 407 | 3300035691 | Ga0373931_0207963 | Ga0373931_0207963_45_497 | 150 |
| 408 | 3300035691 | Ga0373931_0276994 | Ga0373931_0276994_178_630 | 150 |
| 409 | 3300035692 | Ga0373935_0066766 | Ga0373935_0066766_1035_1487 | 150 |
| 410 | 3300035692 | Ga0373935_0295121 | Ga0373935_0295121_137_589 | 150 |
| 411 | 3300035724 | Ga0373933_0018331 | Ga0373933_0018331_788_1240 | 150 |
| 412 | 3300036401 | Ga0373937_0132716 | Ga0373937_0132716_912_1364 | 150 |
| 413 | 3300036401 | Ga0373937_1048204 | Ga0373937_1048204_16_468 | 150 |
| 414 | 3300037068 | Ga0373925_0006466 | Ga0373925_0006466_454_906 | 150 |
| 415 | 3300037068 | Ga0373925_0413370 | Ga0373925_0413370_501_953 | 150 |
| 416 | 3300037471 | Ga0395905_1178099 | Ga0395905_1178099_51_503 | 150 |
| 417 | 3300037853 | Ga0436364_0128244 | Ga0436364_0128244_168_620 | 150 |
| 418 | 3300038443 | Ga0395901_0113223 | Ga0395901_0113223_2271_2723 | 150 |
| 419 | 3300038443 | Ga0395901_1621186 | Ga0395901_1621186_36_488 | 150 |
| 420 | 3300039437 | Ga0436365_0033990 | Ga0436365_0033990_529_981 | 150 |
| 421 | 3300039437 | Ga0436365_1869046 | Ga0436365_1869046_213_665 | 150 |
| 422 | 3300039438 | Ga0436360_0413036 | Ga0436360_0413036_387_839 | 150 |
| 423 | 3300039447 | Ga0436361_0926373 | Ga0436361_0926373_16766_17218 | 150 |
| 424 | 3300039450 | Ga0436363_1633486 | Ga0436363_1633486_12_464 | 150 |
| 425 | 3300041498 | Ga0451841_0788803 | Ga0451841_0788803_13_465 | 150 |
| 426 | 3300041512 | Ga0451853_2634307 | Ga0451853_2634307_330_782 | 150 |
| 427 | 3300042001 | Ga0439441_031703 | Ga0439441_031703_112_564 | 150 |
| 428 | 3300042003 | Ga0439443_010084 | Ga0439443_010084_93_545 | 150 |
| 429 | 3300042436 | Ga0439435_0002379 | Ga0439435_0002379_1807_2259 | 150 |
| 430 | 3300042461 | Ga0439460_0180197 | Ga0439460_0180197_67_519 | 150 |
| 431 | 3300042532 | Ga0450893_0085525 | Ga0450893_0085525_99_551 | 150 |
| 432 | 3300044735 | Ga0466968_0276667 | Ga0466968_0276667_73_525 | 150 |
| 433 | 3300045051 | Ga0451576_0241493 | Ga0451576_0241493_923_1393 | 150 |
| 434 | 3300045051 | Ga0451576_0358305 | Ga0451576_0358305_11_463 | 150 |
| 435 | 3300046455 | Ga0495603_0008846 | Ga0495603_0008846_1108_1560 | 150 |
| 436 | 3300046459 | Ga0495629_0333837 | Ga0495629_0333837_529_981 | 150 |
| 437 | 3300046459 | Ga0495629_0499191 | Ga0495629_0499191_359_811 | 150 |
| 438 | 3300046460 | Ga0495638_0027928 | Ga0495638_0027928_2158_2610 | 150 |
| 439 | 3300046461 | Ga0495641_0028669 | Ga0495641_0028669_1208_1660 | 150 |
| 440 | 3300046461 | Ga0495641_0102638 | Ga0495641_0102638_250_702 | 150 |
| 441 | 3300046472 | Ga0495580_0758573 | Ga0495580_0758573_157_609 | 150 |
| 442 | 3300046473 | Ga0495582_0111548 | Ga0495582_0111548_195_647 | 150 |
| 443 | 3300046474 | Ga0495605_0155459 | Ga0495605_0155459_449_901 | 150 |
| 444 | 3300046476 | Ga0495662_0060797 | Ga0495662_0060797_165_617 | 150 |
| 445 | 3300046491 | Ga0495584_0010255 | Ga0495584_0010255_2364_2816 | 150 |
| 446 | 3300046491 | Ga0495584_0040689 | Ga0495584_0040689_776_1228 | 150 |
| 447 | 3300046491 | Ga0495584_0127559 | Ga0495584_0127559_615_1067 | 150 |
| 448 | 3300046491 | Ga0495584_0131112 | Ga0495584_0131112_147_599 | 150 |
| 449 | 3300046501 | Ga0495607_0069443 | Ga0495607_0069443_1044_1496 | 150 |
| 450 | 3300046513 | Ga0495616_0345026 | Ga0495616_0345026_46_498 | 150 |
| 451 | 3300046514 | Ga0495618_0303500 | Ga0495618_0303500_511_963 | 150 |
| 452 | 3300046516 | Ga0495628_0767550 | Ga0495628_0767550_213_665 | 150 |
| 453 | 3300046517 | Ga0495630_0112151 | Ga0495630_0112151_719_1171 | 150 |
| 454 | 3300046517 | Ga0495630_0307592 | Ga0495630_0307592_50_502 | 150 |
| 455 | 3300046520 | Ga0495637_0033329 | Ga0495637_0033329_987_1439 | 150 |
| 456 | 3300046523 | Ga0495644_0043518 | Ga0495644_0043518_468_920 | 150 |
| 457 | 3300046525 | Ga0495663_0009521 | Ga0495663_0009521_1847_2299 | 150 |
| 458 | 3300046525 | Ga0495663_0166721 | Ga0495663_0166721_44_499 | 150 |
| 459 | 3300046526 | Ga0495666_0070184 | Ga0495666_0070184_150_602 | 150 |
| 460 | 3300046526 | Ga0495666_0237281 | Ga0495666_0237281_95_547 | 150 |
| 461 | 3300046528 | Ga0495642_0242218 | Ga0495642_0242218_30_485 | 150 |
| 462 | 3300046533 | Ga0495640_0089125 | Ga0495640_0089125_1558_2010 | 150 |
| 463 | 3300046537 | Ga0495598_0001377 | Ga0495598_0001377_1472_1924 | 150 |
| 464 | 3300046537 | Ga0495598_0040263 | Ga0495598_0040263_185_637 | 150 |
| 465 | 3300046538 | Ga0495609_0229053 | Ga0495609_0229053_297_752 | 150 |
| 466 | 3300046539 | Ga0495621_0286306 | Ga0495621_0286306_84_539 | 150 |
| 467 | 3300046543 | Ga0495645_0298700 | Ga0495645_0298700_532_1020 | 150 |
| 468 | 3300046557 | Ga0495622_0014213 | Ga0495622_0014213_1177_1629 | 150 |
| 469 | 3300046558 | Ga0495633_0247919 | Ga0495633_0247919_198_650 | 150 |
| 470 | 3300046615 | Ga0495656_0026187 | Ga0495656_0026187_209_661 | 150 |
| 471 | 3300046616 | Ga0495668_0329714 | Ga0495668_0329714_296_748 | 150 |
| 472 | 3300046642 | Ga0495634_0546705 | Ga0495634_0546705_86_538 | 150 |
| 473 | 3300046648 | Ga0495611_0240218 | Ga0495611_0240218_218_670 | 150 |
| 474 | 3300046664 | Ga0495659_0029541 | Ga0495659_0029541_1399_1851 | 150 |
| 475 | 3300046664 | Ga0495659_0102636 | Ga0495659_0102636_334_789 | 150 |
| 476 | 3300046664 | Ga0495659_0179833 | Ga0495659_0179833_149_601 | 150 |
| 477 | 3300046664 | Ga0495659_0246137 | Ga0495659_0246137_263_715 | 150 |
| 478 | 3300046665 | Ga0495661_0068016 | Ga0495661_0068016_1508_1960 | 150 |
| 479 | 3300046674 | Ga0495588_0018784 | Ga0495588_0018784_1237_1689 | 150 |
| 480 | 3300046680 | Ga0495646_0070063 | Ga0495646_0070063_33_485 | 150 |
| 481 | 3300046681 | Ga0495647_0377641 | Ga0495647_0377641_172_624 | 150 |
| 482 | 3300046683 | Ga0495658_0047906 | Ga0495658_0047906_1852_2304 | 150 |
| 483 | 3300046683 | Ga0495658_0093185 | Ga0495658_0093185_527_979 | 150 |
| 484 | 3300046689 | Ga0495613_0118543 | Ga0495613_0118543_640_1092 | 150 |
| 485 | 3300046689 | Ga0495613_0135075 | Ga0495613_0135075_688_1140 | 150 |
| 486 | 3300046690 | Ga0495624_0031919 | Ga0495624_0031919_2949_3401 | 150 |
| 487 | 3300046691 | Ga0495670_0035330 | Ga0495670_0035330_1341_1793 | 150 |
| 488 | 3300046692 | Ga0495671_0042607 | Ga0495671_0042607_1288_1740 | 150 |
| 489 | 3300046694 | Ga0495649_0079569 | Ga0495649_0079569_368_820 | 150 |
| 490 | 3300047315 | Ga0495581_0107934 | Ga0495581_0107934_328_780 | 150 |
| 491 | 3300047315 | Ga0495581_0362557 | Ga0495581_0362557_65_517 | 150 |
| 492 | 3300047317 | Ga0495604_0242813 | Ga0495604_0242813_385_837 | 150 |
| 493 | 3300047319 | Ga0495674_0198305 | Ga0495674_0198305_186_638 | 150 |
| 494 | 3300047319 | Ga0495674_0215273 | Ga0495674_0215273_855_1307 | 150 |
| 495 | 3300047319 | Ga0495674_0445243 | Ga0495674_0445243_436_888 | 150 |
| 496 | 3300047321 | Ga0495676_0077096 | Ga0495676_0077096_1768_2220 | 150 |
| 497 | 3300047321 | Ga0495676_0138827 | Ga0495676_0138827_691_1143 | 150 |
| 498 | 3300047322 | Ga0495680_0162340 | Ga0495680_0162340_1005_1457 | 150 |
| 499 | 3300047322 | Ga0495680_0253760 | Ga0495680_0253760_167_619 | 150 |
| 500 | 3300047322 | Ga0495680_0560824 | Ga0495680_0560824_39_491 | 150 |
| 501 | 3300047323 | Ga0495683_0082792 | Ga0495683_0082792_1048_1500 | 150 |
| 502 | 3300047445 | Ga0495677_0336906 | Ga0495677_0336906_123_578 | 150 |
| 503 | 3300047673 | Ga0495593_0179193 | Ga0495593_0179193_289_741 | 150 |
| 504 | 3300048091 | Ga0495626_0147336 | Ga0495626_0147336_256_708 | 150 |
| 505 | 3300048903 | Ga0496100_0085059 | Ga0496100_0085059_537_989 | 150 |
| 506 | 3300048903 | Ga0496100_0108408 | Ga0496100_0108408_189_641 | 150 |
| 507 | 3300048904 | Ga0496101_0005989 | Ga0496101_0005989_1829_2281 | 150 |
| 508 | 3300048905 | Ga0496102_0004367 | Ga0496102_0004367_669_1121 | 150 |
| 509 | 3300048905 | Ga0496102_0522547 | Ga0496102_0522547_357_809 | 150 |
| 510 | 3300048905 | Ga0496102_0528153 | Ga0496102_0528153_537_989 | 150 |
| 511 | 3300048905 | Ga0496102_1599717 | Ga0496102_1599717_105_557 | 150 |
| 512 | 3300048906 | Ga0496103_0038315 | Ga0496103_0038315_1391_1843 | 150 |
| 513 | 3300048906 | Ga0496103_0138543 | Ga0496103_0138543_317_769 | 150 |
| 514 | 3300048907 | Ga0496104_0001514 | Ga0496104_0001514_17316_17768 | 150 |
| 515 | 3300048907 | Ga0496104_0002405 | Ga0496104_0002405_10212_10664 | 150 |
| 516 | 3300048907 | Ga0496104_0010373 | Ga0496104_0010373_1433_1885 | 150 |
| 517 | 3300048907 | Ga0496104_0152132 | Ga0496104_0152132_1232_1684 | 150 |
| 518 | 3300048908 | Ga0496105_0001433 | Ga0496105_0001433_14078_14530 | 150 |
| 519 | 3300048908 | Ga0496105_0015510 | Ga0496105_0015510_1242_1694 | 150 |
| 520 | 3300048908 | Ga0496105_0043404 | Ga0496105_0043404_2419_2871 | 150 |
| 521 | 3300048909 | Ga0496106_0002564 | Ga0496106_0002564_12337_12789 | 150 |
| 522 | 3300048909 | Ga0496106_0090643 | Ga0496106_0090643_416_868 | 150 |
| 523 | 3300048909 | Ga0496106_0216906 | Ga0496106_0216906_310_762 | 150 |
| 524 | 3300048910 | Ga0496107_0037178 | Ga0496107_0037178_2984_3436 | 150 |
| 525 | 3300048910 | Ga0496107_0355690 | Ga0496107_0355690_184_636 | 150 |
| 526 | 3300048911 | Ga0496108_0001000 | Ga0496108_0001000_9995_10447 | 150 |
| 527 | 3300048911 | Ga0496108_0157204 | Ga0496108_0157204_276_728 | 150 |
| 528 | 3300048911 | Ga0496108_0406611 | Ga0496108_0406611_372_824 | 150 |
| 529 | 3300048912 | Ga0496109_0000796 | Ga0496109_0000796_5347_5799 | 150 |
| 530 | 3300048912 | Ga0496109_0048468 | Ga0496109_0048468_537_989 | 150 |
| 531 | 3300048912 | Ga0496109_0195787 | Ga0496109_0195787_122_574 | 150 |
| 532 | 3300048912 | Ga0496109_0290946 | Ga0496109_0290946_453_905 | 150 |
| 533 | 3300048913 | Ga0496110_0015804 | Ga0496110_0015804_1021_1473 | 150 |
| 534 | 3300048913 | Ga0496110_0049074 | Ga0496110_0049074_2863_3315 | 150 |
| 535 | 3300048913 | Ga0496110_0117127 | Ga0496110_0117127_1311_1763 | 150 |
| 536 | 3300048913 | Ga0496110_0537023 | Ga0496110_0537023_208_660 | 150 |
| 537 | 3300048914 | Ga0496111_0020981 | Ga0496111_0020981_813_1265 | 150 |
| 538 | 3300048914 | Ga0496111_0073078 | Ga0496111_0073078_1715_2167 | 150 |
| 539 | 3300048914 | Ga0496111_0416203 | Ga0496111_0416203_365_817 | 150 |
| 540 | 3300048915 | Ga0496112_0000476 | Ga0496112_0000476_19517_19969 | 150 |
| 541 | 3300048915 | Ga0496112_0168369 | Ga0496112_0168369_817_1269 | 150 |
| 542 | 3300048915 | Ga0496112_0214512 | Ga0496112_0214512_331_783 | 150 |
| 543 | 3300048915 | Ga0496112_1055184 | Ga0496112_1055184_110_562 | 150 |
| 544 | 3300048916 | Ga0496113_0000247 | Ga0496113_0000247_501_953 | 150 |
| 545 | 3300048917 | Ga0496114_0420670 | Ga0496114_0420670_530_982 | 150 |
| 546 | 3300048917 | Ga0496114_0768348 | Ga0496114_0768348_327_779 | 150 |
| 547 | 3300048918 | Ga0496115_0055008 | Ga0496115_0055008_2208_2660 | 150 |
| 548 | 3300048918 | Ga0496115_0055800 | Ga0496115_0055800_1751_2203 | 150 |
| 549 | 3300048918 | Ga0496115_0224842 | Ga0496115_0224842_115_567 | 150 |
| 550 | 3300048918 | Ga0496115_0362683 | Ga0496115_0362683_674_1126 | 150 |
| 551 | 3300049569 | Ga0501032_0351777 | Ga0501032_0351777_382_834 | 150 |
| 552 | 3300049569 | Ga0501032_0784214 | Ga0501032_0784214_125_577 | 150 |
| 553 | 3300049570 | Ga0501033_0137745 | Ga0501033_0137745_835_1287 | 150 |
| 554 | 3300049572 | Ga0501036_0044637 | Ga0501036_0044637_1366_1818 | 150 |
| 555 | 3300049572 | Ga0501036_0211976 | Ga0501036_0211976_1081_1533 | 150 |
| 556 | 3300049572 | Ga0501036_0328666 | Ga0501036_0328666_321_773 | 150 |
| 557 | 3300049573 | Ga0501037_0066756 | Ga0501037_0066756_1469_1921 | 150 |
| 558 | 3300049573 | Ga0501037_0496916 | Ga0501037_0496916_226_678 | 150 |
| 559 | 3300049574 | Ga0501038_0185165 | Ga0501038_0185165_575_1027 | 150 |
| 560 | 3300049575 | Ga0501039_0038492 | Ga0501039_0038492_3160_3612 | 150 |
| 561 | 3300049575 | Ga0501039_0040879 | Ga0501039_0040879_1081_1533 | 150 |
| 562 | 3300049576 | Ga0501040_0005009 | Ga0501040_0005009_3642_4094 | 150 |
| 563 | 3300049576 | Ga0501040_0012423 | Ga0501040_0012423_3926_4378 | 150 |
| 564 | 3300049576 | Ga0501040_0016503 | Ga0501040_0016503_3392_3844 | 150 |
| 565 | 3300049576 | Ga0501040_0088923 | Ga0501040_0088923_1081_1533 | 150 |
| 566 | 3300049577 | Ga0501041_0005100 | Ga0501041_0005100_2061_2513 | 150 |
| 567 | 3300049577 | Ga0501041_0006778 | Ga0501041_0006778_5827_6279 | 150 |
| 568 | 3300049577 | Ga0501041_0010247 | Ga0501041_0010247_1532_1984 | 150 |
| 569 | 3300049579 | Ga0501043_0021134 | Ga0501043_0021134_1125_1577 | 150 |
| 570 | 3300049579 | Ga0501043_0074910 | Ga0501043_0074910_534_986 | 150 |
| 571 | 3300049580 | Ga0501046_0050564 | Ga0501046_0050564_2415_2867 | 150 |
| 572 | 3300049580 | Ga0501046_0766500 | Ga0501046_0766500_25_477 | 150 |
| 573 | 3300049582 | Ga0501048_0048310 | Ga0501048_0048310_2445_2897 | 150 |
| 574 | 3300049582 | Ga0501048_0179561 | Ga0501048_0179561_798_1250 | 150 |
| 575 | 3300049584 | Ga0501068_0037492 | Ga0501068_0037492_1816_2268 | 150 |
| 576 | 3300049584 | Ga0501068_0372509 | Ga0501068_0372509_107_559 | 150 |
| 577 | 3300049587 | Ga0501071_0033677 | Ga0501071_0033677_487_939 | 150 |
| 578 | 3300049587 | Ga0501071_0692836 | Ga0501071_0692836_69_521 | 150 |
| 579 | 3300049588 | Ga0501072_0006855 | Ga0501072_0006855_4272_4724 | 150 |
| 580 | 3300049588 | Ga0501072_0023786 | Ga0501072_0023786_2789_3241 | 150 |
| 581 | 3300049589 | Ga0501073_0439585 | Ga0501073_0439585_353_805 | 150 |
| 582 | 3300049590 | Ga0501074_0125825 | Ga0501074_0125825_453_905 | 150 |
| 583 | 3300049590 | Ga0501074_0930862 | Ga0501074_0930862_149_601 | 150 |
| 584 | 3300049591 | Ga0501075_0003655 | Ga0501075_0003655_2086_2538 | 150 |
| 585 | 3300049591 | Ga0501075_0082723 | Ga0501075_0082723_146_598 | 150 |
| 586 | 3300049592 | Ga0501076_0000778 | Ga0501076_0000778_19030_19482 | 150 |
| 587 | 3300049592 | Ga0501076_0003675 | Ga0501076_0003675_3509_3961 | 150 |
| 588 | 3300049592 | Ga0501076_0613385 | Ga0501076_0613385_257_709 | 150 |
| 589 | 3300049593 | Ga0501077_0044313 | Ga0501077_0044313_1117_1569 | 150 |
| 590 | 3300049593 | Ga0501077_0210342 | Ga0501077_0210342_218_670 | 150 |
| 591 | 3300049667 | Ga0501230_098241 | Ga0501230_098241_76_528 | 150 |
| 592 | 3300049741 | Ga0501079_0017301 | Ga0501079_0017301_4681_5133 | 150 |
| 593 | 3300049741 | Ga0501079_0021835 | Ga0501079_0021835_3170_3622 | 150 |
| 594 | 3300049741 | Ga0501079_0172570 | Ga0501079_0172570_931_1383 | 150 |
| 595 | 3300049741 | Ga0501079_0738854 | Ga0501079_0738854_307_759 | 150 |
| 596 | 3300049742 | Ga0501080_0016458 | Ga0501080_0016458_4016_4468 | 150 |
| 597 | 3300049742 | Ga0501080_0017334 | Ga0501080_0017334_1282_1734 | 150 |
| 598 | 3300049743 | Ga0501081_0000811 | Ga0501081_0000811_7497_7949 | 150 |
| 599 | 3300049743 | Ga0501081_0004676 | Ga0501081_0004676_3575_4027 | 150 |
| 600 | 3300049822 | Ga0501035_0112949 | Ga0501035_0112949_128_580 | 150 |
| 601 | 3300049822 | Ga0501035_0159828 | Ga0501035_0159828_725_1177 | 150 |
| 602 | 3300049823 | Ga0501044_0247039 | Ga0501044_0247039_1222_1674 | 150 |
| 603 | 3300049824 | Ga0501045_0009308 | Ga0501045_0009308_3937_4389 | 150 |
| 604 | 3300049824 | Ga0501045_0052146 | Ga0501045_0052146_2467_2919 | 150 |
| 605 | 3300050489 | nmdc:mga03683_36794_c2 | nmdc:mga03683_36794_c2_415_909 | 150 |
| 606 | 3300050490 | nmdc:mga03n38_403923_c1 | nmdc:mga03n38_403923_c1_52_504 | 150 |
| 607 | 3300050491 | nmdc:mga00v17_15271_c1 | nmdc:mga00v17_15271_c1_307_801 | 150 |
| 608 | 3300050491 | nmdc:mga00v17_461305_c1 | nmdc:mga00v17_461305_c1_197_649 | 150 |
| 609 | 3300050492 | nmdc:mga0yw44_157579_c1 | nmdc:mga0yw44_157579_c1_571_1023 | 150 |
| 610 | 3300050492 | nmdc:mga0yw44_279395_c1 | nmdc:mga0yw44_279395_c1_224_676 | 150 |
| 611 | 3300050492 | nmdc:mga0yw44_300524_c1 | nmdc:mga0yw44_300524_c1_399_851 | 150 |
| 612 | 3300050493 | nmdc:mga0k408_29654_c1 | nmdc:mga0k408_29654_c1_241_693 | 150 |
| 613 | 3300050494 | nmdc:mga06z11_133389_c1 | nmdc:mga06z11_133389_c1_286_738 | 150 |
| 614 | 3300050494 | nmdc:mga06z11_272613_c1 | nmdc:mga06z11_272613_c1_76_528 | 150 |
| 615 | 3300050495 | nmdc:mga04h51_5555_c1 | nmdc:mga04h51_5555_c1_2548_3000 | 150 |
| 616 | 3300050496 | nmdc:mga07m45_136346_c1 | nmdc:mga07m45_136346_c1_36_488 | 150 |
| 617 | 3300050507 | nmdc:mga05p37_1522919_c1 | nmdc:mga05p37_1522919_c1_115_609 | 150 |
| 618 | 3300050507 | nmdc:mga05p37_162879_c1 | nmdc:mga05p37_162879_c1_1065_1517 | 150 |
| 619 | 3300050507 | nmdc:mga05p37_35564_c1 | nmdc:mga05p37_35564_c1_1455_1907 | 150 |
| 620 | 3300050507 | nmdc:mga05p37_413812_c1 | nmdc:mga05p37_413812_c1_876_1328 | 150 |
| 621 | 3300050507 | nmdc:mga05p37_483507_c1 | nmdc:mga05p37_483507_c1_858_1310 | 150 |
| 622 | 3300050507 | nmdc:mga05p37_597536_c1 | nmdc:mga05p37_597536_c1_490_945 | 150 |
| 623 | 3300050507 | nmdc:mga05p37_65954_c1 | nmdc:mga05p37_65954_c1_1931_2383 | 150 |
| 624 | 3300050508 | nmdc:mga09592_219051_c1 | nmdc:mga09592_219051_c1_730_1182 | 150 |
| 625 | 3300050508 | nmdc:mga09592_759720_c1 | nmdc:mga09592_759720_c1_346_798 | 150 |
| 626 | 3300050509 | nmdc:mga0qj67_119206_c1 | nmdc:mga0qj67_119206_c1_1435_1929 | 150 |
| 627 | 3300050509 | nmdc:mga0qj67_14086_c1 | nmdc:mga0qj67_14086_c1_2104_2556 | 150 |
| 628 | 3300050509 | nmdc:mga0qj67_233204_c1 | nmdc:mga0qj67_233204_c1_1007_1459 | 150 |
| 629 | 3300050509 | nmdc:mga0qj67_37_c1 | nmdc:mga0qj67_37_c1_90346_90798 | 150 |
| 630 | 3300050509 | nmdc:mga0qj67_433206_c1 | nmdc:mga0qj67_433206_c1_455_907 | 150 |
| 631 | 3300050510 | nmdc:mga06r32_100411_c1 | nmdc:mga06r32_100411_c1_1093_1587 | 150 |
| 632 | 3300050510 | nmdc:mga06r32_190951_c1 | nmdc:mga06r32_190951_c1_294_746 | 150 |
| 633 | 3300050510 | nmdc:mga06r32_19965_c1 | nmdc:mga06r32_19965_c1_1149_1601 | 150 |
| 634 | 3300050510 | nmdc:mga06r32_434933_c1 | nmdc:mga06r32_434933_c1_739_1191 | 150 |
| 635 | 3300050510 | nmdc:mga06r32_827733_c1 | nmdc:mga06r32_827733_c1_197_649 | 150 |
| 636 | 3300050511 | nmdc:mga08y16_146228_c1 | nmdc:mga08y16_146228_c1_1078_1572 | 150 |
| 637 | 3300050511 | nmdc:mga08y16_178249_c1 | nmdc:mga08y16_178249_c1_1644_2096 | 150 |
| 638 | 3300050511 | nmdc:mga08y16_445810_c1 | nmdc:mga08y16_445810_c1_599_1051 | 150 |
| 639 | 3300050511 | nmdc:mga08y16_97419_c1 | nmdc:mga08y16_97419_c1_1017_1469 | 150 |
| 640 | 3300050512 | nmdc:mga0n895_116878_c1 | nmdc:mga0n895_116878_c1_2191_2643 | 150 |
| 641 | 3300050512 | nmdc:mga0n895_27822_c1 | nmdc:mga0n895_27822_c1_3927_4379 | 150 |
| 642 | 3300050512 | nmdc:mga0n895_434508_c1 | nmdc:mga0n895_434508_c1_641_1093 | 150 |
| 643 | 3300050513 | nmdc:mga0rr50_1113976_c1 | nmdc:mga0rr50_1113976_c1_155_607 | 150 |
| 644 | 3300050513 | nmdc:mga0rr50_150121_c1 | nmdc:mga0rr50_150121_c1_544_996 | 150 |
| 645 | 3300050513 | nmdc:mga0rr50_209563_c1 | nmdc:mga0rr50_209563_c1_453_905 | 150 |
| 646 | 3300050514 | nmdc:mga08x19_273952_c1 | nmdc:mga08x19_273952_c1_690_1142 | 150 |
| 647 | 3300050515 | nmdc:mga0a205_400377_c1 | nmdc:mga0a205_400377_c1_351_803 | 150 |
| 648 | 3300050516 | nmdc:mga0sz30_17451_c1 | nmdc:mga0sz30_17451_c1_1832_2284 | 150 |
| 649 | 3300053077 | Ga0495601_0301119 | Ga0495601_0301119_136_588 | 150 |
| 650 | 3300053078 | Ga0495612_0116298 | Ga0495612_0116298_279_731 | 150 |
| 651 | 3300053078 | Ga0495612_0134173 | Ga0495612_0134173_39_491 | 150 |
| 652 | 3300053083 | Ga0495655_0018253 | Ga0495655_0018253_518_970 | 150 |
| 653 | 3300053083 | Ga0495655_0040008 | Ga0495655_0040008_46_498 | 150 |
| 654 | 3300053084 | Ga0495595_0203020 | Ga0495595_0203020_10_462 | 150 |
| 655 | 3300053085 | Ga0495619_0007761 | Ga0495619_0007761_304_756 | 150 |
| 656 | 3300053085 | Ga0495619_0073057 | Ga0495619_0073057_558_1010 | 150 |
| 657 | 3300053086 | Ga0500578_0644809 | Ga0500578_0644809_45_497 | 150 |
| 658 | 3300060353 | Ga0501082_0002254 | Ga0501082_0002254_3888_4340 | 150 |
| 659 | 3300060353 | Ga0501082_0020235 | Ga0501082_0020235_2420_2872 | 150 |
| 660 | 3300060353 | Ga0501082_0893467 | Ga0501082_0893467_151_603 | 150 |
| 661 | 3300061734 | Ga0530510_0000247 | Ga0530510_0000247_6583_7035 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9287 | 2 | 148 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9215 | 2 | 148 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9212 | 2 | 147 |
| 3hrd-assembly1.cif.gz_H | crystal structure of nicotinate dehydrogenase | 0.9157 | 2 | 148 |
| 4c7y-assembly1.cif.gz_A | aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide | 0.9151 | 1 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9521 | 82 | 148 | 1.10.150.120 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9419 | 83 | 148 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9407 | 83 | 148 | 1.10.150.120 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9315 | 82 | 148 | 1.10.150.120 |
| 5y6qA02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9284 | 82 | 148 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X0JUW7-F1-model_v4 | Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) | 0.9461 | 1 | 148 |
GO:0046872
GO:0047121 GO:0051537 |
| AF-A0A3D8YFZ6-F1-model_v4 | (2Fe-2S)-binding protein | 0.944 | 3 | 149 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A6J4XA38-F1-model_v4 | Uncharacterized aldehyde oxidase, 2Fe-2S subunit | 0.944 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1I2BQ61-F1-model_v4 | Isoquinoline 1-oxidoreductase, alpha subunit | 0.9439 | 3 | 148 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A095WSE8-F1-model_v4 | (2Fe-2S)-binding protein | 0.9437 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar